Complet list of 3p1a hssp fileClick here to see the 3D structure Complete list of 3p1a.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      3P1A
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-01-05
HEADER     Structural Genomics, Structural Genomic 2010-11-03 3P1A
COMPND     Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory k
SOURCE     Homo sapiens
AUTHOR     Chaikuad, A.; Eswaran, J.; Fedorov, O.; Cooper, C.D.O.; Kroeler, T.; V
SEQLENGTH   281
NCHAIN        1 chain(s) in 3P1A data set
NALIGN       46
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : G3QR05_GORGO        0.97  0.97    1  282   76  362  287    1    6  568  G3QR05     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101154548 PE=4 SV=1
    2 : I3MES0_SPETR        0.94  0.97    1  282   76  362  287    1    6  498  I3MES0     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=PKMYT1 PE=4 SV=1
    3 : G3IFB6_CRIGR        0.93  0.96    1  282   67  353  287    1    6  490  G3IFB6     Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase OS=Cricetulus griseus GN=I79_022437 PE=4 SV=1
    4 : G3V6G8_RAT          0.92  0.95    1  282   67  353  287    1    6  490  G3V6G8     Protein Pkmyt1 OS=Rattus norvegicus GN=Pkmyt1 PE=4 SV=1
    5 : L5KGP5_PTEAL        0.92  0.96    1  282   67  353  287    1    6  490  L5KGP5     Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase OS=Pteropus alecto GN=PAL_GLEAN10011654 PE=4 SV=1
    6 : L8J226_BOSMU        0.92  0.96    1  282   71  357  287    1    6  466  L8J226     Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase (Fragment) OS=Bos grunniens mutus GN=M91_18788 PE=4 SV=1
    7 : M3YUY7_MUSPF        0.92  0.95    1  282   67  353  287    1    6  481  M3YUY7     Uncharacterized protein OS=Mustela putorius furo GN=PKMYT1 PE=4 SV=1
    8 : H9GC14_ANOCA        0.60  0.79    1  281   71  357  288    3    9  574  H9GC14     Uncharacterized protein OS=Anolis carolinensis GN=PKMYT1 PE=4 SV=2
    9 : PMYT1_XENLA         0.58  0.77    1  282   69  356  288    1    7  548  Q91618     Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1
   10 : B7P2H9_IXOSC        0.50  0.67   50  279   13  247  236    2    8  379  B7P2H9     Serine/threonine protein kinase, putative OS=Ixodes scapularis GN=IscW_ISCW015956 PE=4 SV=1
   11 : E9H0C8_DAPPU        0.49  0.72    3  280    1  282  283    3    7  305  E9H0C8     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_12061 PE=4 SV=1
   12 : T1JYP1_TETUR        0.47  0.70    3  281   58  339  284    3    8  548  T1JYP1     Uncharacterized protein OS=Tetranychus urticae PE=4 SV=1
   13 : B4JQK6_DROGR        0.45  0.66    5  281   55  332  282    4   10  427  B4JQK6     GH13714 OS=Drosophila grimshawi GN=Dgri\GH13714 PE=4 SV=1
   14 : Q380Q4_ANOGA        0.44  0.68    7  281   54  333  282    5   10  578  Q380Q4     AGAP001950-PA OS=Anopheles gambiae GN=AgaP_AGAP001950 PE=4 SV=4
   15 : PMY13_CAEBR         0.42  0.66    1  280   75  355  286    4   12  656  Q626B1     Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1
   16 : E1FLV7_LOALO        0.41  0.66    9  281  113  386  276    3    6  788  E1FLV7     WEE protein kinase OS=Loa loa GN=LOAG_01883 PE=4 SV=2
   17 : G0P7K9_CAEBE        0.41  0.67    1  281   76  357  287    4   12  694  G0P7K9     Putative uncharacterized protein OS=Caenorhabditis brenneri GN=CAEBREN_14753 PE=4 SV=1
   18 : B3RKH8_TRIAD        0.38  0.56    6  281  105  323  276    4   58  506  B3RKH8     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_51686 PE=4 SV=1
   19 : B8LBM9_THAPS        0.38  0.63   31  273    1  256  258    6   18  301  B8LBM9     Putative uncharacterized protein (Fragment) OS=Thalassiosira pseudonana GN=THAPSDRAFT_263755 PE=4 SV=1
   20 : E3MX70_CAERE        0.36  0.62   38  281  138  381  250    5   13  458  E3MX70     Putative uncharacterized protein OS=Caenorhabditis remanei GN=CRE_19314 PE=4 SV=1
   21 : H3CTQ9_TETNG        0.35  0.56   35  281  204  479  277    7   32  559  H3CTQ9     Uncharacterized protein OS=Tetraodon nigroviridis GN=WEE2 PE=4 SV=1
   22 : D8RG73_SELML        0.34  0.60   32  282  117  367  256    6   11  372  D8RG73     Putative uncharacterized protein WEE1-1 OS=Selaginella moellendorffii GN=WEE1-1 PE=4 SV=1
   23 : F0ZDP6_DICPU        0.34  0.60    4  280   48  335  291    8   18  355  F0ZDP6     Putative uncharacterized protein OS=Dictyostelium purpureum GN=DICPUDRAFT_29443 PE=4 SV=1
   24 : S2JTD2_MUCC1        0.34  0.61    2  282  262  542  289    5   17  579  S2JTD2     WEE protein kinase OS=Mucor circinelloides f. circinelloides (strain 1006PhL) GN=HMPREF1544_01454 PE=4 SV=1
   25 : E3NQQ1_CAERE        0.33  0.55   42  281   10  250  245    4   10  292  E3NQQ1     Putative uncharacterized protein OS=Caenorhabditis remanei GN=CRE_01475 PE=4 SV=1
   26 : H3AFV4_LATCH        0.33  0.56   35  282  219  491  275    8   30  515  H3AFV4     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
   27 : R9P9U5_PSEHS        0.33  0.52    7  279 1048 1349  317    8   60 2075  R9P9U5     Likely protein kinase OS=Pseudozyma hubeiensis (strain SY62) GN=PHSY_005718 PE=4 SV=1
   28 : G0PDN9_CAEBE        0.32  0.54    9  279  142  416  291    9   37  797  G0PDN9     Putative uncharacterized protein OS=Caenorhabditis brenneri GN=CAEBREN_24476 PE=4 SV=1
   29 : G1NKM8_MELGA        0.32  0.55   31  282  203  482  281    7   31  556  G1NKM8     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100550728 PE=4 SV=2
   30 : G3VFF9_SARHA        0.32  0.52   31  280   84  362  281    8   34  442  G3VFF9     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=WEE2 PE=4 SV=1
   31 : H0ZMZ4_TAEGU        0.32  0.54   31  282   74  353  281    7   31  376  H0ZMZ4     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=WEE2 PE=4 SV=1
   32 : M1AT47_SOLTU        0.32  0.53    5  262   85  339  264    8   16  340  M1AT47     Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400011389 PE=4 SV=1
   33 : D7TP05_VITVI        0.31  0.55    5  281  174  444  283    9   19  452  D7TP05     Putative uncharacterized protein OS=Vitis vinifera GN=VIT_07s0104g01740 PE=4 SV=1
   34 : F6VVH6_MONDO        0.31  0.50   11  282  321  624  305    9   35  705  F6VVH6     Uncharacterized protein OS=Monodelphis domestica GN=WEE2 PE=4 SV=2
   35 : G6DBM3_DANPL        0.31  0.50    2  282  185  472  306   10   44 1238  G6DBM3     Sid-1-like protein2 OS=Danaus plexippus GN=KGM_12385 PE=4 SV=1
   36 : L1J5U9_GUITH        0.31  0.50   41  279   12  259  250    6   14  274  L1J5U9     Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_72782 PE=4 SV=1
   37 : M2XMH3_GALSU        0.31  0.52    9  275  208  472  278    9   25  525  M2XMH3     Wee1-like protein kinase putative tyrosine kinase Wee1 OS=Galdieria sulphuraria GN=Gasu_13270 PE=4 SV=1
   38 : WEE2_AILME          0.31  0.53   31  282  210  491  283    7   33  565  D2HHP1     Wee1-like protein kinase 2 OS=Ailuropoda melanoleuca GN=WEE2 PE=3 SV=1
   39 : D2HGQ1_AILME        0.30  0.46   27  282   42  301  269    9   23  477  D2HGQ1     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_010221 PE=4 SV=1
   40 : G1L1X5_AILME        0.30  0.47   27  282   57  324  270    8   17  482  G1L1X5     Ribosomal protein S6 kinase OS=Ailuropoda melanoleuca GN=RPS6KB2 PE=3 SV=1
   41 : G1S740_NOMLE        0.30  0.53    4  279  280  568  304   10   44  645  G1S740     Uncharacterized protein OS=Nomascus leucogenys GN=WEE1 PE=4 SV=1
   42 : G3T1M8_LOXAF        0.30  0.53    4  279  281  569  304   10   44  646  G3T1M8     Uncharacterized protein OS=Loxodonta africana GN=WEE1 PE=4 SV=1
   43 : I4YBK8_WALSC        0.30  0.49   31  281  125  429  306    6   57  499  I4YBK8     Kinase-like protein OS=Wallemia sebi (strain ATCC MYA-4683 / CBS 633.66) GN=WALSEDRAFT_32795 PE=4 SV=1
   44 : L8I3D9_BOSMU        0.30  0.47   33  265   61  302  245    7   16  356  L8I3D9     Ribosomal protein S6 kinase beta-2 (Fragment) OS=Bos grunniens mutus GN=M91_14031 PE=4 SV=1
   45 : Q0V8L0_BOVIN        0.30  0.48   35  282   17  277  265    8   22  395  Q0V8L0     Mitogen-activated protein kinase kinase kinase kinase 1 OS=Bos taurus GN=MAP4K1 PE=2 SV=1
   46 : S4RVI0_PETMA        0.30  0.45   31  282  164  433  275   10   29  465  S4RVI0     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
## ALIGNMENTS    1 -   46
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   76 A Q              0   0  147   12   45  QQQQQQQRQ     D D                             
     2   77 A L        +     0   0   60   14   60  LPPPPPPLP     T T      P          P           
     3   78 A Q        -     0   0  114   16   68  QHQQQHQQR KR  T T      Q          E           
     4   79 A P        +     0   0   39   19   49  PPPPPAPPP AA  P P     PD          K     AA    
     5   80 A R  E     -A  103   0A  51   22   58  RRRRRRRHQ HQH Q Q     TR       RR P     KK    
     6   81 A R  E     -A  102   0A  45   23   79  RRRRRRRSS TAA L LS    KT       RR A     RR    
     7   82 A V        +     0   0    6   25   48  VVVVVVVVV IVIIV LI    TI  V    SS K     II    
     8   83 A S        -     0   0   36   25   67  SSSSSSSSS SSSST TL    PP  R    KK R     TT    
     9   84 A F  S    S+     0   0  121   28   37  FFFFFFFFF FFFFPFPY    LL  FF   YY L L   II    
    10   85 A R  S    S-     0   0  131   28   75  RRLLCRRHR KKCRHKHT    RA  RR   PS R R   TT    
    11   86 A G        +     0   0   57   29   68  GNGCGDSgS SERlGEGA    tD  Sg   VGgE N   EE    
    12   87 A E        +     0   0  171   17   75  EEEEKQKrP KS.d....    t.  Np   ..k. .   ..    
    13   88 A A  S    S-     0   0   56   18   76  AATTAAAQQ SD.S.K..    K.  GS   ..E. .   ..    
    14   89 A S        -     0   0   74   22   81  SSSSSSSEN DFGRPPPS    N.  HT   ..D. .   ..    
    15   90 A E  S    S+     0   0  115   23   73  EEEEEEEQK SSAAQVQA    T.  GS   ..E. S   ..    
    16   91 A T  S    S-     0   0   84   23   76  TTTTTPTPT ATEEEMPV    T.  HS   ..G. V   ..    
    17   92 A L        +     0   0   10   25   36  LLLLLLLLP LLLLLILV    I.  LA   FFL. I   ..    
    18   93 A Q        +     0   0  152   26   79  QQQQRQQHA ISNSEEEN    HK  EH   NFP. E   ..    
    19   94 A S    >   -     0   0   20   29   53  SSSSSSSSS sKAASTSS    FS  Ts   PPaS R   SS    
    20   95 A P  T 3  S+     0   0   68   17   44  PPPPPPPRK p...PNPP    ..  .p   ..r. .   ..    
    21   96 A G  T 3  S+     0   0   40   22   94  GGGGSGSLL HDDLHYLI    ..  .S   AAH. .   ..    
