Complet list of 3kn5 hssp fileClick here to see the 3D structure Complete list of 3kn5.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      3KN5
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-01-02
HEADER     KINASE, AMP-PNP, MSK1, MSK, ATP-BINDING 2010-04-21 3KN5
COMPND     Ribosomal protein S6 kinase alpha-5
SOURCE     Homo sapiens
AUTHOR     D'Angelo, I.; Malakhova, M.; Dong, Z.
SEQLENGTH   289
NCHAIN        2 chain(s) in 3KN5 data set
KCHAIN        1 chain(s) used here ; chains(s) : B
NALIGN       62
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : F7HGG0_CALJA        0.90  0.91    1  291  356  670  315    2   26  740  F7HGG0     Ribosomal protein S6 kinase (Fragment) OS=Callithrix jacchus GN=RPS6KA5 PE=3 SV=1
    2 : G5AZZ5_HETGA        0.90  0.91    1  291  475  789  315    2   26  859  G5AZZ5     Ribosomal protein S6 kinase OS=Heterocephalus glaber GN=GW7_05559 PE=3 SV=1
    3 : G3SL50_LOXAF        0.89  0.91    1  291  318  632  315    2   26  689  G3SL50     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=RPS6KA5 PE=4 SV=1
    4 : F6XUU5_HORSE        0.88  0.91    1  291  381  695  315    2   26  765  F6XUU5     Ribosomal protein S6 kinase (Fragment) OS=Equus caballus GN=RPS6KA5 PE=3 SV=1
    5 : F7FUC1_MONDO        0.88  0.90    1  291  412  726  315    2   26  795  F7FUC1     Ribosomal protein S6 kinase OS=Monodelphis domestica GN=RPS6KA5 PE=3 SV=2
    6 : K9IVQ2_PIG          0.88  0.90    1  291  416  730  315    2   26  800  K9IVQ2     Ribosomal protein S6 kinase OS=Sus scrofa GN=RPS6KA5_tv1 PE=2 SV=1
    7 : U3KCI1_FICAL        0.82  0.89    1  291  382  696  315    2   26  766  U3KCI1     Uncharacterized protein (Fragment) OS=Ficedula albicollis GN=RPS6KA5 PE=4 SV=1
    8 : H3BWE8_TETNG        0.75  0.85    1  291  361  675  315    2   26  701  H3BWE8     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=RPS6KA5 PE=4 SV=1
    9 : M4AMS0_XIPMA        0.75  0.84    1  291  402  716  315    2   26  804  M4AMS0     Ribosomal protein S6 kinase OS=Xiphophorus maculatus GN=RPS6KA5 PE=3 SV=1
   10 : G3QA74_GASAC        0.60  0.79    1  291  394  708  315    2   26  759  G3QA74     Ribosomal protein S6 kinase (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
   11 : H9H7V4_MONDO        0.60  0.79    1  291  103  419  317    3   28  448  H9H7V4     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=RPS6KA4 PE=4 SV=1
   12 : I7GN41_MACFA        0.60  0.79    1  291   26  342  317    3   28  398  I7GN41     Macaca fascicularis brain cDNA clone: QflA-19410, similar to human ribosomal protein S6 kinase, 90kDa, polypeptide 4(RPS6KA4), mRNA, RefSeq: NM_003942.1 OS=Macaca fascicularis PE=2 SV=1
   13 : G1QYV2_NOMLE        0.59  0.78    1  291  399  715  320    5   34  771  G1QYV2     Ribosomal protein S6 kinase OS=Nomascus leucogenys PE=3 SV=1
   14 : G5B6P5_HETGA        0.59  0.77    1  281  400  706  310    5   34  768  G5B6P5     Ribosomal protein S6 kinase OS=Heterocephalus glaber GN=GW7_20667 PE=3 SV=1
   15 : K7BI90_PANTR        0.59  0.78    1  291  400  716  320    5   34  772  K7BI90     Ribosomal protein S6 kinase OS=Pan troglodytes GN=RPS6KA4 PE=2 SV=1
   16 : U3ETT5_CALJA        0.59  0.78    1  291  400  716  320    5   34  772  U3ETT5     Ribosomal protein S6 kinase alpha-4 isoform a OS=Callithrix jacchus GN=RPS6KA4 PE=2 SV=1
   17 : H0WVS0_OTOGA        0.58  0.78    1  291  400  716  320    5   34  764  H0WVS0     Ribosomal protein S6 kinase OS=Otolemur garnettii GN=RPS6KA4 PE=3 SV=1
   18 : H3AQU0_LATCH        0.56  0.74    1  281  355  658  306    5   29  658  H3AQU0     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
   19 : R7U598_CAPTE        0.52  0.73    1  291  376  692  326    7   46  722  R7U598     Ribosomal protein S6 kinase OS=Capitella teleta GN=CAPTEDRAFT_1743 PE=3 SV=1
   20 : K1R902_CRAGI        0.50  0.69    1  291  401  716  324    7   43  901  K1R902     Ribosomal protein S6 kinase alpha-5 OS=Crassostrea gigas GN=CGI_10016528 PE=4 SV=1
   21 : D4AFY0_HAELO        0.49  0.69    1  291  405  723  328    7   48  973  D4AFY0     Ribosomal protein S6 kinase OS=Haemaphysalis longicornis PE=2 SV=1
   22 : H2XJU0_CIOIN        0.43  0.61    2  291  404  736  341    8   61  813  H2XJU0     Uncharacterized protein OS=Ciona intestinalis GN=rps6ka5 PE=4 SV=1
   23 : A8X620_CAEBR        0.40  0.61    2  291  371  691  331    8   53  772  A8X620     Ribosomal protein S6 kinase OS=Caenorhabditis briggsae GN=rskn-2 PE=3 SV=2
   24 : G4ZC03_PHYSP        0.38  0.56   20  251   21  273  261    6   39  327  G4ZC03     Putative uncharacterized protein OS=Phytophthora sojae (strain P6497) GN=PHYSODRAFT_263632 PE=4 SV=1