    22   97 A Y    <   +     0   0   35   24   57  YYYYYYYYY YYTYYYYY    LH  .T   ILV. .   ..    
    23   98 A D    >   -     0   0   60   24   63  DDDDDDDDD NDSNDNDN    TQ  .P   SIT. .   ..    
    24   99 A P  T 3  S+     0   0   97   25   86  PPPPPPPPQ LEMRREHK    QT  .I   GGG. D   ..    
    25  100 A S  T 3  S+     0   0  100   25   73  SSNSNRSTS STSHARKN    KA  .R   NGE. S   ..    
    26  101 A R  S <  S-     0   0  111   27   77  RRRRRRRKK KRCKNFNT    KS  .N   DDR. D   NN    
    27  102 A P  S    S+     0   0  122   30   84  PPPPPPPRG ESNPTRTN    RF  .I   GGTN T PPMM    
    28  103 A E  S    S-     0   0   87   30   74  EEEEEEEED DEKEQSQR    TA  .K   LLSI S EEKK    
    29  104 A S     >  -     0   0   32   30   48  SSSSSSSLT TSSTTSSS    KS  .P   SSSS S RRSS    
    30  105 A F  H  > S+     0   0    4   30   75  FFFFFFFFF FYYYFFFY    SY  .V   RRRR R IIRR    
    31  106 A F  H  > S+     0   0    2   37   31  FFFFFFFFF FFFYFFLFF   TF  .LYYYYYYY YYGGYYF  F
    32  107 A Q  H  4 S+     0   0   87   38   69  QQQQQQQRK RQEEEDEES  RSD  .EQEKRHEN WEPPTTE  E
    33  108 A Q  H  < S+     0   0    3   39   65  QQQQQQQQQ QQQQQQQQA  ENS  .QKKKTTKV QKHHTTKH S
    34  109 A S  H  < S+     0   0    1   40   85  SSNNSSSCC CCCCVTTCD  EDR  ALEEEDDEE DECCEEEC C
    35  110 A F  E  <  -B   54   0A   4   43    0  FFFFFFFFF FFFFFFFFF FFFF FFYFFFFFFF FFFFFFFFYF
    36  111 A Q  E     -B   53   0A 107   43   80  QQQQQHQQK EKEEQSKDN LHDE LTQLLLHHLM ELEEHHFEDV
    37  112 A R  E     +B   52   0A  89   43   87  RRRRRRRQS IIRQINIIN EQYR EITEEEEEEE EELLEEILLE
    38  113 A L  E     -     0   0A  74   44   46  LLLLLLLLI EELLDPDELLLILL LELLLLIILL IVLLLLILLL
    39  114 A S  E     -B   51   0A  55   44   73  SSSSGGGSC AKDTEREKGEEKTG EVEEEEEEEG AERREESRQS
    40  115 A R  E     -B   50   0A 124   44   82  RRRRRRRCK NKKKICIQIPREEV KTTRKKQQKV VKVVKKEVRE
    41  116 A L  E     -     0   0A  80   45   26  LLLLLLLLL IILVIIILLLIIIM ILLIIIIIIILLILLIILLLI
    42  117 A G  E     -B   49   0A  22   46    0  GGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    43  118 A H  E     +B   48   0A 119   46   83  HHHHHHHRR SSEERKRSSKVRESKAQSVVVSDVSKRVKKSSKKGR
    44  119 A G  E >   -B   47   0A  26   46    0  GGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    45  120 A S  T 3  S+     0   0  123   46   63  SSSSSSSSS SSSSSSSSASEDSECEESEAENNAQAEEGGEEENTR
    46  121 A Y  T 3  S-     0   0  103   46   16  YYYYYYYFF FFFFFFFFFYFFFFFFFFFFFFFFFQRFYYFFFYYF
    47  122 A G  E <   -BC  44  66A   0   46   21  GGGGGGGGG GGGGGGGGAGGSAAGGSGGGGSSGGGGGGGGGSGGS
    48  123 A E  E     -BC  43  65A  34   46   72  EEEEEEEEE DNEEEEEEDEAYKRESETSSSRRSRCVTKKSSEKET
    49  124 A V  E     -BC  42  64A  29   46    4  VVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVAVVV
    50  125 A F  E     -BC  40  63A  24   47   23  FFFFFFFYYYFYFFFFFFYFYYFLWFLLYYYFFYAYVYFFFFFFFR
    51  126 A K  E     +BC  39  62A  71   47   42  KKKKKKKKKKRKQKAKAQKGKKKKGKKKKKKKKKRRKKQQKKIQKR
    52  127 A V  E     -BC  37  61A   0   47   59  VVVVVVVVVVVCVVAAAVVGCVAAGCAVCCCVVCAAACVVCCAVAC
    53  128 A R  E     -BC  36  60A  98   47   74  RRRRRRRRQRRIRRRFRKRVVLKRVIVRIIIFLILRRIRRVVCRRR
    54  129 A S  E  >  -B   35   0A   7   47   71  SSSSSSSYSSSSDSCSCNSYKKGCCKSSKKKKKKNNHKKKKKKKES
    55  130 A K  T  4 S+     0   0   97   47   52  KKKKKKKRLRKKRRRKLKKKRRKLRRKRRRRRRRRKRRVVRRRVKV
    56  131 A E  T  4 S+     0   0  118   47   83  EEEEEEEEEEEDSTEDEERGLLMALLSELLLIILLLILQQLLDQVA
    57  132 A D  T  4 S-     0   0   72   47   25  DDDDDDDDDDDDDDDDDDDDDDDTTDTDDDDDDDDDDDggDDegTg
    58  133 A G  S  < S+     0   0   39   47   33  GGGGGGGGGGGGSGSKSGRNGGNNGGGQGGGGGGGGGGggGGsgGe
    59  134 A R        -     0   0  167   47   88  RRRRRRRQCRRKRRRRRQGICCKQRCYKCYCCCYCSGCKKCCGKDP
    60  135 A L  E     +C   53   0A  58   47   61  LLLLLLLLFWMYLLLWLSFKLLLLKLAEVIVMMIVVIVIIIIKILE
    61  136 A Y  E     -CD  52 113A  13   47   18  YYYYYYYYYYYYYYYYYYYYYYYYFYYYYYYYYYYVYYYYYYMYVL
    62  137 A A  E     -CD  51 112A   8   47    5  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAYAAA
    63  138 A V  E     -CD  50 111A   0   47   26  VVVVVVIVVVVIVVVVVVIIIVIIIIVIIIIVVILIIIMMIIAMLV
    64  139 A K  E     -CD  49 110A  41   47    5  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKIKKK
    65  140 A R  E     -CD  48 109A  76   46   73  RRRRRRRRRERKIKVIVVQKRHKK.RRVRRRHHCRAMRVVRRKVMV
    66  141 A S  E     -C   47   0A  12   46   52  SSSSSSSSSASSSSSTSSANSSSS.SMCSSSSSSSVSSLLSSRLVI
    67  142 A M  S    S-     0   0  109   47   80  MMMMMMMVVYRRKKIVIRRVRNKKKRKEKTKTTTLERTRRKKGRKG
    68  143 A S  S    S-     0   0   59   47   71  SSSSSSSESRVEQTAEAERKRRRNSKKKRRRKRRRLKKKKKKKKMK
    69  144 A P  S    S-     0   0   79   47   64  PPPPPPPPPQPRLYPPPKQFPRPSTPARPRPQPRPSPPAAPPPAEQ
    70  145 A F        -     0   0   36   47   63  FFFFFFFFFFFYCFMFIFFKLLIFKLYGLLLLLLVRLFKKLLFKPL
    71  146 A R        -     0   0  223   47   86  RRRRRRRRRRRKRRRRRRRPALWTYAMGAGAHHGAMVAIIAAEIDR
    72  147 A G  S  > S-     0   0   30   47   51  GGGGGGGGGSGGSSQSQNGQGNEGTGGAGGGQQGGSGGVVGGGVDG
    73  148 A P  H  > S+     0   0  113   46   82  PPPPPPPEEMTKESHPHNVDSETWPSPRS.SDDSSRNLRRSSGRDR
    74  149 A K  H  > S+     0   0  183   47   80  KKKKKKKGSKTSHQSASAKRAGSDVTRESSSTTVAKSSNNVVRNVD
    75  150 A D  H  > S+     0   0   18   47   55  DDDDDDDDDDDDDCMDIDDKDDEDDDDADTDDENAMCNAADDDASE
    76  151 A R  H  X S+     0   0   94   47   64  RRRRRRRRRRRRRRSRSRRFERRRSERHENERREERQEKKEERKTV
    77  152 A A  H  X S+     0   0   61   47   84  AATTATAQQQKDAQKEKQELQRNWKQLIQDQRRNREHNDDQQLDLC
    78  153 A R  H  < S+     0   0  159   47   90  RRRRRRRRRNERELYDYVRSLKQLNLRFLLLKKSAEELTTNNRTQR
    79  154 A K  H >< S+     0   0   34   47   77  KKKKKKKKKKKRRCRKRKAEAAHQFARFATAAAAAAAAAAAAQAKE
    80  155 A L  H >X S+     0   0   11   47   50  LLLLLLLLLLLLLLELEAMVLLILLLLKLLLLLLLALLHHLLLHEA
    81  156 A A  H 3X S+     0   0   44   47   87  AAAAAAAAQQEQEEARAITRKRQIKREVRRRMMRNHRHTTRRNTIC
    82  157 A E  H <> S+     0   0   26   47   36  EEEEEEEEEEEEEEEEEYEGEEEEEEESEEEEEEEEEERREEERLV
    83  158 A V  H <> S+     0   0    1   47   37  VVVVVVVVVVVVVVSVLSVFVVIVAVVIVVVVVVVVVVAAVVPAIL
    84  159 A G  H  X S+     0   0    8   47   96  GGGGGGGRRARARRHQHNQMYQEERYDHYYYQQYYRQYEEYYVELR
    85  160 A S  H  X S+     0   0   10   47   83  SGGGGGGKKKKKRRMKMRTGAANHMAIEAAAAAAAVIARRAATRKS
    86  161 A H  H  X S+     0   0   14   47   75  HHHHHHHHHHMHYYIHLTMVHLGLFHlNHHHLLHHLLHnnHHLnTL
    87  162 A E  H  < S+     0   0   45   40   75  EEEEEEEEEEEEEE.E..Q.ASMRQAt.AAAAAAASVAllAASl..
    88  163 A K  H  < S+     0   0   68   40   88  KKKKKKKRRCSQEQ.L..R.VCKKRVS.VVVAVVARAVEEVVKE..
    89  164 A V  H  < S-     0   0    2   42   49  VVVVVVVVVLLLLFILI.Y.LLLVILG.LLLLLLLLLLSSLLLS..
    90  165 A G     <  -     0   0   35   44   56  GGGGGGGGGPPPSSPPP.GPGGGQPGK.GGGGGGGRGGVVGGPVC.