   25 : J9MCX6_FUSO4        0.37  0.57   21  239   25  267  250    6   40  315  J9MCX6     Uncharacterized protein OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=FOXG_00725 PE=4 SV=1
   26 : D3BKT2_POLPA        0.35  0.56   18  265   12  280  277    6   39  312  D3BKT2     Uncharacterized protein OS=Polysphondylium pallidum GN=PPL_09164 PE=4 SV=1
   27 : J9I202_9SPIT        0.34  0.53   23  253   25  274  258    5   37  317  J9I202     Protein kinase domain containing protein OS=Oxytricha trifallax GN=OXYTRI_15618 PE=4 SV=1
   28 : N6UDQ6_DENPD        0.34  0.58   19  266   29  307  282    9   39  365  N6UDQ6     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=D910_11995 PE=4 SV=1
   29 : A7RTX6_NEMVE        0.33  0.52   15  249    8  287  280    6   47  365  A7RTX6     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g93027 PE=4 SV=1
   30 : A8IPF1_CHLRE        0.33  0.54   21  249   15  269  261    7   40  269  A8IPF1     Predicted protein (Fragment) OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_115049 PE=4 SV=1
   31 : E0VA03_PEDHC        0.33  0.57    1  266   12  299  295    8   38  353  E0VA03     cAMP-dependent protein kinase catalytic subunit, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM025040 PE=4 SV=1
   32 : F0ZY89_DICPU        0.33  0.54   21  265   15  280  274    6   39  314  F0ZY89     Putative uncharacterized protein OS=Dictyostelium purpureum GN=DICPUDRAFT_95599 PE=4 SV=1
   33 : F4PYJ1_DICFS        0.33  0.56    1  251   30  292  275    5   38  308  F4PYJ1     Putative uncharacterized protein OS=Dictyostelium fasciculatum (strain SH3) GN=DFA_02043 PE=4 SV=1
   34 : H9G3L0_ANOCA        0.33  0.55   13  259    5  298  294    7   49  395  H9G3L0     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100557602 PE=4 SV=1
   35 : N6U0G0_DENPD        0.33  0.54   19  250   26  275  256    4   32  356  N6U0G0     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=YQE_09351 PE=4 SV=1
   36 : N6UHQ5_DENPD        0.33  0.54   19  250   26  275  256    4   32  331  N6UHQ5     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=YQE_03427 PE=4 SV=1
   37 : A2BGS0_DANRE        0.32  0.54    1  274   12  330  324    9   57  475  A2BGS0     Uncharacterized protein OS=Danio rerio GN=mapkapk5 PE=2 SV=1
   38 : F2CVF8_HORVD        0.32  0.53   22  252   34  283  262    6   45  333  F2CVF8     Predicted protein OS=Hordeum vulgare var. distichum PE=2 SV=1
   39 : I3IT67_DANRE        0.32  0.53   21  257    2  259  266    5   39  294  I3IT67     Uncharacterized protein (Fragment) OS=Danio rerio GN=camk2a PE=4 SV=1
   40 : K5WEB3_PHACS        0.32  0.53   23  252   23  276  260    5   38  347  K5WEB3     Uncharacterized protein OS=Phanerochaete carnosa (strain HHB-10118-sp) GN=PHACADRAFT_173010 PE=4 SV=1
   41 : Q25108_HEMPU        0.32  0.57   16  270   19  299  286    7   38  350  Q25108     MAPKAPK-4 OS=Hemicentrotus pulcherrimus PE=2 SV=1
   42 : A7S729_NEMVE        0.31  0.57   16  266   27  301  284    8   44  348  A7S729     Predicted protein OS=Nematostella vectensis GN=v1g207834 PE=4 SV=1
   43 : B0S5N5_DANRE        0.31  0.51   23  258   28  281  262    5   36  316  B0S5N5     Uncharacterized protein OS=Danio rerio GN=pnck PE=4 SV=1
   44 : B8LP72_PICSI        0.31  0.51   15  249   13  274  269    6   43  283  B8LP72     Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1
   45 : F1L6N6_ASCSU        0.31  0.49   18  270   39  321  294    9   54  409  F1L6N6     Phosphorylase b kinase gamma catalytic chain OS=Ascaris suum PE=2 SV=1
   46 : F6Q786_HORSE        0.31  0.54    1  274   12  332  326   11   59  473  F6Q786     Uncharacterized protein OS=Equus caballus GN=MAPKAPK5 PE=4 SV=1
   47 : F6WED0_CALJA        0.31  0.54    1  274   12  332  325    9   57  475  F6WED0     Uncharacterized protein OS=Callithrix jacchus GN=MAPKAPK5 PE=4 SV=1
   48 : G7N5I2_MACMU        0.31  0.54    1  274   12  330  324    9   57  473  G7N5I2     MAP kinase-activated protein kinase 5 isoform 2 OS=Macaca mulatta GN=MAPKAPK5 PE=2 SV=1
   49 : H2ZGT8_CIOSA        0.31  0.56   29  266   10  270  267    7   37  323  H2ZGT8     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
   50 : I3KAY5_ORENI        0.31  0.54    1  274   12  330  324    9   57  471  I3KAY5     Uncharacterized protein OS=Oreochromis niloticus GN=mapkapk5 PE=4 SV=1
   51 : K7CJV6_PANTR        0.31  0.54    1  274   12  330  325   11   59  473  K7CJV6     Mitogen-activated protein kinase-activated protein kinase 5 OS=Pan troglodytes GN=MAPKAPK5 PE=2 SV=1