    91  166 A Q        +     0   0  162   45   80  QQQQQQQYEPHGGDPKP.LAHYFHRHP.HQHPSQKHGHKKQQEKRS
    92  167 A H    >   -     0   0   49   45   17  HHHHHHHHHHHHHHHHH.YHHHHSSHH.HHHHHHHEHHHHHHHHHH
    93  168 A P  T 3  S+     0   0   90   44   52  PPPPPPPPPPPPQEKPK..PPENQPPA.PPPEEPEHPPPPSFPPAP
    94  169 A C  T 3  S+     0   0    2   44   66  CRHHHRRNNNNNNNNNN..NHNNHYHN.HHHNNHHVNHFFHHNFNQ
    95  170 A C  B <  S-f  174   0B   3   46   59  CCCCCCCCCCCLCCLLL.LIVVICIVILVVVVIVLIIVIIVVIIIV
    96  171 A V        -     0   0   13   46   31  VVVVVVVVLVVVVVVIV.LLVVALLVVMVVVVVVVRTVVVVVIVVP
    97  172 A R        -     0   0   74   46   64  RRRRRRRSRRRKRKKSR.FKRRQNKRSKRRRGGRRYQREERRKEAR
    98  173 A L  E     - E   0 112A  32   46   35  LLLLLLLFFFFFFLFFF.FFYYVMYYLMYYYYYYYLYYLLYYLLYL
    99  174 A E  E     -     0   0A  79   46   81  EEEEEEEVVIYYIYYVY.IIYFLIFYFFYYYYYYYSFYAAFFNAHL
   100  175 A Q  E     - E   0 111A  43   46   85  QRQRRQQQRKQKRQRRR.RRSSCNKSDYSSSSTSSSNSYYSSDYGH
   101  176 A A  E     + E   0 110A   3   46   31  AAAAAAAAAAAAAAAAA.AGASAASAAAAAASSAAFSAAAAAYASA
   102  177 A W  E     -AE   6 109A   0   45    3  WWWWWWWWWWWWWWWWW.WWWWWWWWWWWWWWWWW.WWFFWWWFYF
   103  178 A E  E     +AE   5 108A  18   46   70  EEEEEEEEEEEEEEEEV.QVAFEEVAEEAAAFFAAQLAQQAAEQLE
   104  179 A E  E >   - E   0 107A  35   46   32  EEEEEEEEEEEEQQEEE.EDEEEEDEEEEEEEEEEEEETTEEDTWG
   105  180 A G  T 3  S-     0   0   43   46   67  GGGGGGGCKNNNNDTYT.NGDNGKSEQKDDDNNDDGNDGGDDNGLP
   106  181 A G  T 3  S+     0   0   10   46   55  GGGGGGGGRCQGCDDGD.GEDDGGDDGADDDEEDDMEDGGDDNGQA
   107  182 A I  E <   - E   0 104A  25   46   88  IIIIIIIQMRFYRRRFR.YAHFHYQHHQHHHHKHHTTHKKHHRKKA
   108  183 A L  E     - E   0 103A   8   46   17  LLLLLLLLLLLLLLLLL.FVMLILVMLVMMMLLMMLIMLLMMLLLF
   109  184 A Y  E     -DE  65 102A  14   46   41  YYYYYYYYYYYYFYYYY.FYIYYYFIHFIIIYYIIYYIYYLLYYWM
   110  185 A L  E     -DE  64 101A   3   46   29  LLLLLLLILIIIVMIII.CLIIIIIILLIIIIIIIIIILLIIILIL
   111  186 A Q  E     +DE  63 100A   3   46   33  QQQQQQQQQQQQQQQQQ.QQQQQQQQQQQQQQQQQVQQIIQQQICV
   112  187 A T  E     -DE  62  98A  27   46   75  TTTTTTTTTMLTMMTTT.TTNMMLTSLLNNNMMNNTLNLLNNTLMQ
   113  188 A E  E     -D   61   0A  42   46    1  EEEEEEEEEEEEEEEEE.EEEEEEDEEEEEEEEEEEEEEEEEEEEE
   114  189 A L        +     0   0   53   46   53  LLLLLLLLLLLLLLLLL.LIYLLLLYLMHYHLLYYIYYCCYYLCFL
   115  190 A C        -     0   0   33   46   30  CCCCCCCCCCCCCCCCC.CCCCCCCCCCCCCCCCCACCLLCCCLCV
   116  191 A G        -     0   0   33   46   68  GGGGGGGPAHQDRREQE.sQdEesHnpgnnnDDndesnssnnesge
   117  192 A P        -     0   0   66   41   80  PPPPPPP.G.SC.EQCQ.p.aTdgMdftqqqH.qggsqggddvggp
   118  193 A S  B  >  -G  165   0B   7   44   70  SSSSSSSGSSSSENSSS.S.DNASNAFRDADS.ASTTTEEAAFESR
   119  194 A L  H  > S+     0   0    1   45   48  LLLLLLLSLNLLSLLLL.TRALLLLILLVAVL.ALMLALLIILLLL
   120  195 A Q  H  > S+     0   0   72   46   89  QQQQQQQLQMSSLEQLQ.GDIRNESADQLVLSHVQYMIFFSSDFQL
   121  196 A Q  H  > S+     0   0   92   46   77  QQQQQQQLQTEELVQDQ.DLSDLKDDENLSLNSSQENSTTEEDTDD
   122  197 A H  H  X S+     0   0   34   46   87  HHHHHHHQHAIFQYYYY.SLQEAFYNYGEEEKLEKMDEHHNNYHIY
   123  198 A C  H  X S+     0   0   17   46   92  CCCCCCSYSYSLYACKC.ASKSVMSRGVNNNKSNMIINLLYYGLYL
   124  199 A E  H  < S+     0   0  125   46   78  EEEEEEECEAEELRSML.NHELQQKNDEAEAYIEEKITEERRMEQV
   125  200 A A  H  < S+     0   0   88   46   85  AAAATAAEEEEISEVKI.VSVAEFNEQEKKKSKRARPKRRISHRVK
   126  201 A W  H  < S-     0   0  126   46   94  WWWWWWWKFEQNRQQVK.QKQWEKGEVPHLLKRLGQSSEEMMFETQ
   127  202 A G     <  +     0   0   56   46   68  GGGGGGGYAHHHCQHGH.NDGTgNPQGDGGGLsGPTIGGGSSEGGG
   128  203 A A  S    S-     0   0   45   23   84  AAAATATGGH..R.....R.E.gR....QRQ.hR.R.N........
   129  204 A S        -     0   0   53   40   96  SSSSSSGPSDEDQQAIA.LGL.KS.YA.YFY.LF.M.HIIYYRISL
   130  205 A L        -     0   0    7   44   29  LLLLLLLLLILIILLIL.LLFFLVTFL.FFFFFFLL.FFFFFLFLA
   131  206 A P    >>  -     0   0   56   44   71  PPPPPPPPPPPAPPPPP.PQSTPSEED.PQTSTEPQ.QLLKKELST
   132  207 A E  H 3> S+     0   0   50   44    5  EEEEEEEEPEEEEDEEE.EEEEEEEEE.EEEEEEEE.EEEEEEEEE
   133  208 A A  H 3> S+     0   0   88   45   85  ATAAATAWRRHPKENKK.REPKYDIAP.TPGVGPSKDPDDAATDLR
   134  209 A Q  H <> S+     0   0   49   45   68  QQQQQQQQRALMRREDE.AEEKIQEER.KEEEEEEQEKTTEERTQK
   135  210 A V  H  X S+     0   0    0   46   37  VVVVVVVVVIIVIIILI.IIVLIVVLVILLLVVLLVLLAALLVAIV
   136  211 A W  H  X S+     0   0   51   46   72  WWWWWWWRWWWWWWWWW.WWKTWWWKWWKKKLLKLWFKCCKKWCSA
   137  212 A G  H  X S+     0   0   28   46   87  GGGGGGGVNNDNHSNLN.QSDEQGWEKTENEEENLKRDFFDDKFYG
   138  213 A Y  H  X S+     0   0   12   46   62  YYYYYYYFIYYFIIIFI.VILAYIVIVIIMIAAMIYIIYYLLIYVY
   139  214 A L  H  X S+     0   0    0   46   32  LLLLLLLLTLMLLLFFS.CLLMLFLLLLLLLMMLLVMLLLLLLLCV
   140  215 A R  H  X S+     0   0   61   46   93  RRRRRRRWCVIALLVGV.HSLFYHKLAMLLLYHLAIRLAALLGSRR
   141  216 A D  H  X S+     0   0    5   47   43  DDDDDDDDDDDDDDDDDLDDQQDKDQEMQQQQQQHQNQEEQQDEED
   142  217 A T  H  X S+     0   0    2   47   54  TTTTATTLLLLLLLLILRIIVLVILVLLVIVVIIVTIIIIVVIIVT
   143  218 A L  H  X S+     0   0    0   47   78  LLLLLLLLLLLLLLLALNSLSLAVLSSASSSAASAATSTTGGATLL
   144  219 A L  H  X S+     0   0   39   47   80  LLLLLLLQHQLSRLELQERKMNQLRMSQMMMKKLDLSLLLRRELQG
   145  220 A A  H  X S+     0   0    0   47   32  AAAAAAAGGGAAGAAAAGGGGAGGGGGGGGGAAGGGAGAAGGGAGI
   146  221 A L  H  X S+     0   0    0   47   12  LLLLLLLLLLILLLVVVLLLLLLILLVLLLLLLLLLLLLLLLVLLL
   147  222 A A  H  X S+     0   0   13   47   80  AADDAAARKKQKKKHRHKFSKKANEKAEKKKQQKALCKGGRKKGAC
   148  223 A H  H  X S+     0   0   40   47   54  HHHHHHHHHHHHSSHYHHHHYHHDHYYHYYYFFYYHFYHHYYFHYY
   149  224 A L  H ><>S+     0   0    0   47   27  LLLLLLLLLLLLLLLLLLILILVILIILIIIITIIIIILLIILLLL
   150  225 A H  H ><5S+     0   0   29   47    0  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
   151  226 A S  H 3<5S+     0   0   82   47   57  GGSSSGGDDDDEDDSSSDSDSSETRSNSNHNQEQSSSSSSSSASSS
   152  227 A Q  T <<5S-     0   0   86   47   81  QQQQQQQHRHNRRRNHLFHSSHKAATHHSSSRKSQQKSQQMMCQQC
   153  228 A G  T < 5S+     0   0   26   47   44  GGGGGGGNNNDDNNDEDGGGGGGDNGGGGGGGGGQRGGGGSSGGKN
   154  229 A L  E   < -I  182   0C   3   47   34  LLLLLLLLLLLLLLMLMSMFLLIILLIVLLLVILLIIMIILLIIKV
   155  230 A V  E     -I  181   0C   0   47   45  VVVVVVVLLIIIIIILIVVLVAMALVLIVVVGAVVLVVIIVVWIIA
   156  231 A H        -     0   0    0   47   11  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHYYHHHYHH
   157  232 A L        +     0   0   12   47   55  LLLLLLLMLLMLLLDLDMYNLLLLNLLNLLLLLLMRMLRRMMLRRL
   158  233 A D        +     0   0   27   47    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   159  234 A V        +     0   0    0   47   22  VVVVIVVIIIVIIIIIIIILIVILIILVIIIVVIVVVILLIILLIV
   160  235 A K  S >  S-     0   0   34   47    0  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
   161  236 A P  G >  S+     0   0    1   47   17  PPPPPPPPPPPPLLPPPPPPPPPPPPPPPPPPPPPTPPPPPPPPGP
   162  237 A A  G 3  S+     0   0   27   47   63  AAAAAAAAADEDDDEQDASESDESESAESSSDDSGMESEESSAEAE
   163  238 A N  G <  S+     0   0   10   47    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   164  239 A I  E <   - H   0 174B   0   47   16  IIIIIIIIVIIIVIIIIIIIIILICIVCIIIIIIIIVIIIIIIIIL
   165  240 A F  E     -GH 118 173B  43   47   20  FFFFFFFFFFLFLLFMFFFLFYLLLFLLFFFYYFFFLFMMFFFMLL
   166  241 A L  E     - H   0 172B  19   47   29  LLLLLLLLIILIIVLVLVFLIIFILIILIIIVVIILIILLIIVLIL
   167  242 A G    >   -     0   0   27   47   70  GGGGGGGSSSSSGTTSTSVGCRSDSCTGCCCKKCCTSCNNSSTSNE
   168  243 A P  G >  S+     0   0  120   47   89  PPPPPPPSFNMKADKFRKSVHKNDTWEMHKHNDRTKKHSSRRASDC
   169  244 A R  G 3  S-     0   0  105   47   74  RRRRRRRNSEEDDDHDHdnDpGDQGehdkkkGGkdTGkQQttnQAR
   170  245 A G  G <  S+     0   0   40   47   43  GGGGGGGNGGGGEGKGKvtGgVGGGggggigVVggGVeGGggnGGa
   171  246 A R    <   -     0   0  114   42   86  RRRRRRRVVLVLKTIII.IIv.VRFvgdmmv..ikD.mHHimvHEs
   172  247 A C  E     - H   0 166B   2   47   69  CCCCCCCCCCCFWCCCCCCWYYLLWYHSYYYYYYYVHYIIFFLIVV
   173  248 A K  E     - H   0 165B  47   47   16  KKKKKKKKKKKKKKKKKKKKKKKKKKADKKKKKKKKKKKKKKEKRR
   174  249 A L  E     +fH  95 164B   0   47   26  LLLLLLLLLLLLLLLLLLILIIIILILLIIILLIILLILLIISLLL
   175  250 A G        +     0   0    0   47   29  GGGGGGGGGGGGSAGGGGGGGGGGAGDDGGGGGGGGGGTTGGSTAV
   176  251 A D        +     0   0   64   47    4  DDDDDDDDDDDDDDDDDDDDDDDDDDQGDDDDDDDDDDDDDDDDDD
   177  252 A F    >   +     0   0    0   47   22  FFFFFFFFFFFFFFFFFFFFLFFFFLVTLLLFFLLLFLFFLLGFFF
   178  253 A G  T 3  S+     0   0   35   47    9  GGGGGGGGGGGGGGGSGGGGGGGGGGAGGGGGGGGGGGGGGGVGGG
   179  254 A L  T 3  S+     0   0   48   47   72  LLLLLLLLLLLLLILLLLLHHLVICHEAHLHCCLHVLHLLHHELID
   180  255 A L    <   -     0   0   14   47   71  LLLLLLLMMVVVVVVIVMALVACSCVAMVVVAAVVAAVCCVVECSC
   181  256 A V  E     -I  155   0C  27   47   81  VVVVVVVLVVVVIFIVINGTTCSVSTWKTTTTTTTKCTKKTTDKAL
   182  257 A E  E     -I  154   0C 112   47   82  EEEEEEEEERNKDDNDNEDVSRSRVSPGSSSLLSCILSEERRDEQR
   183  258 A L              0   0   69   47   65  LLLLLLLLLLLALLLILSIITIATSASDIIILLIILSISSIIISIV
   184  259 A G              0   0  128   47   73  gggggggdddksdtkqkDgssdnpsshKaqtddqsddsiisssigs
   185      ! !              0   0    0    0    0  
   186  266 A V              0   0  110   46   74  vaaaaaaaapavaaaeaCggvigkgve.vvviivvtevttvvetsq
   187  267 A Q        -     0   0   51   47   77  QQQQQQQQQVTTTTEEEQQDEEDGDERMEEEEDEEMQEFFEERFFP
   188  268 A E        -     0   0  171   47   38  EEEEEEEEEEEEEEEEEEEEEDEEEEEDEEEEEEEVEECCEEECIC
   189  269 A G        -     0   0   22   47    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   190  270 A D    >>  -     0   0   26   47   25  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDTDDTTDDDTTV
   191  271 A P  G >4 S+     0   0   64   47   72  PPPPPPPPPASPSSSGSSTASSQRGIRSRSRAASCPKSIISSRIPP
   192  272 A R  G 34 S+     0   0   70   47   55  RRRRRRRRRRKKRRKKKKARRRVRRRVRRRRRRRRYRREERREEYE
   193  273 A Y  G <4 S+     0   0    8   47    3  YYYYYYYYYYYYYYYYYYYYFYYYYFYYFFFYYFYYYFYYFFYYWF
   194  274 A M    <<  -     0   0   31   47   15  MMMMMMMMMMLLMMLLLLMLLLMMILLLLLLMMLLLLLMMLLLMMS
   195  275 A A    >   -     0   0    0   47   20  AAAAAAAAAAAAAAAAAAPAAPAAAAAAAAAPPAPSCAAAAAAAAA
   196  276 A P  G >  S+     0   0   20   47   52  PPPPPPPPPPPKPPPPPPNPSMPPPNpPNNNQQNKPRNPPNNPPpP
   197  277 A E  G > >S+     0   0   11   47   15  EEEEEEEEEEEEEEEEEEEEEEEDEEvEEEEEEEEESEEEEEEEvE
   198  278 A L  G X 5S+     0   0   37   47   36  LLLLLLLLLLVLILVVVVLVVLLLVIIAIVIIIIVLMIIIVVIIAL
   199  279 A L  G < 5S+     0   0  107   47   14  LLLLLLLLLMLMLMLLLLLLLILLLLFMLLLLLLLCLLLLLLLLLV
   200  280 A Q  G < 5S-     0   0  144   47   67  QQQRQQQHDNGQQENQNQSGHNNRAQEEQQQNNQQEDQVVQQRVKL
   201  281 A G  T < 5 +     0   0   42   47   54  GGGGGGGGGGGGGGGSGGTdedDEteGGeeeedeegperreeGrGg
   202  282 A S      < -     0   0   63   46   95  SSSSSSSEIDIKQTKGRSCtyh.NtyQTyyyyyyfatyggyyNgGs
   203  283 A Y        +     0   0  116   47   90  YYYYYYYYFFFFFYPAPFVPSSIFPTYPFRCDDRTYAQHHTTYHYV
   204  284 A G  S >  S-     0   0   18   47   82  GGGGGGGTSTSTTTTRTGKSNHRDTHGAHFYHHYHNDHNNHHSNNG
   205  285 A T  T >> S+     0   0   49   47   85  TTTTTTTKKKKKKKFKKKHKLLTKKLKKLLLLLLLEFLRRLLHREP
   206  286 A A  H 3> S+     0   0   21   47   54  AAAAAAAAAAKAAAAPAPPAPDPPAPAPPPPDDPTKKPAAPPAALA
   207  287 A A  H <> S+     0   0    1   47   71  AAAAAAAAAAAAAASSSAgAkkaASkAWkkkkkkkSskVVkkAVCA
   208  288 A D  H <> S+     0   0    0   47    0  DDDDDDDDDDDDDDDDDDdDdddDDdDDdddddddDddDDddDDDD
   209  289 A V  H  X S+     0   0    1   47   35  VVVVVVVIVVIIIIIIIIIVIMIIVIVVIVIIMVIVIIWWIIIWIV
   210  290 A F  H  X S+     0   0    0   47    3  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFWFFWWFFFWWW
   211  291 A S  H  X S+     0   0    7   47   29  SSSSSSSSSSSSSSSSSSSSASSSSASSAAASSAASAASSAASSSS
   212  292 A L  H  X S+     0   0    0   47    9  LLLLLLLLLLLLLLLLLVLALLLLLLLLLLLLLLFLLLLLLLLLLV
   213  293 A G  H  X S+     0   0    0   47    8  GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGAGGGGGGGGGAAGGGG
   214  294 A L  H  X S+     0   0    0   47   51  LLLLLLLIMIIIIIVMVILMLAILLLLVLLLAALLCALAALLLAIV
   215  295 A T  H  X S+     0   0    0   47   47  TTTTTTTTSTTTAATTTTTSTTTITTITTTTAATTVTTLLTTILTL
   216  296 A I  H  X S+     0   0    1   47   48  IIIIIIIILILTITIMITLLVFLLVMMMTIVIIMLLMIMMVVIMAA
   217  297 A L  H  X S+     0   0    0   47   56  LLLLLLLLLLLLLLLVLFYLLYYLLALLAAAYYAFYLAYYVVLYIY
   218  298 A E  H  X>S+     0   0   35   47   51  EEEEEEEEEEEEEEEDEEEELEEEELEELVLEEVEEEVDDCCEDEV
   219  299 A V  H  <5S+     0   0    3   47   59  VVVVVVVIVLLLLLAIALIIALMLIAVVAAALLAALIAMMAAAMLM
   220  300 A A  H  <5S+     0   0   11   47   41  AAAAAAAAAAAAAAACAAAVAAAATAAAAAAIIAGCAALLAAALAL
   221  301 A C  H  <5S-     0   0    9   47   70  CCCCCCCCCCCCCCTTTCATGRTTTGATGGGRRGGTTGTTGGCTES
   222  302 A N  T  <5 +     0   0   86   47   73  NNNNNNNNNDDDYNDDDDSCARNGYANDAATGGAGFGAGGAANGLG
   223  303 A M      < -     0   0    8   47   82  MMMMMMMMMLLLMLLLLVVISSYVLEVVGKASSKGKKESSEEISQV
   224  304 A E        -     0   0  178   47   76  EEEEEEEEEEDEDEDEDEdQPPNVYPEWPSPSHSPHSSAPPPVAps
   225  305 A L        -     0   0    4   44   17  LLLLLLLLLLLVLLVLVLvMLLLLMLLLLLLLLLL.LL..LLLSfl
   226  306 A P        -     0   0   38   46   13  PPPPPPPPPPPPPPPPPPPPPPPPVPPPPPPPPPPPPP.PPPPPDE
   227  307 A H  S    S-     0   0  150   46   86  HHHHHRHNKGASSPSTSSRSQAKGAQDTHTHEETKFTT.FRRGAVD
   228  308 A G  S  > S+     0   0   33   46   62  GGGGGGGGGQNNNNNTSREGNSKTNNNNNNNSSNNESN.TNNNSHS
   229  309 A G  H  > S-     0   0   53   47   22  GGGGGGGGGGGGGGGGGGGGGGGGGDGGGDGGGDGAGGSAGGGSpa
   230  310 A E  H  > S+     0   0  148   46   61  EEEEEEEEDETNPRDDDEDEDSQEAQDDAEAPYEPAEA.EDDEGvt
   231  311 A G  H  > S+     0   0   28   46   84  GGGGGGGGGHLGLMALAGRSEQMSEASGMPLHQLQNEA.NQQPGLC
   232  312 A W  H  X S+     0   0   18   46   14  WWWWWWWWWWWWWWWWWWWRWYWWRWWWWWWFFWWHWW.RWWWRFL
   233  313 A Q  H >< S+     0   0   90   46   53  QQQQQQQQQHHHHQHQHHHQHQREQHQQHHHLLHHGQH.KHHQPLN
   234  314 A Q  H ><>S+     0   0   60   47   76  QQQQQRQQQSEQERQGQQESRANMAHRDHRHNNHAAKHPKEEKPMI
   235  315 A L  H 3<5S+     0   0   10   47   43  LLLLLLLLLLLLLLIFILLILILLIILIIIIILIYLIIATIILFTS
   236  316 A R  T <<5S+     0   0   12   47   31  RRRRRRRRRRRRRRRRRRRLRRRRLRRRRRRRRRRVRRSMRRRTKR
   237  317 A Q  T < 5S-     0   0  132   47   76  QQQQQQQQQTHENNNFNSRNEQELNKHNKRKEEQDLNELDQQSASL
   238  318 A G  T   5S+     0   0   58   47   34  GGGGGGGGGGGGGGGKGGGNGGGGGGDDGGGGGGGKNGGKGGLEGD
   239  319 A Y      < -     0   0  100   47   91  YYYYYYYYHTSKKQQRQESEKKKDQNDRNNNKKNHIDKGIRRDNYY
   240  320 A L        -     0   0   22   47   50  LLLLLLLLLLLMLPIIILHVLLIFILLIILVLLLLVVLRILLFRQC
   241  321 A P    >>  -     0   0   19   46   50  PPPPPPPPPPPPPLPYPPVP.APSPPSPPPPPPPPRDPAKPPSKPF
   242  322 A P  H 3> S+     0   0   69   47   77  PPPPPPPPTAPEDPEHPEPEPLFKNAERSAPLLDGGQDPGRREKPP
   243  323 A E  H 34 S+     0   0  143   47   88  EEEEEEEEEDTHEEREREEKTLPQRVVSILILLLLRGIPKIICTRE
   244  324 A F  H <4 S+     0   0   98   47   83  FFFFFFFFFVIFFLFFFFIFLPEKFPDLPPPPPPPYFPFLPPPMLH
   245  325 A T  H >< S+     0   0    0   47   92  TTTTTTTTTVTFILFIFTPFPGDGFQLYQQQGGQQLLQTTQQFDKY
   246  326 A A  T 3< S+     0   0   81   47   89  AAAAAAAASTRNNAVKVKTRQFDVKKSPKKKHYELPQKALVVDKDF
   247  327 A G  T 3  S+     0   0   77   47   87  GGGGGGGDDEHKTRGDGDSGESDLSLEELLLSSLSIQLEPLLNIKA
   248  328 A L  S <  S-     0   0   19   47   85  LLLLLLLLLILLLKIVIIRYLLASVTIGPSPLLSRPRSNPSSLIGD
   249  329 A S     >  -     0   0   32   47   75  SSSSSSSSPSSTSVSPSSSSSVIKSNSRNKHQQEESCERYQQSRKV
   250  330 A S  H  > S+     0   0   90   47   87  SASSSSSAPPKPVsSPPSDKSFilLGGsGDHfFDFsgEklEELGws
   251  331 A E  H  > S+     0   0  112   35   62  EEEEEEEEDDDEEaDAIESDP.deE.Pd...n...vr.td..A.aq
   252  332 A L  H  > S+     0   0    0   43   24  LLLLLLLLFLLLLLLLLLLLF.LMLFMLFFFL.F.MLFMAFFL.FA
   253  333 A R  H  X S+     0   0   82   47   86  RRRRRRRRLRSRQKRLQKGQRQKSRTLKIYLLQYNTSYDRTTVKHK
   254  334 A S  H  X S+     0   0   65   47   76  SSSSSSSTKDAKQDVDDLKGASNEGSRAENEKNNQRANKDEEDLNE
   255  335 A V  H  X S+     0   0    4   47   32  VVVVVVVLVLVVVILILLLLLLLMLLVLLLLVLLLILLILLLLEFF
   256  336 A L  H  X S+     0   0    0   47   27  LLLLLLLLLVMIIIIVIIIILIIILLLILLLLLLLVILIVLLILVI
   257  337 A V  H  < S+     0   0   80   47   79  VVTTIVTASQELKHELKMQGQKLEGEEDKKKTKKKDRKKKKKKPKT
   258  338 A M  H  < S+     0   0   80   47   90  MMMMMTMAARMNCSQLSSLLSSRWLLRQLYLSACKDWNGKVVAPVA
   259  339 A M  H  < S+     0   0    0   47   36  MMMMMMMMMMMMMMMLMMMMLLMLMLLMMMMSMMMCCMKFMMMYTL
   260  340 A L  S  < S+     0   0    7   47   31  LLLLLLLLLMMMMMILLILILMMLKILTIIILLIVLLILLIILLLL
   261  341 A E        -     0   0   61   47   73  EEEEEEEEEHNHTRNEDDQHHHDTHHCFHHHLDHDQAHTKHHDTTR
   262  342 A P  S    S+     0   0   42   47   50  PPPPPPPPPPPPPPKTKPPRPPPTLASRPPPPPPPKSPLRPPPPKG
   263  343 A D  S >> S-     0   0   64   46   38  DDDDDDDNDDDDDVEDDIDDDADEDDDDDKD DKDDDDPNDDNDSS
   264  344 A P  T 34 S+     0   0   43   46   32  PPPPPPPPYPAYPPPPPPAPVAPAPPPPPPP PPPVPPPPPPPAPP
   265  345 A K  T 34 S+     0   0  187   46   82  KQQQKKKQRISKQTMSLNKQTKAKGVEKMEA VESRMRYSEEERKG
   266  346 A L  T <4 S+     0   0  123   45   82  LLLLLLLHRQNRQEKKKKQSKNKEAAQAEEQ QEQSKELQRRN KK
   267  347 A R  S  < S-     0   0   13   45    5  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRTRRRR RR
   268  348 A A        -     0   0   21   45   45  AAAAAAAPAIPWPPPPPIPPPPIPPPAPPPP PPPPPPPIPPP PP
   269  349 A T     >  -     0   0   80   45   49  TTTTTTTSTSSTTTTTTTSTSSTTNTSTSTS STSTTSDGSSS SR
   270  350 A A  H  > S+     0   0    3   45   45  AAAAAAAVVVAAAVSASVAATAIVCAICAAA AAATAAAGAAA AA
   271  351 A E  H  > S+     0   0  130   45   70  EEEEQESEDDSEEDDEQDEKKAQQAAEETAT KAAEEARAMMY TQ
   272  352 A A  H  4 S+     0   0   53   45   69  AAAVAAATWQQEQVAETQDEEQGDEAEEAAA ESREEADPAAQ KA
   273  353 A L  H >< S+     0   0    2   45   34  LLLLLLLLLLLLLLLILLILLALICLILLLL LLLLLLLGLLI MC
   274  354 A L  H 3< S+     0   0   23   44   57  LLLLLLLLLLLLLLRCLL LCLLMLAVLTVT VTRLLAVDVVL LL
   275  355 A A  T 3< S+     0   0   65   44   76  AAAAAAAASAEEAKKCAA AKKKQDKEWKRK ERRRQRKAKKQ TK
   276  356 A L  S X  S-     0   0   55   43   78  LLLLLLLSLHHYDHHIHH HHNIHHHLHHNH NNHS SKAHHH HQ
   277  357 A P  G >  S+     0   0   95   43   57  PPPPPPPSPPPPPPLPAE PVADPPPPPPTP PTAP RFDSSP QA
   278  358 A V  G 3  S+     0   0   71   43   71  XMMMMVMLARLPVMSMSY MVLKSTATGIVV IILL VLVVVI LW
   279  359 A L  G <  S+     0   0    4   43   34  XLLLLLLIIILILLIIML ILFLFVLLILIL FLLL LKQLLL VL
   280  360 A R  S <  S-     0   0  152   37   60  RRRRRRRRR RSTQRAKK QRKQVKR  RRR DRH  RRR  N SA
   281  361 A Q              0   0   71   33   67  QQQQQQRRN  RRK KRQ NEK NRR  P R RPP  PNH  N QS
   282  362 A P              0   0  189   21   49  PPPPPPP A            S A A  S S  SA  SPP    PP
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1   76 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   8   0  75   0   0  17    12    0    0   0.721     24  0.54
    2   77 A   0  21   0   0   0   0   0   0   0  64   0  14   0   0   0   0   0   0   0   0    14    0    0   0.892     29  0.40
    3   78 A   0   0   0   0   0   0   0   0   0   0   0  13   0  13  13   6  50   6   0   0    16    0    0   1.473     49  0.32
    4   79 A   0   0   0   0   0   0   0   0  26  63   0   0   0   0   0   5   0   0   0   5    19    0    0   0.951     31  0.50
    5   80 A   0   0   0   0   0   0   0   0   0   5   0   5   0  14  50   9  18   0   0   0    22    0    0   1.427     47  0.41
    6   81 A   0   9   0   0   0   0   0   0  13   0  13   9   0   0  52   4   0   0   0   0    23    0    0   1.432     47  0.21
    7   82 A  52   4  28   0   0   0   0   0   0   0   8   4   0   0   0   4   0   0   0   0    25    0    0   1.285     42  0.51
    8   83 A   0   4   0   0   0   0   0   0   0   8  56  16   0   0   8   8   0   0   0   0    25    0    0   1.353     45  0.32
    9   84 A   0  14   7   0  61   0  11   0   0   7   0   0   0   0   0   0   0   0   0   0    28    0    0   1.197     39  0.63