   52 : K9IST6_DESRO        0.31  0.54    1  274   31  349  325   11   59  490  K9IST6     Putative map kinase-activated protein kinase 5 (Fragment) OS=Desmodus rotundus PE=2 SV=1
   53 : M4AP00_XIPMA        0.31  0.54    1  274   12  332  326    9   59  473  M4AP00     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
   54 : B7G129_PHATC        0.30  0.52   18  254    1  257  265    6   38  293  B7G129     Predicted protein (Fragment) OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_1859 PE=4 SV=1
   55 : F0X2L4_9STRA        0.30  0.48   21  238   72  328  264    5   55  330  F0X2L4     Calcium/calmodulindependent protein kinase putative OS=Albugo laibachii Nc14 GN=AlNc14C1239G12846 PE=4 SV=1
   56 : J9EPB6_9SPIT        0.30  0.49   38  273   40  330  303   11   81  408  J9EPB6     Calcium-dependent protein kinase 2 OS=Oxytricha trifallax GN=OXYTRI_11515 PE=4 SV=1
   57 : K2N8Z2_TRYCR        0.30  0.52   21  252   19  263  258    7   41  278  K2N8Z2     Serine/threonine protein kinase, putative OS=Trypanosoma cruzi marinkellei GN=MOQ_004902 PE=4 SV=1
   58 : K2NGG2_TRYCR        0.30  0.50   21  249   19  267  261    6   46  297  K2NGG2     Serine/threonine protein kinase, putative,protein kinase, putative OS=Trypanosoma cruzi marinkellei GN=MOQ_008222 PE=4 SV=1
   59 : L5LP73_MYODS        0.30  0.53   19  260    1  260  268    5   36  322  L5LP73     Calcium/calmodulin-dependent protein kinase type 1B (Fragment) OS=Myotis davidii GN=MDA_GLEAN10006532 PE=4 SV=1
   60 : Q5HZR1_XENLA        0.30  0.48   21  278   33  320  297    8   50  395  Q5HZR1     LOC496328 protein OS=Xenopus laevis GN=phkg2 PE=2 SV=1
   61 : R7QA21_CHOCR        0.30  0.50   21  264   16  278  275    7   45  290  R7QA21     Serine/threnine protein kinase OS=Chondrus crispus GN=CHC_T00008731001 PE=4 SV=1
   62 : S0CSE3_LEIGU        0.30  0.52   21  249   19  267  261    6   46  297  S0CSE3     Serine/threonine kinase, putative,protein kinase,putative OS=Leishmania guyanensis GN=LgM4147LRVneg.07.00200.00090 PE=4 SV=1
## ALIGNMENTS    1 -   62
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1  415 B K              0   0  247   32   38  KKKKKKKQKEQQQQQQQKKKK         K N   K        KKK KKKK         
     2  416 B D        -     0   0  119   34   37  DDDDDDDDDEDDDDDDDDNNNDS       S E   E        EEE EEEE         
     3  417 B S    >>  -     0   0   22   34   50  SSSSSSSSSSSSSSSSSSSSSSS       T G   T        TTT TTTV         
     4  418 B P  H >> S+     0   0   54   34   53  PPPPPPPPPQPPPPPPSPPAAES       P P   S        SSS SSSS         
     5  419 B F  H >> S+     0   0    0   34   31  FFFFFFFFFFFFFFFFFFFFFFF       I L   I        III IIII         
     6  420 B Y  H <4 S+     0   0   92   34   37  YYYYYYYYYFFFFFFFFFFFFFF       I N   L        LLL LLLL         
     7  421 B Q  H << S+     0   0  100   34   52  QQQQQQHMMQQQQQQQQQQQQTA       N Q   E        EEE DEED         
     8  422 B H  H << S+     0   0   77   34   71  HHHHHHHSNHLQQQQQQHANNLK       D N   E        EEE EEEE         
     9  423 B Y  E  <  -J  317   0D   1   34    0  YYYYYYYYYYYYYYYYYYYYYYY       Y Y   Y        YYY YYYY         
    10  424 B D  E     -J  316   0D  82   34   54  DDDDDDEEEEEEEEEEEEEEDEK       E T   N        NNS NSNI         
    11  425 B L  E     -J  315   0D  41   34   30  LLLLLLLMMLLLLLLLLMIILLL       I L   I        III IIII         
    12  426 B D        +     0   0   64   34   48  DDDDDDDDDCDDDDDDDDDDIDD       S G   N        NNN NNNN         
    13  427 B L  S    S+     0   0  115   34   55  LLLLLLLLLLLLLLLLLLLLTLK       N .L  W        WWW WWWW         
    14  428 B K  S    S+     0   0  173   34   79  KKKKKKKRQHRRRRRRRKRSRDS       N .Q  T        TTT TTTT         
    15  429 B D  S    S-     0   0   93   36   46  DDDDDDEDDGEEEEEEEEEEETE     E V .E  Q      E QQQ QQQQ         
    16  430 B K        -     0   0  182   39   67  KKKKKKKSSPPPPPPPPKNKGEN     E L NE  K   KK E KKK KKKK         
    17  431 B P        -     0   0   33   39   83  PPPPPPPVAPAAAAAAAPNPIPG     P G EV  L   VV V LLL LLLL         
    18  432 B L  S    S-     0   0   96   42   56  LLLLLLLLLLLLLLLLLLLILLl  L  L L IL  G   LL ILGgG GGGGL        
    19  433 B G  B     -K  312   0D  28   39    7  GGGGGGGGGGGGGGGGGGGGGGg  G GG G GGGG.   GG GG.g. ....K    G   
    20  434 B E        +     0   0  143   47   79  EEEEEEEEEEQQQQQQQEDDDDKE R LQ I REAAA   LV RRAIA AAAAS    R   
    21  435 B G    >   +     0   0   52   57    4  GGGGGGGGGGGGGGGGGGGGGGGGGG GGGSGGGGGG G GG GGGSG GGGGGG GGGGGG
    22  436 B S  T 3  S-     0   0   88   57   74  SSSSSSSSSSSSSSSSSSTSSSANSA IKE.AAASSISA II RLIGI IIIIST NNAVNN