   10   85 A   0   7   0   0   0   0   0   0   4   4   4  11   7  11  43  11   0   0   0   0    28    0    0   1.815     60  0.25
   11   86 A   3   3   0   0   0   0   0  34   3   0  14   3   3   0   3   0   0  17   7   7    29    0    0   2.009     67  0.31
   12   87 A   0   0   0   0   0   0   0   0   0  12   6   6   0   0   6  24   6  29   6   6    17    0    0   1.952     65  0.24
   13   88 A   0   0   0   0   0   0   0   6  33   0  17  11   0   0   0  11  11   6   0   6    18    0    0   1.879     62  0.23
   14   89 A   0   0   0   0   5   0   0   5   0  14  41   5   0   5   5   0   0   5   9   9    22    0    0   1.916     63  0.19
   15   90 A   4   0   0   0   0   0   0   4  13   0  17   4   0   0   0   4  13  39   0   0    23    0    0   1.748     58  0.26
   16   91 A   9   0   0   4   0   0   0   4   4  13   4  43   0   4   0   0   0  13   0   0    23    0    0   1.788     59  0.24
   17   92 A   4  68  12   0   8   0   0   0   4   4   0   0   0   0   0   0   0   0   0   0    25    0    0   1.105     36  0.64
   18   93 A   0   0   4   0   4   0   0   0   4   4   8   0   0  12   4   4  27  19  12   0    26    0    0   2.118     70  0.21
   19   94 A   0   0   0   0   3   0   0   0  10   7  66   7   0   0   3   3   0   0   0   0    29    0    0   1.229     41  0.47
   20   95 A   0   0   0   0   0   0   0   0   0  76   0   0   0   0  12   6   0   0   6   0    17    0    0   0.790     26  0.56
   21   96 A   0  18   5   0   0   0   5  27   9   0  14   0   0  14   0   0   0   0   0   9    22    0    0   1.925     64  0.06
   22   97 A   4   8   4   0   0   0  71   0   0   0   0   8   0   4   0   0   0   0   0   0    24    0    0   1.056     35  0.43
   23   98 A   0   0   4   0   0   0   0   0   0   4   8   8   0   0   0   0   4   0  17  54    24    0    0   1.442     48  0.37
   24   99 A   0   4   4   4   0   0   0  12   0  36   0   4   0   4   8   4   8   8   0   4    25    0    0   2.130     71  0.13
   25  100 A   0   0   0   0   0   0   0   4   8   0  36   8   0   4  12   8   0   4  16   0    25    0    0   1.908     63  0.27
   26  101 A   0   0   0   0   4   0   0   0   0   0   4   4   4   0  37  19   0   0  19  11    27    0    0   1.725     57  0.23
   27  102 A   0   0   3   7   3   0   0  10   0  37   3  13   0   0  10   0   0   3  10   0    30    0    0   1.961     65  0.15
   28  103 A   0   7   3   0   0   0   0   0   3   0  10   3   0   0   3  13   7  43   0   7    30    0    0   1.856     61  0.26
   29  104 A   0   3   0   0   0   0   0   0   0   3  70  13   0   0   7   3   0   0   0   0    30    0    0   1.039     34  0.52
   30  105 A   3   0   7   0  47   0  17   0   0   0   3   0   0   0  23   0   0   0   0   0    30    0    0   1.401     46  0.24
   31  106 A   0   5   0   0  54   0  32   5   0   0   0   3   0   0   0   0   0   0   0   0    37    0    0   1.111     37  0.68
   32  107 A   0   0   0   0   0   3   0   0   0   5   5   5   0   3  11   5  26  29   3   5    38    0    0   2.009     67  0.30
   33  108 A   3   0   0   0   0   0   0   0   3   0   5  10   0   8   0  15  51   3   3   0    39    0    0   1.589     53  0.34
   34  109 A   3   3   0   0   0   0   0   0   3   0  15   5  28   0   3   0   0  25   5  13    40    0    0   1.915     63  0.15
   35  110 A   0   0   0   0  95   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0    43    0    0   0.188      6  0.99
   36  111 A   2  16   0   2   2   0   0   0   0   0   2   2   0  14   0   7  23  19   2   7    43    0    0   2.119     70  0.20
   37  112 A   0   9  16   0   0   0   2   0   0   0   2   2   0   0  23   0   7  33   5   0    43    0    0   1.812     60  0.12
   38  113 A   2  68  14   0   0   0   0   0   0   2   0   0   0   0   0   0   0   9   0   5    44    0    0   1.063     35  0.54
   39  114 A   2   0   0   0   0   0   0  14   5   0  18   5   2   0   9   7   2  34   0   2    44    0    0   1.975     65  0.27
   40  115 A  14   0   7   0   0   0   0   0   0   2   0   5   5   0  25  25   7   9   2   0    44    0    0   2.002     66  0.18
   41  116 A   2  51  44   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    45    0    0   0.873     29  0.73
   42  117 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
   43  118 A  13   0   0   0   0   0   0   2   2   0  22   0   0  17  15  17   2   7   0   2    46    0    0   2.003     66  0.17
   44  119 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
   45  120 A   0   0   0   0   0   0   0   4   9   0  46   2   2   0   2   0   2  24   7   2    46    0    0   1.643     54  0.37
   46  121 A   0   0   0   0  67   0  28   0   0   0   0   0   0   0   2   0   2   0   0   0    46    0    0   0.790     26  0.84
   47  122 A   0   0   0   0   0   0   0  80   7   0  13   0   0   0   0   0   0   0   0   0    46    0    0   0.619     20  0.79
   48  123 A   2   0   0   0   0   0   2   0   2   0  15   7   2   0   9   9   0  46   2   4    46    0    0   1.800     60  0.28
   49  124 A  98   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.105      3  0.96
   50  125 A   2   6   0   0  57   2  28   0   2   0   0   0   0   0   2   0   0   0   0   0    47    0    0   1.177     39  0.76
   51  126 A   0   0   2   0   0   0   0   4   4   0   0   0   0   0   9  70  11   0   0   0    47    0    0   1.047     34  0.58
   52  127 A  49   0   0   0   0   0   0   4  23   0   0   0  23   0   0   0   0   0   0   0    47    0    0   1.164     38  0.40
   53  128 A  13   6  15   0   4   0   0   0   0   0   0   0   2   0  53   4   2   0   0   0    47    0    0   1.490     49  0.25
   54  129 A   0   0   0   0   0   0   4   2   0   0  38   0   9   2   0  34   0   2   6   2    47    0    0   1.582     52  0.28
   55  130 A   9   6   0   0   0   0   0   0   0   0   0   0   0   0  47  38   0   0   0   0    47    0    0   1.108     36  0.47
   56  131 A   2  28   6   2   0   0   0   2   4   0   4   2   0   0   2   0   6  34   0   6    47    0    0   1.927     64  0.17
   57  132 A   0   0   0   0   0   0   0   9   0   0   0   9   0   0   0   0   0   2   0  81    47    0    0   0.673     22  0.74
   58  133 A   0   0   0   0   0   0   0  77   0   0   9   0   0   0   2   2   2   2   6   0    47    0    0   0.917     30  0.66
   59  134 A   0   0   2   0   0   0   6   6   0   2   2   0  26   0  34  13   6   0   0   2    47    0    0   1.833     61  0.12
   60  135 A  11  40  17   6   4   4   2   0   2   0   2   0   0   0   0   6   0   4   0   0    47    0    0   1.906     63  0.39
   61  136 A   4   2   0   2   2   0  89   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.481     16  0.81
   62  137 A   0   0   0   0   0   0   2   0  98   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.103      3  0.94
   63  138 A  47   4  40   6   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.113     37  0.73
   64  139 A   0   0   2   0   0   0   0   0   0   0   0   0   0   0   0  98   0   0   0   0    47    0    0   0.103      3  0.95
   65  140 A  17   0   4   4   0   0   0   0   2   0   0   0   2   7  46  13   2   2   0   0    46    0    0   1.711     57  0.26
   66  141 A   4   7   2   2   0   0   0   0   4   0  72   2   2   0   2   0   0   0   2   0    46    0    0   1.188     39  0.47
   67  142 A   9   2   4  17   0   0   2   4   0   0   0  11   0   0  21  23   0   4   2   0    47    0    0   2.067     69  0.19
   68  143 A   2   2   0   2   0   0   0   0   4   0  21   2   0   0  23  30   2   9   2   0    47    0    0   1.865     62  0.28
   69  144 A   0   2   0   0   2   0   2   0   9  55   4   2   0   0  11   2   9   2   0   0    47    0    0   1.611     53  0.36
   70  145 A   2  28   4   2  40   0   4   2   0   2   0   0   2   0   2  11   0   0   0   0    47    0    0   1.720     57  0.36
   71  146 A   2   2   6   4   0   2   2   6  17   2   0   2   0   4  43   2   0   2   0   2    47    0    0   2.022     67  0.14
   72  147 A   6   0   0   0   0   0   0  60   2   0  11   2   0   0   0   0  11   2   4   2    47    0    0   1.423     47  0.48
   73  148 A   2   2   0   2   0   2   0   2   0  24  20   4   0   4  13   2   0   9   4   9    46    0    0   2.260     75  0.18
   74  149 A  11   0   0   0   0   0   0   4   9   0  21   9   0   2   6  23   2   2   6   4    47    0    0   2.193     73  0.19
   75  150 A   0   0   2   4   0   0   0   0  11   0   2   2   4   0   0   2   0   6   4  62    47    0    0   1.443     48  0.45
   76  151 A   2   0   0   0   2   0   0   0   0   0   6   2   0   2  55   6   2  19   2   0    47    0    0   1.487     49  0.35
   77  152 A   0   9   2   0   0   2   0   0  13   0   0   6   2   2   9   9  23   6   6  11    47    0    0   2.325     77  0.16
   78  153 A   2  17   0   0   2   0   4   0   2   0   4   6   0   0  32   6   4   9   9   2    47    0    0   2.167     72  0.09
   79  154 A   0   0   0   0   4   0   0   0  38   0   0   2   2   2  11  32   4   4   0   0    47    0    0   1.619     54  0.23
   80  155 A   2  72   2   2   0   0   0   0   6   0   0   0   0   6   0   2   0   6   0   0    47    0    0   1.089     36  0.50
   81  156 A   2   0   6   4   0   0   0   0  23   0   0   9   2   4  23   4   9   9   4   0    47    0    0   2.186     72  0.12
   82  157 A   2   2   0   0   0   0   2   2   0   0   2   0   0   0   6   0   0  83   0   0    47    0    0   0.740     24  0.64
   83  158 A  72   4   6   0   2   0   0   0   9   2   4   0   0   0   0   0   0   0   0   0    47    0    0   1.052     35  0.62
   84  159 A   2   2   0   2   0   0  21  17   4   0   0   0   0   6  17   0  13  11   2   2    47    0    0   2.153     71  0.03
   85  160 A   2   0   4   6   0   0   0  15  28   0   6   4   0   2  13  15   0   2   2   0    47    0    0   2.133     71  0.17
   86  161 A   2  21   2   4   2   0   4   2   0   0   0   4   0  49   0   0   0   0   9   0    47    0    0   1.619     54  0.25
   87  162 A   3   8   0   3   0   0   0   0  30   0   8   3   0   0   3   0   5  40   0   0    40    0    0   1.635     54  0.25
   88  163 A  25   3   0   0   0   0   0   0   8   0   5   0   5   0  13  28   5  10   0   0    40    0    0   1.928     64  0.12
   89  164 A  26  52   7   0   2   0   2   2   0   0   7   0   0   0   0   0   0   0   0   0    42    0    0   1.334     44  0.51
   90  165 A   7   0   0   0   0   0   0  59   0  20   5   0   2   0   2   2   2   0   0   0    44    0    0   1.303     43  0.43
   91  166 A   0   2   0   0   2   0   4   7   2  11   4   0   0  18   4  11  27   4   0   2    45    0    0   2.220     74  0.19
   92  167 A   0   0   0   0   0   0   2   0   0   0   4   0   0  91   0   0   0   2   0   0    45    0    0   0.392     13  0.82
   93  168 A   0   0   0   0   2   0   0   0   5  66   2   0   0   2   0   5   5  11   2   0    44    0    0   1.287     42  0.48
   94  169 A   2   0   0   0   7   0   2   0   0   0   0   0   5  32   7   0   2   0  43   0    44    0    0   1.492     49  0.34
   95  170 A  26  15  26   0   0   0   0   0   0   0   0   0  33   0   0   0   0   0   0   0    46    0    0   1.353     45  0.41
   96  171 A  74  11   4   2   0   0   0   0   2   2   0   2   0   0   2   0   0   0   0   0    46    0    0   1.017     33  0.69
   97  172 A   0   0   0   0   2   0   2   4   2   0   7   0   0   0  54  15   4   7   2   0    46    0    0   1.580     52  0.36
   98  173 A   2  35   0   4  24   0  35   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.296     43  0.64
   99  174 A   7   4  11   0  15   0  33   0   7   0   2   0   0   2   0   0   0  17   2   0    46    0    0   1.939     64  0.19
  100  175 A   0   0   0   0   0   0   9   2   0   0  28   2   2   2  22   7  17   0   4   4    46    0    0   1.989     66  0.14
  101  176 A   0   0   0   0   2   0   2   2  80   0  13   0   0   0   0   0   0   0   0   0    46    0    0   0.690     23  0.69
  102  177 A   0   0   0   0   9  89   2   0   0   0   0   0   0   0   0   0   0   0   0   0    45    0    0   0.404     13  0.96
  103  178 A   7   4   0   0   7   0   0   0  22   0   0   0   0   0   0   0  11  50   0   0    46    0    0   1.412     47  0.30
  104  179 A   0   0   0   0   0   2   0   2   0   0   0   7   0   0   0   0   4  78   0   7    46    0    0   0.851     28  0.68
  105  180 A   0   2   0   0   0   0   2  30   0   2   2   4   2   0   0   7   2   2  22  22    46    0    0   1.923     64  0.32
  106  181 A   0   0   0   2   0   0   0  39   4   0   0   0   4   0   2   0   4   9   2  33    46    0    0   1.604     53  0.45
  107  182 A   0   0  17   2   7   0   7   0   4   0   0   4   0  28  13  11   7   0   0   0    46    0    0   2.058     68  0.11
  108  183 A   7  63   4  22   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.073     35  0.82
  109  184 A   0   4  17   2   9   2  63   0   0   0   0   0   0   2   0   0   0   0   0   0    46    0    0   1.193     39  0.58
  110  185 A   2  35  59   2   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0    46    0    0   0.930     31  0.71
  111  186 A   4   0   7   0   0   0   0   0   0   0   0   0   2   0   0   0  87   0   0   0    46    0    0   0.519     17  0.66
  112  187 A   0  17   0  17   0   0   0   0   0   0   2  41   0   0   0   0   2   0  20   0    46    0    0   1.459     48  0.24
  113  188 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  98   0   2    46    0    0   0.105      3  0.98
  114  189 A   0  61   4   2   2   0  20   0   0   0   0   0   7   4   0   0   0   0   0   0    46    0    0   1.239     41  0.46
  115  190 A   2   7   0   0   0   0   0   0   2   0   0   0  89   0   0   0   0   0   0   0    46    0    0   0.447     14  0.70
  116  191 A   0   0   0   0   0   0   0  22   2   4  13   0   0   4   4   0   7  15  17  11    46    0    0   2.100     70  0.31
  117  192 A   2   0   0   2   2   0   0  20   2  24   5   5   5   2   0   0  17   2   0  10    41    0    0   2.177     72  0.20
  118  193 A   0   0   0   0   5   0   0   2  14   0  45   7   0   0   5   0   0   9   7   7    44    0    0   1.764     58  0.30
  119  194 A   4  67   7   2   0   0   0   0   9   0   4   2   0   0   2   0   0   0   2   0    45    0    0   1.281     42  0.52
  120  195 A   4  13   4   4   7   0   2   2   2   0  13   0   0   2   2   0  30   4   2   7    46    0    0   2.294     76  0.11
  121  196 A   2  13   0   0   0   0   0   0   0   0  11   9   0   0   0   2  26  13   7  17    46    0    0   1.984     66  0.23
  122  197 A   0   4   4   2   4   0  17   2   4   0   2   0   0  26   0   4   7  13   7   2    46    0    0   2.291     76  0.12
  123  198 A   4  11   4   4   0   0  13   4   4   0  15   0  20   0   2   7   0   0  11   0    46    0    0   2.297     76  0.08
  124  199 A   2   7   4   4   0   0   2   0   7   0   2   2   2   2   7   4   7  41   4   2    46    0    0   2.205     73  0.21
  125  200 A   9   0   7   0   2   0   0   0  20   2   9   2   0   2  11  15   2  17   2   0    46    0    0   2.253     75  0.14
  126  201 A   4   7   0   4   4  20   0   4   0   2   4   2   0   2   4  11  15  13   2   0    46    0    0   2.442     81  0.05
  127  202 A   0   2   2   0   0   0   2  48   2   4   7   4   2  11   0   0   4   2   4   4    46    0    0   1.953     65  0.31
  128  203 A   0   0   0   0   0   0   0  13  26   0   0   9   0   9  26   0   9   4   4   0    23    0    0   1.877     62  0.15
  129  204 A   0  10  10   3   5   0  13   5   8   3  25   0   0   3   3   3   5   3   0   5    40    0    0   2.414     80  0.03
  130  205 A   2  50   9   0  34   0   0   0   2   0   0   2   0   0   0   0   0   0   0   0    44    0    0   1.189     39  0.70
  131  206 A   0   7   0   0   0   0   0   0   2  48   9   9   0   0   0   5   9   9   0   2    44    0    0   1.721     57  0.29
  132  207 A   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0  95   0   2    44    0    0   0.216      7  0.94
  133  208 A   2   2   2   0   0   2   2   4  20  13   2   9   0   2   9  11   0   4   2  11    45    0    0   2.463     82  0.14
  134  209 A   0   2   2   2   0   0   0   0   4   0   0   7   0   0  11   9  27  33   0   2    45    0    0   1.835     61  0.32
  135  210 A  43  26  24   0   0   0   0   0   7   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.233     41  0.62
  136  211 A   0   7   0   0   2  57   0   0   2   0   2   2   7   0   2  20   0   0   0   0    46    0    0   1.414     47  0.28
  137  212 A   2   4   0   0   7   2   2  22   0   0   4   2   0   2   2   7   4  13  15  11    46    0    0   2.390     79  0.13
  138  213 A   9   7  33   4   7   0  35   0   7   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.616     53  0.38
  139  214 A   4  70   0  11   7   0   0   0   0   0   2   2   4   0   0   0   0   0   0   0    46    0    0   1.111     37  0.68
  140  215 A   7  24   4   2   2   2   4   4  11   0   4   0   2   7  24   2   0   0   0   0    46    0    0   2.243     74  0.07
  141  216 A   0   2   0   2   0   0   0   0   0   0   0   0   0   2   0   2  28  11   2  51    47    0    0   1.347     44  0.56
  142  217 A  21  28  28   0   0   0   0   0   2   0   0  19   0   0   2   0   0   0   0   0    47    0    0   1.521     50  0.46
  143  218 A   2  47   0   0   0   0   0   4  17   0  19   9   0   0   0   0   0   0   2   0    47    0    0   1.481     49  0.21
  144  219 A   0  38   0  11   0   0   0   2   0   0   6   0   0   2  11   6  13   6   2   2    47    0    0   1.962     65  0.19
  145  220 A   0   0   2   0   0   0   0  53  45   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.778     25  0.68
  146  221 A  11  85   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.510     17  0.87
  147  222 A   0   2   0   0   2   0   0   6  21   0   2   0   4   4   6  34   6   4   2   4    47    0    0   2.088     69  0.19
  148  223 A   0   0   0   0   9   0  30   0   0   0   4   0   0  55   0   0   0   0   0   2    47    0    0   1.114     37  0.45
  149  224 A   2  62  34   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    47    0    0   0.829     27  0.72
  150  225 A   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    47    0    0   0.000      0  1.00
  151  226 A   0   0   0   0   0   0   0   9   2   0  49   2   0   2   2   0   4   6   6  17    47    0    0   1.674     55  0.42
  152  227 A   0   2   0   4   2   0   0   0   4   0  15   2   4  15  11   6  30   0   4   0    47    0    0   2.125     70  0.18
  153  228 A   0   0   0   0   0   0   0  62   0   0   4   0   0   0   2   2   2   2  15  11    47    0    0   1.282     42  0.56
  154  229 A   6  57  21   9   2   0   0   0   0   0   2   0   0   0   0   2   0   0   0   0    47    0    0   1.279     42  0.66
  155  230 A  45  15  26   2   0   2   0   2   9   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.448     48  0.55
  156  231 A   0   0   0   0   0   0   6   0   0   0   0   0   0  94   0   0   0   0   0   0    47    0    0   0.237      7  0.88
  157  232 A   0  62   0  15   0   0   2   0   0   0   0   0   0   0  11   0   0   0   6   4    47    0    0   1.212     40  0.45
  158  233 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    47    0    0   0.000      0  1.00
  159  234 A  34  15  51   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.994     33  0.77
  160  235 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0    47    0    0   0.000      0  1.00
  161  236 A   0   4   0   0   0   0   0   2   0  91   0   2   0   0   0   0   0   0   0   0    47    0    0   0.380     12  0.82
  162  237 A   0   0   0   2   0   0   0   2  30   0  23   0   0   0   0   0   2  23   0  17    47    0    0   1.588     52  0.36
  163  238 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0    47    0    0   0.000      0  1.00
  164  239 A   9   4  83   0   0   0   0   0   0   0   0   0   4   0   0   0   0   0   0   0    47    0    0   0.633     21  0.84
  165  240 A   0  26   0   9  60   0   6   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.042     34  0.80
  166  241 A  13  43  40   0   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.127     37  0.70
  167  242 A   2   0   0   0   0   0   0  23   0   0  28  13  17   0   2   4   0   2   6   2    47    0    0   1.897     63  0.30
  168  243 A   2   0   0   4   4   2   0   0   4  17  11   4   2   9   9  15   0   2   6   9    47    0    0   2.493     83  0.11