    23  437 B F  T 3  S+     0   0  107   60   57  FFFFFFFFFFFFFFFFFFFFFFFFYFFSKY.FFHYYSFFYNNFFASPS SSSSFF FFFSYF
    24  438 B S  E <   - L   0 329D  27   61   34  SSSSSSSSSSSSSSSSSSSSSSSSSSAGGSGSSASSGGSAGGSGSGVG GGGGAS SSSSGS
    25  439 B I  E     - L   0 328D  33   61   75  IIIIIIIIIVVVVVVVVIVIVVVIVIIKVKKVIKYYPKVIKKEVTPRP PPPPTI TKETLK
    26  440 B C  E     +KL 305 327D  33   61   48  CCCCCCCCCCCCCCCCCCCCCCVVVVVVVVVVVVCCVVVVVVVIVVSV VVVVVV VVVVVV
    27  441 B R  E     - L   0 326D  51   61   50  RRRRRRRRRRRRRRRRRRRRRRRKKYRVHVVFRQKKRKRKLLRRRRRR RRRRCR RKVRKK
    28  442 B K  E     + L   0 325D  86   61   85  KKKKKKKRRKRRRRRRRRRKKKREELSEGEELEALLVHREEEVRKVVV VVVVRE QILRLI
    29  443 B C  E     -JL 297 324D   0   62   36  CCCCCCCCCCCCCCCCCCCCCCCCCVACCCCVACGGCACACCACCCCCCCCCCGG CGACAA
    30  444 B V  E     -JL 296 323D  31   62   77  VIIILTLTTRRRRRRRRRKLIVETVTVFIICTTMVVVRVVIFQFVVVVTVVVVTV TRQIVR
    31  445 B H  E  >> -JL 295 322D  37   62   60  HHHHHHHHHHQQQQQQQQHHNERNHENNNNSEHNHHKHKHDDHNEKKKNKKKKHH DDEHND
    32  446 B K  T  45S+     0   0   76   61   55  KKKKRKKKKKRRRRRRRLKKKLVRIKIKTMKKRLKKKRVIKKRKKKKKRKKNKRK .IRRRT
    33  447 B K  T  45S+     0   0  182   62   80  KKKKKKKKTQQQQQQQQQQAKSAADKKNIVIKAIAASALKKKCRGSSSKSSSSAP AEGEDE
    34  448 B S  T  45S-     0   0   62   62   44  SSSSSSTTTTSSSSSSSTSTTTDTTTTTTDSTSTTTTTSTSTTSTTTTTTTTSTT QTSTTT
    35  449 B N  T  <5 +     0   0  128   62   57  NNNNNNSGGGGGGGGGGGGQGGGGGKGKNHKKGNGGQGGGKNQGGQQQGQQQQGK GGSGGG
    36  450 B Q  E   < -L  317   0D 114   62   58  QQQQQQQQQNQQQQQQQQKKLRADRKEELKEKEKQQEDQQEDKQLEEEQEEEERQ QKHREK
    37  451 B A  E     +L  316   0D  31   62   75  AAAAEAEKQEEEEEEEEEEQAEQRYQKKERKQREKKRHEYKKLQMRRRKRRRRKK KELQQE
    38  452 B F  E     -LM 315 371D  13   63   32  FFFFYYYYFFFFFFFFFYYYYFFYYWVFYYFWVYYYFFYYFHVAFFFFCLFFLVYYWWVFFW
    39  453 B A  E     -LM 314 370D   6   63    0  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
    40  454 B V  E     -LM 313 369D   0   63   35  VVVVVVVVVVVVVVVVVVVVVVVVAMILVVLMIVVVLVACLLVCVLLLLLLLLIIVVILVVI
    41  455 B K  E     -LM 312 368D  30   63    0  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    42  456 B I  E     -LM 311 367D  13   63   25  IIIIIIIIIIIIIIIIIIIIIIICVVIVIIVISIIIIIIVVVCTIIIIIIIIICCIIICIIV
    43  457 B I  E     -LM 310 366D   4   63   26  IIIIIIIVVVLLLLLLLLIVVIVIIIIIILLIIIIILLIILLIIVLLLLLLLLVIIIIIIVI
    44  458 B S  E >   - M   0 365D  25   63   83  SSSSSSSSSSSSSSSSSSSSSSSNNDDLQEHDKEEEIDNNAHRRDFLLAILFILKNDDSEKD
    45  459 B K  G >  S+     0   0   56   63   55  KKKKKRKKKRRRRRRRRKRRRRQKKRRKKKDKTKKKDRTKDDKKIDDDDDDDDRRKKKKVKK
    46  460 B R  G 3  S+     0   0  202   63   64  RRRRRRRRRRRRRRRRRRRRRRRARKQMSANKQRSSRGKKNNRASRRRCRRRRKDEGEKTEE
    47  461 B M  G X> S+     0   0   51   63   89  MMMLMMMMMMLLLLLLLMMLIWFalssqpnVsflRRPrklTLadTPPPEPPPPdgqrqaPaq
    48  462 B E  H <>  +     0   0   33   45   53  EEEEEEEEEEEEEEEEEE...EArekesrp.knr...dhe..er.........dileeeEde
    49  463 B A  H 3> S+     0   0   80   47   78  AAAAAAAAAAMAAAAAAS...LSSHAIERG.GKSCC.DQY..SE.........AEKDEARVE
    50  464 B N  H <> S+     0   0   50   63   76  NNNNNNNQQNNNNNNNNNDDDQQNMAAKRAKALRDDKQKMKKMCEKKKKKKKKAARQQLLDQ
    51  465 B T  H  X S+     0   0    0   63   78  TTTTTTTTTTTTTTTTTTSCTSALVLLAILALLVCCAVLVAALLRAAAAAAAAILLMLVSIL
    52  466 B Q  H  X S+     0   0  117   63   73  QQQQQQQQQQQQQQQQQQTTTMQVRQQKLSREMFRRRRDRRRENQRRRRRRRRYTQLKEPKK
    53  467 B K  H  X S+     0   0   27   63   65  KKKKKKRRRRRRRRRRRRRRQLRQNTTRNRRTRREENRRNRRNSSNNNRNNNNDTQRRNERR
    54  468 B E  H  X S+     0   0    8   63    5  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQEE
    55  469 B I  H  X S+     0   0   23   63   25  IIIIIIIIIVIVVVVVVIIVVLAIIIVVIVVIIVVVVIAIVVVIHVVVVVVVVVVIVIILII
    56  470 B T  H  X S+     0   0   64   63   74  TTTTTTTAAAAAAAAAATHNQRREAEDTEAEEEEEERARAEEAKERRRDRRRRAANAAAKAA
    57  471 B A  H  X S+     0   0    0   63   68  AAAAAAAAAAAAAAAAAALLLSIIVIILLVLIIMIILTIVLLVIALLLLLLLLIINVVVEIV
    58  472 B L  H  < S+     0   0    5   63   55  LLLLLLLLLLLLLLLLLLLLLLLLLMLHLTHMMLLLHLCLHHLMAHHHHHHHHLLLMMLVMM
    59  473 B K  H >< S+     0   0   96   63   64  KKKKKKRKKRRRRRRRRKRRRSEKKKSWYRWKKYRRMTRKYWRQRMMMWMMMMAKKRKRRKK
    60  474 B L  H 3< S+     0   0   73   63   72  LLLLLLLLLQLLLLLLLLLKLHMDKKQRRMKKKQRRMMLRRKRYLMMMRMMMMSQISMRLAM
    61  475 B C  T >< S+     0   0    1   63   71  CCCCCCCCCCCCCCCCCCCCCCVLVIIACLAVVCYYCLLVASIVLCCCACCCCLVILLVSLL
    62  476 B E  T <   +     0   0   70   63   72  EEEEEEEDDEQQQQQQQDQQQQQSsDDSRASEGQNNAAKssSNSnAAASAAAANsDRHStDR
    63  477 B G  T 3  S+     0   0   74   49   58  GGGGGGGGGTSSSTSSSAGGGGG.g..GGGG.DGQQS..gfL.GgTTTGNTTN.e....n..
    64  478 B H    X   -     0   0   25   63   20  HHHHHHHHHHHHHHHHHHHHHHHHHHHCHFHHHHHHHHHHPCHHHHHHCHHHHHHHHQHHHQ
    65  479 B P  T 3  S+     0   0   73   63   31  PPPPPPPPPPPPPPPPPPPPPPPPQPPRRSRPPRPPPPPPIPEPPSPPKPPPPPPPEPPPTP
    66  480 B N  T 3  S+     0   0    8   63   28  NSNNNNNNNNNNNNNNNNNNNNNNNNNHNHHNNNGANNNNNYNTSNNNHNNNNHNNNNNSNN
    67  481 B I  B <  S-o  432   0E   7   63   10  IIIIIIVIIIVVVVVVVIIIIIIIIIVIITIIIIIIIVIIIIIVIIIIIIIIIIIIIIIIII
    68  482 B V        -     0   0   11   63   11  VVVVVVVVVVVVVVVVVVVVVVVILVVVLVVVLLVVVVVVVVVVIVVVVVVVVVMVVIVIVI
    69  483 B K        -     0   0   97   63   73  KKKKKKKKKKKNNNNNNKQTQKQKTRKNERNKKESSKRRTHGSANQQQCQQQQPIKAEASAE
    70  484 B L  E     -N  370   0D   2   63   27  LLLLLLLLLLLLLLLLLLLLFLLLLMLICVIMLLLLILLLIILLIIIIIIIIILLYLLLLLL
    71  485 B H  E     -     0   0D  88   63   80  HHHHYHHHHHQHHHHHHVHQVYHFVHYIIHIHYIKKMHHHRKEHHIIICLIILIYFRREINH
    72  486 B E  E     -N  369   0D  64   63   23  EEEEEEEEEEEEEEEEEDDEENDDDEEDEEDEEERREEDDDDEDDEEEDEEEEDDEDEDDDE
    73  487 B V  E     -N  368   0D  40   63   44  VVVVVVVIIVVVVVVVVVVSAVVVYYIVYVVYVFVVVVSYIVTVFVVVVVVVVFFTVVVSVV
    74  488 B F  E     -N  367   0D  18   63   42  FFFFYFFYYYHHHHHHHYFMFFHYFFFYFLYFYFYYYAIFYYFYYFFFYYFFYFFFMMHYLM
    75  489 B H  E     +N  366   0D  92   63   67  HHHHHHHHHTHHHHHQQHQVQQSDEEDEEEEEEEEEAASEEEEEEAAAEAAAADAIEQEEYQ
    76  490 B D        -     0   0   39   63   53  DDDDDDDDDDDDDDDDDDDDDDDGTSDnDDnSTEDDnSETnnTDtnnnnnnnnEEDSTSsST
    77  491 B Q  S    S+     0   0  198   63   74  QQQQQQQQQQQQQQQQQQEEEKPDMTKnRKgTKETTpKESgkPDtpppnpppeKEPNTPtPS
    78  492 B L  S    S+     0   0  118   63   95  LLLLLLLLLYYLLLLLLHIFAHLgNDDkEHnDKDQQrTGHqnTDFrrrrrrrrDRNNNSFKH
    79  493 B H  E     -M  330   0D  58   61   71  HHHHHHHHHHHHHHHHHHHHHHHmNKCcRCcKHRSSrKHNccKF.rrrcrrrrCYYHHH.RH
    80  494 B T  E     -MN 329 361D   0   63   73  TTTSTTTTTTTTTTTTTHTTTTFCLIMLFYLILFVVLIHLLLLVLLLLLLLLLYYIYILIVI
    81  495 B F  E     -MN 328 360D   0   63   32  FFFFFFFYFYYYYYYYYHYYYYYFYYYFYYLYHYYYLYYYLLYHFLLLVLLLLFYYYYYFFY
    82  496 B L  E     -MN 327 359D   0   63   26  LLLLLLLLLLLLLLLLLFIIIILLLLLVLLVLLLLLIMLLVVLLAIIIIIIIIILLLLLLML
    83  497 B V  E     -MN 326 358D   0   63    8  VVVVVVVVVVVVVVVVVIVVVVIVVVVVIVVVVVVVVVIVVVVVVVVVVVVVVVVLIVAVVV
    84  498 B M  E     -MN 325 356D  22   63   25  MMMMMMMLLMLLLLLLLILLLMMMTVLMFLMVLFLLMLFFMMMMFMMMMMMMMMTMLLMFML
    85  499 B E  E     -M  324   0D  56   63    7  EEEEEEEEEEEEEEEEEEEEEEEEDEEEEEEEEEEEEEDDEETEEEEEEEEEEEEEEEEDEE
    86  500 B L        -     0   0   34   63   39  LLLLLLLLLLLLLLLLLMLLLLLYLLLCKLCLLKLLMFLLCCLMMMMMRMMMMLFLYLLLLL
    87  501 B L        +     0   0   16   63   47  LLLLLLLLLLLLLLLLLSLLLLLAAVMMMCMVVMLLMVVCMMLCAMMMMMMMMMMCVVVMVV
    88  502 B N        +     0   0  117   63   78  NNNNNNKGGRRRRRRRQAKKTHTELNTERKETKRTMENTTESTSPEEEQEEEESEEPTTKRT
    89  503 B G  S    S-     0   0   10   63    6  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGRGG
    90  504 B G        -     0   0   31   63    4  GGGGGGGGGGGGGGGGGSGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    91  505 B E  B >>  -P  423   0E  59   63   18  EEEEEEEEEEEEEEEEEIEEEEEEEQEEPEEPESDDEEEEEEEDEEEEEEEEEDEEEEEEEE
    92  506 B L  H >> S+     0   0    0   63    7  LLLLLLLLLLLLLLLLLSLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLVLLLLLL
    93  507 B F  H 3> S+     0   0   27   63   10  FFFFFFLLLLLLLLLLLYLLLLLFFFFFLFFFFLLLFFFFFFLFFFFFFFFFFFFFFFFFFF
    94  508 B E  H <> S+     0   0   71   63   47  EEEEEEEEEEEEEEEEENQDESEDDDDQKDQDETDDHDEDSENDEHHHNHHHHDDSDDDDEE
    95  509 B R  H << S+     0   0   67   63   52  RRRRRRRRRRHHHHHHHCRRRMRRRKRrHHRRKHYYRRDRRRRrMRRRVRRRRRRKKRRYSK
    96  510 B I  H >< S+     0   0    1   62   12  IIIIIIIIIIIIIIIII.IIIIIIIIIqIIIIIIMMIIIIIIIvLIIIIIIIIIIIIIILII
    97  511 B K  H 3< S+     0   0   75   63   89  KKKKKKQRRKRRRRRRRRRRRRRICMVDELQVVHVVSAVCQQLSNSSSQSSSSGVVVAMTVA
    98  512 B K  T 3< S+     0   0  154   63   69  KKKKKRKRRRKKKKKKKVKKRDKTREEKKADDQRMMQMAAEREKKQQQEQQQQTENQAEEKT
    99  513 B K    <   -     0   0   44   63   55  KKKKKKKKKKKKKKKKKTKKRHLKKKKARKKKRRKKHKRKRRRKSHHHRHHHHKKKLARKHA
   100  514 B K  S    S+     0   0  168   63   73  KKKKKKKQQKQRRRRRRTKKAPEEGKEEKVQKGRGGKREGSGGSVRRRARRRKKSPKKGVGK
   101  515 B H        +     0   0   46   63   78  HHHHHHHHHLHHHHHHHKHSRTRYSSHgFgdSEHKKHKYNSdStTHHHeHHHHAYMRRSTRR
   102  516 B F        +     0   0    0   61   15  FFFFFFFFFFFFFFFFF.FFFFFYYFYfFyfFYFLLFLYYFfYfVFFFfFFFFYY.LFYLQF
   103  517 B S  B >>  -R  545   0F   0   63   60  SSSSSSSSSGSSSSSSSITTTNTTFSSTTSTSSNTTTSSYTTTSSTTTTTTTTSSDDDTSDD