  169  244 A   0   0   0   0   0   0   0  11   2   2   2   6   0   6  19  11   9   6   6  19    47    0    0   2.268     75  0.25
  170  245 A  11   0   2   0   0   0   0  70   2   0   0   2   0   0   0   4   0   4   4   0    47    0    0   1.135     37  0.56
  171  246 A  19   5  17  10   2   0   0   2   0   0   2   2   0   7  21   5   0   2   0   5    42    0    0   2.237     74  0.14
  172  247 A   6   6   6   0   6   6  23   0   0   0   2   0  38   4   0   0   0   0   0   0    47    0    0   1.802     60  0.31
  173  248 A   0   0   0   0   0   0   0   0   2   0   0   0   0   0   4  89   0   2   0   2    47    0    0   0.481     16  0.84
  174  249 A   0  68  30   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0    47    0    0   0.704     23  0.74
  175  250 A   2   0   0   0   0   0   0  77   6   0   4   6   0   0   0   0   0   0   0   4    47    0    0   0.906     30  0.70
  176  251 A   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   2   0   0  96    47    0    0   0.205      6  0.95
  177  252 A   2  23   0   0  70   0   0   2   0   0   0   2   0   0   0   0   0   0   0   0    47    0    0   0.834     27  0.78
  178  253 A   2   0   0   0   0   0   0  94   2   0   2   0   0   0   0   0   0   0   0   0    47    0    0   0.308     10  0.91
  179  254 A   4  55   6   0   0   0   0   0   2   0   0   0   6  19   0   0   0   4   0   2    47    0    0   1.428     47  0.27
  180  255 A  36  19   2   9   0   0   0   0  15   0   4   0  13   0   0   0   0   2   0   0    47    0    0   1.739     58  0.29
  181  256 A  30   4   6   0   2   2   0   2   2   0   4  28   4   0   0  11   0   0   2   2    47    0    0   2.025     67  0.18
  182  257 A   4   6   2   0   0   0   0   2   0   2  17   0   2   0  13   2   2  30   6  11    47    0    0   2.140     71  0.18
  183  258 A   2  40  30   0   0   0   0   0   6   0  15   4   0   0   0   0   0   0   0   2    47    0    0   1.484     49  0.34
  184  259 A   0   0   6   0   0   0   0  21   2   2  23   4   0   2   0   9   6   0   2  21    47    0    0   2.021     67  0.27
  185          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  186  266 A  28   0   7   0   0   0   0   9  28   2   2   9   2   0   0   2   2   9   0   0    46    0    0   1.946     64  0.25
  187  267 A   2   0   0   4   9   0   0   2   0   2   0   9   0   0   4   0  28  32   0   9    47    0    0   1.863     62  0.22
  188  268 A   2   0   2   0   0   0   0   0   0   0   0   0   9   0   0   0   0  83   0   4    47    0    0   0.663     22  0.61
  189  269 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.000      0  1.00
  190  270 A   2   0   0   0   0   0   0   0   0   0   0  11   0   0   0   0   0   0   0  87    47    0    0   0.439     14  0.75
  191  271 A   0   0   9   0   0   0   0   4   9  30  30   2   2   0  11   2   2   0   0   0    47    0    0   1.841     61  0.27
  192  272 A   4   0   0   0   0   0   4   0   2   0   0   0   0   0  66  13   0  11   0   0    47    0    0   1.126     37  0.45
  193  273 A   0   0   0   0  21   2  77   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.615     20  0.96
  194  274 A   0  49   2  47   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0    47    0    0   0.869     29  0.85
  195  275 A   0   0   0   0   0   0   0   0  85  11   2   0   2   0   0   0   0   0   0   0    47    0    0   0.539     18  0.80
  196  276 A   0   0   0   2   0   0   0   0   0  66   2   0   0   0   2   4   4   0  19   0    47    0    0   1.105     36  0.47
  197  277 A   4   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0  91   0   2    47    0    0   0.380     12  0.84
  198  278 A  26  40  28   2   0   0   0   0   4   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.286     42  0.64
  199  279 A   2  83   2   9   2   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0    47    0    0   0.692     23  0.85
  200  280 A   6   2   0   0   0   0   0   4   2   0   2   0   0   4   6   2  43   9  15   4    47    0    0   1.939     64  0.32
  201  281 A   0   0   0   0   0   0   0  51   0   2   2   4   0   0   6   0   0  26   0   9    47    0    0   1.375     45  0.46
  202  282 A   0   0   4   0   2   0  24  11   2   0  22  11   2   2   2   4   4   2   4   2    46    0    0   2.284     76  0.05
  203  283 A   4   0   2   0  17   0  30   0   4  11   4   9   2   6   4   0   2   0   0   4    47    0    0   2.203     73  0.10
  204  284 A   0   0   0   0   2   0   4  23   2   0   9  17   0  19   4   2   0   0  13   4    47    0    0   2.079     69  0.17
  205  285 A   0  28   0   0   4   0   0   0   0   2   0  19   0   4   6  32   0   4   0   0    47    0    0   1.697     56  0.14
  206  286 A   0   2   0   0   0   0   0   0  51  32   0   2   0   0   0   6   0   0   0   6    47    0    0   1.223     40  0.46
  207  287 A   6   0   0   0   0   2   0   2  47   0  13   0   2   0   0  28   0   0   0   0    47    0    0   1.395     46  0.29
  208  288 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    47    0    0   0.000      0  1.00
  209  289 A  38   0  51   4   0   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.021     34  0.64
  210  290 A   0   0   0   0  87  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.382     12  0.96
  211  291 A   0   0   0   0   0   0   0   0  23   0  77   0   0   0   0   0   0   0   0   0    47    0    0   0.544     18  0.71
  212  292 A   4  91   0   0   2   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.380     12  0.90
  213  293 A   0   0   0   0   0   0   0  91   9   0   0   0   0   0   0   0   0   0   0   0    47    0    0   0.291      9  0.91
  214  294 A   9  49  19   6   0   0   0   0  15   0   0   0   2   0   0   0   0   0   0   0    47    0    0   1.417     47  0.48
  215  295 A   2   9   6   0   0   0   0   0   9   0   4  70   0   0   0   0   0   0   0   0    47    0    0   1.060     35  0.52
  216  296 A  11  17  38  19   2   0   0   0   4   0   0   9   0   0   0   0   0   0   0   0    47    0    0   1.650     55  0.51
  217  297 A   6  53   2   0   4   0  21   0  13   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.320     44  0.43
  218  298 A   9   9   0   0   0   0   0   0   0   0   0   0   4   0   0   0   0  70   0   9    47    0    0   1.012     33  0.49
  219  299 A  23  26  13  11   0   0   0   0  28   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.545     51  0.41
  220  300 A   2   9   4   0   0   0   0   2  77   0   0   2   4   0   0   0   0   0   0   0    47    0    0   0.928     30  0.58
  221  301 A   0   0   0   0   0   0   0  21   4   0   2  28  36   0   6   0   0   2   0   0    47    0    0   1.526     50  0.29
  222  302 A   0   2   0   0   2   0   4  19  17   0   2   2   2   0   2   0   0   0  30  17    47    0    0   1.906     63  0.27
  223  303 A  13  17   4  23   0   0   2   4   2   0  15   0   0   0   0   9   2   9   0   0    47    0    0   2.121     70  0.17
  224  304 A   4   0   0   0   0   2   2   0   4  21  13   0   0   4   0   0   2  34   2  11    47    0    0   1.928     64  0.23
  225  305 A   9  82   0   5   2   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0    44    0    0   0.695     23  0.83
  226  306 A   2   0   0   0   0   0   0   0   0  93   0   0   0   0   0   0   0   2   0   2    46    0    0   0.313     10  0.86
  227  307 A   2   0   0   0   4   0   0   7   9   2  13  13   0  20   9   7   4   4   2   4    46    0    0   2.426     80  0.13
  228  308 A   0   0   0   0   0   0   0  24   0   0  15   7   0   2   2   2   2   4  41   0    46    0    0   1.641     54  0.38
  229  309 A   0   0   0   0   0   0   0  81   6   2   4   0   0   0   0   0   0   0   0   6    47    0    0   0.739     24  0.77
  230  310 A   2   0   0   0   0   0   2   2  11   7   2   4   0   0   2   0   4  39   2  22    46    0    0   1.890     63  0.39
  231  311 A   0  13   0   7   0   0   0  30   9   4   7   0   2   4   2   0  11   7   4   0    46    0    0   2.191     73  0.15
  232  312 A   0   2   0   0   7  78   2   0   0   0   0   0   0   2   9   0   0   0   0   0    46    0    0   0.832     27  0.85
  233  313 A   0   7   0   0   0   0   0   2   0   2   0   0   0  39   2   2  41   2   2   0    46    0    0   1.410     47  0.46
  234  314 A   0   0   2   4   0   0   0   2   9   4   4   0   0  11  11   6  28  11   6   2    47    0    0   2.280     76  0.24
  235  315 A   0  51  34   0   4   0   2   0   2   0   2   4   0   0   0   0   0   0   0   0    47    0    0   1.224     40  0.57
  236  316 A   2   4   0   2   0   0   0   0   0   0   2   2   0   0  85   2   0   0   0   0    47    0    0   0.681     22  0.68
  237  317 A   0   9   0   0   2   0   0   0   2   0   6   2   0   4   4   6  30  13  17   4    47    0    0   2.135     71  0.23
  238  318 A   0   2   0   0   0   0   0  79   0   0   0   0   0   0   0   6   0   2   4   6    47    0    0   0.838     27  0.66
  239  319 A   0   0   4   0   0   0  23   2   0   0   4   2   0   4   9  17   9   4  13   9    47    0    0   2.234     74  0.08
  240  320 A   9  55  17   2   4   0   0   0   0   2   0   0   2   2   4   0   2   0   0   0    47    0    0   1.517     50  0.49
  241  321 A   2   2   0   0   2   0   2   0   4  72   7   0   0   0   2   4   0   0   0   2    46    0    0   1.188     39  0.49
  242  322 A   0   6   0   0   2   0   0   6   6  38   2   2   0   2   6   4   2  13   2   6    47    0    0   2.134     71  0.22
  243  323 A   4  13  11   0   0   0   0   2   0   4   2   6   2   2  11   4   2  34   0   2    47    0    0   2.177     72  0.11
  244  324 A   2  11   4   2  43   0   2   0   0  28   0   0   0   2   0   2   0   2   0   2    47    0    0   1.665     55  0.17
  245  325 A   2   9   4   0  13   0   4   9   0   4   0  30   0   0   0   2  19   0   0   4    47    0    0   2.061     68  0.07
  246  326 A  11   4   0   0   4   0   2   0  23   4   4   4   0   2   4  19   4   2   4   6    47    0    0   2.391     79  0.11
  247  327 A   0  19   4   0   0   0   0  23   2   2  13   2   0   2   2   4   2  11   2  11    47    0    0   2.238     74  0.13