   104  518 B E  H 3> S+     0   0    4   63    4  EEEEEEEEEEEEEEEEEFEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
   105  519 B T  H 3> S+     0   0   46   63   78  TTTTTTTTTASSSSSSSSTPSACASKLRKARKGLQQKRAARRKEKKKKRKKKKARKSPKKKS
   106  520 B E  H <> S+     0   0   54   63   39  EEEEEEEEEEEEEEEEEEEEEEEEDEEEEEEEDEEEMEDDEEDEKQQQEMQQMDETTTDETT
   107  521 B A  H  X S+     0   0    0   63   14  AAAAAAAAAAAAAAAAAIAAAAAAAAAAAAAAAASSAGAAAAAAAAAAAAAAAAASAAATAA
   108  522 B S  H  X S+     0   0    0   63   59  SSSSSSSSSSSSSSSSSRSSCSAKARAASAAKCSAASRSAAASARSSSASSSSRRARRSRRR
   109  523 B Y  H  X S+     0   0  107   63   85  YYYYYYHRRQQQQQQQQYKNRIDKDIEQLAQLKGVVQRHDESRTRQQQGQQQQDDKQHHCRH
   110  524 B I  H  X S+     0   0    5   63   36  IIIIIIIIILIIIIIIIIIIIIIVLITVVVIVIVIIVLCLIVVILVVVVVVVVLLIYYLIYY
   111  525 B M  H  X S+     0   0    2   63   56  MMMMMMMMMLLLLLLLLVCMFMMVVVIMVMMTVVLLTFIVVVILMTTTMTTTTIVMFFVMFF
   112  526 B R  H  X S+     0   0   52   63   56  RRRRRRRRRQRRRRRRRSRLRKRKRKKNNRRKRRKKKQQRRRYQRKKKRKKKKVKIHHGRHH
   113  527 B K  H  X S+     0   0   23   63   73  KKKKKKRKKSSSSSSSSLKKRQQVAQPEDVEQQDTTQQQISQQKQQQQDQQQQKLQQQQSQQ
   114  528 B L  H  X S+     0   0    2   63   31  LLLLLLLLLLLLLLLLLVLLLILVTLIIILILIILLILIIIVVLLAIIIIIIIMLVLLVLLL
   115  529 B V  H  X S+     0   0   12   63   65  VVVVVVVVVVVVVVVVVSVVVVVALLICCLCLVAAASILLGTLMFIAAGSAASLLFIILLII
   116  530 B S  H  X S+     0   0   57   63   76  SSSSSSSSSSSSSSSSSTSNSSSKSEDVSDSESSKKLDEKQTQEDILLSQLLQKEKAAGEDC
   117  531 B A  H  X S+     0   0    0   63   24  AAAAAAAAAAAAAAAAAAAAAASVAAAAAFASAASSAGAAAAAAGAAAAAAAAAAAGGAAAG
   118  532 B V  H  X S+     0   0    1   63   25  VVVVVVVVVVVVVVVVVILVVVVLVLIVLTVLVLIILVVVVLVIVLLLVLLLLVVVIIVVVI
   119  533 B S  H  X S+     0   0   40   63   80  SSSSSSSSSSSSSSSSSFSDHAKRAERKDEKKGHAAQSLKHAKSAARRKERQASKKYHSYHN
   120  534 B H  H  X S+     0   0   52   63   46  HHHHHHHHHFYFFFFFFNYFFFYYYYYYFHYYHFYYHYHYHHYYFLHHYHHHHYYYYYYYYY
   121  535 B M  H ><>S+     0   0    0   63   74  MMMMMMMMMMMMMMMMMYMMMMLCLLCLLALLLLLLCCCILLLCMQCCLCCCCCCLCCLLCC
   122  536 B H  H ><5S+     0   0   13   63    0  HHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhHHHHHHHHHH
   123  537 B D  H 3<5S+     0   0  126   61   69  DDDDDDDDDEeeeeeeeDSSAEDADKGDKRDSENEESGQEVSQSEhLLDS..SADNSTSTHR
   124  538 B V  T <<5S-     0   0   44   63   86  VVVVVVVVVAAAAAAAAVRKRKKEHIMLQEMINKNNLKMCMLLMRlLLILllLRFIKHLNRQ
   125  539 B G  T < 5S+     0   0    6   63   40  GGGGGGGGGGGGGGGGGRGGGGRGGGGDGGNGGGGGNGGGNNGGNNNNTNNNNKDGGGGNGG
   126  540 B V  E   < -S  440   0G   0   63   19  VVVVVVVVVVVVVVVVVKVIVIIVIIIIIIIIIIVVIVVIIIVIIIIIIIIIIIIIFIIIVI
   127  541 B V  E     -S  439   0G   0   63   55  VVVVVVVVVVVVVVVVVCVVVVVTVVMAAIAVAAVVAYVVAAVAVAAAAAAAAAVMAAVVYA
   128  542 B H        -     0   0    0   63    0  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
   129  543 B R        +     0   0   70   63    7  RRRRRRRRRRRRRRRRRNRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRCRRRRRRRR
   130  544 B D        +     0   0   16   63    3  DDDDDDDDDDDDDDDDDVDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   131  545 B L        +     0   0    2   63    5  LLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLILLLLVLLLLMLLLLLLLL
   132  546 B K    >   -     0   0   47   63    3  KKKKKKKKKKKKKKKKKVKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
   133  547 B P  G >  S+     0   0   13   63    7  PPPPPPPPPPPPPPPPPIPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPPPPPPPPP
   134  548 B E  G 3  S+     0   0   34   63   15  EEEEEEEEEEEEEEEEEKEEEEEEEEEEEHEEQEAAEEEEEEEDEEEEEEEEEKEEEEEEEE
   135  549 B N  G <  S+     0   0    8   63    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNnNNNNNNNNNNNNNNNNNNNNNNNnNNNNNNNN
   136  550 B L  E <   + Q   0 432E   2   63   21  LLLLLLLLLVIIIIIIIILLLIILLLLLIlLLLIIILVLLLLLIILLLLLLLLlLILLLILL
   137  551 B L  E     -PQ 377 431E  33   63    5  LLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLILLILLLLLLLLLLLLMLLLLLL
   138  552 B F  E     - Q   0 430E   2   63   32  FFFFFFFFFFYYYYYYYFYFFFFYFLYYCLYLCCLLFILFYYFFCFFFYFFFFMLFLLYMLL
   139  553 B T              0   0   29   63   77  TTTTTTTTTAAAAAAAAASVTVEARKGSSNSKTEAAKDARRAEAIKKKSKKKKSTVDDADGD
   140  554 B D              0   0  125   63   53  DDDDDDDDDDDDDDDDDDDDDQSDTSSKHEHTGSDDDRSTDNTNDDDDADDDDDSNAATDEA
   141      ! !              0   0    0    0    0  
   142  559 B L              0   0   98   63   72  EEEEEEEEEEEDDDDDDEEESATEPERKEHKPDPRRNKKKRHPNDNNNINNNNDRKNNPCNN
   143  560 B E        -     0   0   69   63   73  nnnnnntssaattttttssssPdteqdgnvstesnnsgsrtslsesssgssssnddgdflgd