  248  328 A   4  38  13   0   0   0   2   4   2   9  13   2   0   0   6   2   0   0   2   2    47    0    0   2.039     68  0.15
  249  329 A   6   0   2   0   0   0   2   0   0   4  47   2   2   2   6   6   9   6   4   0    47    0    0   1.946     64  0.24
  250  330 A   2   9   2   0   9   2   0  11   4  11  30   0   0   2   0   6   0   6   0   6    47    0    0   2.246     74  0.13
  251  331 A   3   0   3   0   0   0   0   0  11   6   3   3   0   0   3   0   3  40   3  23    35    0    0   1.826     60  0.37
  252  332 A   0  60   0   9  26   0   0   0   5   0   0   0   0   0   0   0   0   0   0   0    43    0    0   1.017     33  0.75
  253  333 A   2  11   2   0   0   0   6   2   0   0   6   9   0   2  32  13  11   0   2   2    47    0    0   2.156     71  0.13
  254  334 A   2   4   0   0   0   0   0   4   9   0  21   2   0   0   4  11   4  13  13  13    47    0    0   2.267     75  0.23
  255  335 A  30  53   9   2   4   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0    47    0    0   1.204     40  0.67
  256  336 A  11  53  34   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    47    0    0   1.023     34  0.73
  257  337 A   9   6   2   2   0   0   0   4   2   2   2  11   0   2   2  34   6  11   0   4    47    0    0   2.247     74  0.20
  258  338 A   6  15   0  17   0   4   2   2  11   2  13   2   4   0   6   4   4   0   4   2    47    0    0   2.519     84  0.09
  259  339 A   0  15   0  70   2   0   2   0   0   0   2   2   4   0   0   2   0   0   0   0    47    0    0   1.076     35  0.63
  260  340 A   2  55  23  15   0   0   0   0   0   0   0   2   0   0   0   2   0   0   0   0    47    0    0   1.197     39  0.69
  261  341 A   0   2   0   0   2   0   0   0   2   0   0  11   2  30   4   2   4  23   4  13    47    0    0   2.014     67  0.26
  262  342 A   0   4   0   0   0   0   0   2   2  68   4   4   0   0   6   9   0   0   0   0    47    0    0   1.214     40  0.49
  263  343 A   2   0   2   0   0   0   0   0   2   2   4   0   0   0   0   4   0   4   7  72    46    0    0   1.158     38  0.61
  264  344 A   4   0   0   0   0   0   4   0  11  80   0   0   0   0   0   0   0   0   0   0    46    0    0   0.689     22  0.67
  265  345 A   4   2   2   7   0   0   2   4   4   0   9   4   0   0   9  24  13  13   2   0    46    0    0   2.355     78  0.17
  266  346 A   0  20   0   0   0   0   0   0   7   0   4   0   0   2   9  20  18  13   7   0    45    0    0   2.019     67  0.18
  267  347 A   0   0   0   0   0   0   0   0   0   0   0   2   0   0  98   0   0   0   0   0    45    0    0   0.107      3  0.94
  268  348 A   0   0   9   0   0   2   0   0  22  67   0   0   0   0   0   0   0   0   0   0    45    0    0   0.904     30  0.54
  269  349 A   0   0   0   0   0   0   0   2   0   0  36  56   0   0   2   0   0   0   2   2    45    0    0   1.033     34  0.50
  270  350 A  13   0   4   0   0   0   0   2  67   0   4   4   4   0   0   0   0   0   0   0    45    0    0   1.177     39  0.54
  271  351 A   0   0   0   4   0   0   2   0  18   0   4   7   0   0   2   7  11  33   0  11    45    0    0   1.969     65  0.30
  272  352 A   4   0   0   0   0   2   0   2  36   2   2   4   0   0   2   2  13  22   0   7    45    0    0   1.935     64  0.31
  273  353 A   0  78  11   2   0   0   0   2   2   0   0   0   4   0   0   0   0   0   0   0    45    0    0   0.832     27  0.65
  274  354 A  14  61   0   2   0   0   0   0   5   0   0   7   5   0   5   0   0   0   0   2    44    0    0   1.348     44  0.42
  275  355 A   0   0   0   0   0   2   0   0  34   0   2   2   2   0  11  27   7   9   0   2    44    0    0   1.799     60  0.24
  276  356 A   0  23   5   0   0   0   2   0   2   0   7   0   0  44   0   2   2   0   9   2    43    0    0   1.687     56  0.21
  277  357 A   2   2   0   0   2   0   0   0   9  60   7   5   0   0   2   0   2   2   0   5    43    0    0   1.521     50  0.43
  278  358 A  23  16   9  19   0   2   2   2   5   2   7   5   0   0   2   2   0   0   0   0    43    0    0   2.165     72  0.28
  279  359 A   5  58  21   2   7   0   0   0   0   0   0   0   0   0   0   2   2   0   0   0    43    0    0   1.234     41  0.66
  280  360 A   3   0   0   0   0   0   0   0   5   0   5   3   0   3  57  11   8   0   3   3    37    0    0   1.569     52  0.40
  281  361 A   0   0   0   0   0   0   0   0   0  12   3   0   0   3  27   9  27   3  15   0    33    0    0   1.786     59  0.32
  282  362 A   0   0   0   0   0   0   0   0  19  57  24   0   0   0   0   0   0   0   0   0    21    0    0   0.977     32  0.50
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     1   185   260     6 gTAGAGEv
     2   185   260     6 gATGASEa
     3   185   251     6 gSTGAGEa
     4   185   251     6 gSAGAGEa
     5   185   251     6 gASGANEa
     6   185   255     6 gVSGTSEa
     7   185   251     6 gTSGAGEa
     8    12    82     2 gEKr
     8   184   256     6 dRGDLSDa
     9   185   253     7 dGTEGSGEa
    10   135   147     7 dSAENRDDp
    11    18    18     1 sSp
    11   182   183     5 kENLFDa
    12   181   238     6 sEIDIDEv
    13   177   231     6 dKVESDQa
    14     6    59     1 lDd
    14   177   231     6 tKSNPRYa
    14   242   302     1 sPa
    15   180   254     7 kNPNDVKSa
    16   175   287     4 qKDSRe
    17   180   255     7 kNPNDVKSa
    18   109   213     1 dLv
    19    85    85     5 sRATPTp
    19   138   143     4 nPRWGt
    19   153   162     4 gTKDDg
    19   175   188     1 gAd
    19   192   206     2 dWTv
    20   142   279     6 sPDGFSAg
    20   158   301     1 dMt
    21    83   286     4 dGGSLa
    21   136   343     7 pDTSGTCGg
    21   137   351    15 gESEEEENDGRTSSGVv
    21   151   380     3 sSPQv
    21   167   399     1 eDy
    21   173   406     1 kAd
    22   151   267     4 dGAISi
    22   167   287     1 dDh
    22   173   294     1 kAd
    23     9    56     1 tPt
    23   112   160     5 eRGNLKd
    23   123   176     2 gGAg
    23   180   235     4 nEEKEg
    23   201   260     1 aAd
    23   244   304     2 iSDd
    24   108   369     1 sGg
    24   176   438     6 pVDARWVk
    24   241   509     2 lSLe
    25   140   149     5 sEPITAg
    25   156   170     1 tMt
    26    83   301     5 nGGSLQd
    26   135   358    12 eLQPEELDSDIEDg
    26   136   371     6 gVSSTNVv
    26   150   391     3 sNPQv
    26   166   410     1 eDy
    26   172   417     1 kAd
    27    67  1114     4 lRTLSt
    27    97  1148     5 pLGTLAf
    27   149  1205    24 hGTLKIGDFGMATRWPLVDAETTLRg
    27   150  1230     8 gARLDDEPHg
    27   164  1252     3 hHGLe
    27   175  1266     1 pEv
    28     4   145     2 gSVp
    28    12   155     1 sAp
    28   101   245     4 gENLLt
    28   147   295     8 dQQWKIADFg
    28   148   304     5 gISIDMd
    28   226   387     1 sLd
    29    87   289     4 nGGSLq
    29   140   346     4 kLAVEg
    29   141   351    17 gQAGQEESDSDDEFSSGVm
    29   155   382     3 aNPQv
    29   171   401     1 eQy
    29   177   408     1 kAd
    30    86   169     4 nGGSLq
    30   139   226     4 kQEDDi
    30   140   231    19 iPYVSEEGENEDDWFLSAKVm
    30   154   264     3 qSPQv
    30   170   283     1 eDy
    30   176   290     1 kAd
    31    87   160     4 nGGSLq
    31   140   217     4 kLAVSg
    31   141   222    17 gPAGQEESDSEDEFSPGVv
    31   155   253     3 tNPQv
    31   171   272     1 eQy
    31   177   279     1 kAd
    32   172   256     4 dKSQPi
    32   188   276     1 eNy
    32   194   283     1 kVd
    32   237   327     1 fQn
    33   115   288     1 sSh
    33   171   345     4 dRSLPi
    33   187   365     1 dNy
    33   193   372     1 kVd
    34     2   322     1 gDk
    34    10   331     1 aKr
    34   107   429     4 nGGSLq
    34   160   486    11 kDEDDVQCVLEEg
    34   161   498    12 gDNEDDWFFSANVi
    34   175   524     3 qNPQv
    34   191   543     1 eDy
    34   197   550     1 kGd
    35   102   286     1 dGg
    35   153   338     9 dNAAAVDSDDg
    35   154   348    11 gYDDDDLPPATHk
    35   168   373     3 sSPSv
    35   184   392     1 eDf
    35   190   399     1 kAd
    36    76    87     1 eGg
    36   144   156     7 dNTMDMAMt
    36   160   179     1 gRa
    36   208   228     3 sYSQv
    37   102   309     4 sGGSLs
    37   164   375     5 dRSDFIe
    37   180   396     1 pTt
    37   186   403     1 sAd
    37   229   447     1 gSr
    38    87   296     4 nGGSLq
    38   140   353     9 kMQSDSPVVPe
    38   141   363    14 eEIENEADWFLSANVm
    38   155   391     3 sKPKv
    38   171   410     1 eDy
    38   177   417     1 kAd
    39    32    73     3 gTNLg
    39    61   105     1 nIl
    39    91   136     1 sGg
    39   158   204     7 iHEGAVTHt
    39   174   227     1 rSg
    39   215   269     1 kKt
    40    32    88     3 gTNLg
    40    61   120     1 nIl
    40    91   151     1 sGg
    40   158   219     7 iHEGAVTHt
    40   174   242     1 rSg
    40   222   291     2 lTPd
    41   101   380     5 nGGSLAd
    41   153   437     9 tSIPNAASEEg
    41   154   447    10 gDEDDWASNKVi
    41   168   471     3 sSPQv
    41   184   490     1 eNy
    41   190   497     1 kAd
    42   101   381     5 nGGSLAd
    42   153   438     9 tSIPNAASEEg
    42   154   448    10 gDEDDWASNKVm
    42   168   472     3 sSPQv
    42   184   491     1 eNy
    42   190   498     1 kAd
    43    28   152     2 eAYs
    43    87   213     5 eKGSLNv
    43   139   270    24 nGTLRIGDFGLAVQESQLKSSTQYKn
    43   140   295    19 nLPKRRKSSEPDADRTMLTTv
    43   154   328     6 sLYAGDLe
    44    26    86     3 gSNLg
    44    55   118     1 nIl
    44    85   149     1 sGg
    44   152   217     7 iHEGAVTHt
    44   168   240     1 rSg
    45    80    96     1 gAg
    45   147   164     7 gATLARRLs
    45   158   182     4 pEVAAv
    45   186   214     2 pPLf
    45   191   221     2 pLRv
    45   212   244     2 wSAa
    46    28   191     8 gGGGDGGDTe
    46    83   254     1 eGp
    46   136   308     3 aSPPs
    46   150   325     6 sHQRRTRq
    46   166   347     1 gEs
    46   189   371     2 sPFl
    46   194   378     2 aEEt
    46   215   401     1 sAq
//