   144  561 B I  E     - Q   0 424E   1   62   24  iiiiiiiiilvvvvvvviiii.liliilviliivvvvivilliivvvvlvvvviiilliill
   145  562 B K  E     - Q   0 423E  18   62   30  KKKKKKKKKKKKKKKKKKKKK.RKLAKKKRKARKRRKKKMKKVKVKKKKKKKKKKKKKMKKK
   146  563 B I  E     +oQ 353 422E   1   62   27  VVVVVVIIIVIIIIIIIVIIV.LIILILIILLVIIILILILLILILLLLLLLLLLIIIVLII
   147  564 B I        +     0   0   39   63   73  IIIIIIIIIIIIIIIIIIVVVTVAASATCITSACSSCSAATTSASCCCTCCCCAAISSSSTS
   148  565 B D        +     0   0   54   63    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   149  566 B F    >   +     0   0    1   63    5  FFFFFFFFFFFFFFFFFFFFFTFFFFFFFFFFFFLLFFFFFFFFFFFFFFFFFFFFFFFFFF
   150  567 B G  T 3  S+     0   0    7   63    5  GGGGGGGGGGGGGGGGGGGGGngGGGGGDGGGGDGGGGGGGGGGGGGGGGGGGGGgGGGGGG
   151  568 B F  T 3  S+     0   0  109   63   17  FFFFFFFFFFFFFFFFFFFFFflFLLLFLTFLLLFFFLLLFFLQFFFFFFFFFFFfLLLFFL
   152  569 B A    <   -     0   0    0   63   38  AAAAAAAAAAAAAAAAAASAAgRASSAAASASSgAAACASAASAAAAAAAAAAAAlSSSSSS
   153  570 B R  E     -S  413   0G  83   63   59  RRRRRRRRRRRRRRRRRRCRRrKKRKRKSDKKKqKKKAIRKKKSTKKKKKKKKAKdNNKCAN
   154  571 B L  E     -S  412   0G  60   63   63  LLLLLLLLLLLLLLLLLLLLLLMLIIFEGYEIILQQILEVEEMSQIIIPIIIIRKILLIIML
   155  572 B K        -     0   0  107   63   92  kkkkkkkkkcrrrrrrrrkkkktvmlltictlfnlldpvlttefldddtddddvikqhqlrq
   156  573 B P              0   0   86   63   72  nnnnnnnkkeaaaaaaaekkrqdrknegdkgneekkeqrkggqgreeegeeeemesmkeknk
   157  574 B P              0   0  186   62   77  QPHHHHHYYSHQQQQQQPgkatqKKpGPaEPpCaRRpNKKPPQGapppPppppRG.EEQhqE
   158      ! !              0   0    0    0    0  
   159  597 B N              0   0  206   63   88  NNNSNNNDNAQQQGQQQGGDTPPLTTKESDESKSQQYRDTEEKKEYYYEYYYYKQQRRKPDQ
   160  598 B G        +     0   0   31   62   58  GGGGGGGGGGGGGGGGGGEGGGEPGAGKT.KAPIGGTGPGKRTDGTTTHTTTTGAVGGPGGG
   161  599 B Y        +     0   0   48   63    5  YYYYYYYYYYYYYYYYYYYYYYYYHYYYYYYYYYYYYYYHYYYYYYYYYYYYYYYYYYYYYY
   162  600 B D    >   -     0   0   55   63   35  DDDDDDDDDDDDDDDDDDDDSDNDGTDDDDDSDDDDNDGGDDGSGNNNDNNNNDGDNDGGDD
   163  601 B E  T 3> S+     0   0   75   63   58  EEEEEEEEEKEEEEEEEEEEEEESKEKKKKKEEKAAKgKKKKKEVKKKKKKKKQKEggKKgg
   164  602 B S  H 3> S+     0   0   36   63   60  SSSSSSSSSASSSSSSSSSASSQKPAESKTSAARAASlAPSSEKESSSSSSSSQARskAEkk
   165  603 B C  H <> S+     0   0   12   63   44  CCCCCCCCCCCCCCCCCCCCCCCCVVVCCACVCCCCCSVVCCVVVCCCCCCCCSVCAAVVNA
   166  604 B D  H  > S+     0   0    0   63    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   167  605 B L  H  X S+     0   0    6   63   30  LLLLLLLLLLLLLLLLLLLLLLLILMYILIIMLLIILILVMMLVNLLLMLLLLMIMIIVLAI
   168  606 B W  H  X S+     0   0    5   63    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   169  607 B S  H  X S+     0   0    4   63   18  SSSSSSSSSSSSSSSSSSSSSSSSASSSSSSGSSSSSSAASSASASSSSSSSSSSSSSAASS
   170  608 B L  H  X S+     0   0    3   63   46  LLLLLLLLLLLLLLLLLLLLLILLLVILLLLVVLLLLCCMLLIALLLLILLLLVVMCCLCCC
   171  609 B G  H  X S+     0   0    0   63    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   172  610 B V  H  X S+     0   0    1   63    4  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVCVVVVVVIV
   173  611 B I  H  X S+     0   0    2   63    5  IIIIIIIIIIIIIIIIIIIIIIVIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIILVVIIIV
   174  612 B L  H  X S+     0   0    0   63   45  LLLLLLLLLLLLLLLLLLLLLLLATSLMLLMTTLFFVLLTMMTVLIIIMIIIIVTLLLSVLL
   175  613 B Y  H  X S+     0   0   13   63    1  YYYYYYYYYYYYYYYYYYYYYYFYYYYYYYYYYYYYYYYYYYFYYYYYYYYYYYFYYFYFYF
   176  614 B T  H  X S+     0   0    2   63   57  TTTTTTTTTTMMMMMMMTSTTATIFIIIIIIIVIIIVIIFIIIITVVVIVVVILIIVVITVV
   177  615 B M  H  < S+     0   0    0   63    8  MMMMMMMMMMMMMMMMMMMMMVMLLLLLMLLLLLMMMMLLLLLMLMMMLMMMMLLLMMLLMM
   178  616 B L  H  < S+     0   0    0   63    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLM
   179  617 B S  H  < S-     0   0    0   63   45  SSSSSSSSSSSSSSSSSSSSSSSCCCCCSSCCTSCCCIVCCCCSACCCCCCCCSCCAACATA
   180  618 B G  S  < S+     0   0    1   63    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   181  619 B Q        -     0   0   45   62   91  QQQQQQQQQQQQQQQQQQKKRAQ.YFFYYSFFCYCCYQYYFFYVYYYYFYYYYNYYRYYSKY
   182  620 B V    >   -     0   0   17   62   70  VVVVVVVVVVVVVVVVVVAVAVV.TPPPPMPPFPCCPLPTPPPAAPPPPPPPPLPPLLPPQL
   183  621 B P  T 3  S+     0   0    0   61    0  PPPPPPPPPPPPPPPPPPPPPPP..PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   184  622 B F  T 3  S+     0   0    3   61    0  FFFFFFFFFFFFFFFFFFFFFFF..FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   185  623 B Q    <   -     0   0   21   61   92  QQQQQQQQQQQQQQQQQQSQQVH..YYYYGYYWVGGYDWDYYYLYYYYYYYYYMHNEDYWYD
   186  624 B S        -     0   0   29   61   62  SSSSSSSCCSGGgggggSTTTSA..SESgGSSDgIISDDRSSDGHSSSSSSSSGDGDDDHDD
   187  625 B H  S    S+     0   0   84   52   73  HHHHHNQRQEGAqqqqqS.......DE.wPNEKwRRKREDNNDD.KKKHKKKKRE.REE.DE
   188  626 B D  S    S-     0   0  119   55   68  DDDDDDDEEQPSGGGGGY...D.F.DNDENHDNDDHHNDTHHNT.HHHQHHHHTN.NNS.DN
   189  627 B R        +     0   0  131   54   85  RRKKKKRKKRGGGGGGGK...G.P.INHR.GINRPSHMQQGGDP.HHHGHHHHQH.MVD.DV
   190  628 B S  S    S+     0   0  105   55   79  SSSSSSSSSGRQQQQQQG...Q.PPRQGG.LRAGDDSVHQMATQ.SSSLSSSSKN.NNP.EN
   191  629 B L  S    S+     0   0  157   55   92  LLVLLLLLLMGGSSSSSM...S.FFKKLE.AKVESSRVRQAAQE.RRRSRRRREA.AAE.VA
   192  630 B T        -     0   0   91   55   79  TTTTTTTMITGGQQQQQT...L.YDLLAT.ILLAPPTLLEIILI.TTTITTTTLL.LLL.LL
   193  631 B b        -     0   0   33   57   91  CCCCCCCHHSQQAAAAAF.K.RRDRFFIC.SFYCQQIYYMSSYF.IIISIIIIFF.LFF.LF
   194  632 B T        -     0   0   42   60   72  TTTTTTTTTSSSAAAAASSSPASEDEDSRPPEEPAAPQQEPPKE.PPPPPPPPRK.ATS.ET
   195  633 B S     >  -     0   0   61   63   79  SSSSSSSSSYQQEEEEEhsksSrNSSMPtEGSKaLLKKQAGgLArKKKGKKKKKKrKKQrKK
   196  634 B A  H  > S+     0   0   32   47   74  AAAAAAAAAAAA.....aaaa.aQDII.qTMIIqLL.III.iIVq...M....IIsIIIqVI
   197  635 B V  H  > S+     0   0   85   47   86  VAVVVVLEEAAA.....AVSA.TVFMK.EIKLRNKK.FKI.RILL...K....VKKEELMSE
   198  636 B E  H >> S+     0   0   76   57   73  EEEEEEEEEDEE.....DATAEEEEANGMTKSNTKKDKAA.QKCIDDDKDDDDSRERRRLER
   199  637 B I  H 3X S+     0   0    0   63   77  IIIIIIIIIIIIIIIIIIIILIIEEACMLKRAVLMMMGGGMGAGMMMMRMMMMGGVGGAMGG
   200  638 B M  H 3X S+     0   0   12   63   78  MMMMMMMMMMMMMMMMMMMMMMMMMTQKLMINDFDDRDADKQERLRRRIRRRRKKIEESLVE
   201  639 B K  H S+     0   0   36   62   61  KKKKKKKKKKKKKKKKKKRRRRRKA.DRRATDGSGGKKDKRDERMKKKNKKKKEQSQREMER
   203  641 B I  H ><5S+     0   0    2   62   45  IIIIIIIIIIIIIIIIIIIIIIIII.FIIAGFWIQQIIFFIFFFIIIIGIIIIFFVMMFIYM
   204  642 B K  H 3<5S+     0   0  110   62   84  KKKKKKKKKKRRRRRRRKRKRTCLL.PRQGQPPQLLMPPERPDPQMMMQMMMMVDKVADMPA
   205  643 B K  H 3<5S-     0   0  150   62   77  KKKKKRKQQEEEEEEEEEGDEKRNN.STEEFAEEDDTESPNNSSETTTYTTTTSSRRRSDDR
   206  644 B G  T <<5 +     0   0   20   62   55  GGGGGGGGGGGGGGGGGGGGGGAGA.PGGRDEGGSSGWPAGPPDAGGGSGGGGDPAHHPGYH
   207  645 B D      < +     0   0   53   62   92  DDDDDDEDDDRRRCRRREEQEEEDD.YQIKFYLKNNSLEEQEYPKSSSFSSSSDYQVFFRLF
   208  646 B F        -     0   0   25   63   47  FFFFFFFFFFFFFFFFFFFFFFFFYYWYYYPWEYEEFSWYYWWWYFFFPFFFFWWVSSWFSS
   209  647 B S        -     0   0   24   63   69  SSSSSSSSSSSSSSSSSSSDSTSESDDSESSGVEQQDPDWESNLEEEEDDEEDKDNEMDQEA
   210  648 B F        +     0   0   52   63   71  FFFFFFFFFLLLLLLLLLLFFFFFFFDFFMPSSFWWFGTAFYDSFFFFPFFFFDHFAEDFGE
   211  649 B E        +     0   0   99   63   83  EEEEEEEEGDDDDSDDDEESSDEVTPVPPEEIDPKKPAVNPVIIRPPPWPPPPVVSVSIGAA
   212  650 B G  S >> S-     0   0   20   63   67  GGGGGGGGGGGGGGGGGGGSGGGApESDESWSQDSSEQTVDSSSAEEESEEEESSTKRSSRR
   213  651 B E  T 34 S+     0   0  150   43   46  EEEEEEEEEEEEEEEEEEESPLDPeQ.LKE...K..E...P...EEEE.DEED..E...P..
   214  652 B A  T 34 S+     0   0    8   43   70  AAAAAAAAAAAAAAAAAAPEQSAYYY.EEV...D..E...E...QEEE.EEEE..E...E..
   215  653 B W  T <4 S+     0   0    2   43    0  WWWWWWWWWWWWWWWWWWWWWWWFWW.WWW...W..W...W...WWWW.WWWW..W...W..
   216  654 B K  S  < S+     0   0  141   44   76  KKKRKKKRRKQQQQQQQKEKEQTDRK.QSKK..G..S...S...ASSS.SSSS..L...D..
   217  655 B N  S    S+     0   0   78   45   70  NNNNNNNNNGGGGGGGGSNDPNNGGN.KQGS..H..Q...Q...QQQQAQQQQ..F...D..
   218  656 B V        -     0   0    8   47   21  VVVVVVVVVVVVVVVVVVVVVVVVVI.VVVV..ILLI...V...IIIIVIIII..V...R..
   219  657 B S     >  -     0   0   25   48   11  SSSSSSSSSSSSSSSSSSSSSSSSSS.SSSS..SSSS..ST...TSSSSSSSS..T...S..
   220  658 B Q  H  > S+     0   0  108   57   59  QQQQQQEQQEEEEEEEEETQDESQSKDDEGQK.FSSE.PDEQDNFEEEDEEEEDDD..ES..
   221  659 B E  H  > S+     0   0   83   57   66  EEEEEEEQQNEEEEEEEEQKQEDQHEVAEEDE.GEEM.ETDQSSEMMMEMMMMDDE..ST..
   222  660 B A  H  > S+     0   0    0   58    1  AAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAAAA.AAAAAAAAAAAAAAAAAA..AA..
   223  661 B K  H  X S+     0   0   25   58    5  KKKKKKKKKKKKKKKKKKKKKRKKKKKKKKKKKKRRK.KKKKKKKKKKKKKKKKKK..KK..
   224  662 B D  H  X S+     0   0   72   63   39  DDDDDDEDDEEEEEEEEKRDDRNDDHDKDDDHSDVIDNDDNDDDDDDDSDDDDDDDDDDDED
   225  663 B L  H >X S+     0   0    1   63   17  LLLLLLLLLLLLLLLLLLLLVLLLFFLLLFLFLLLLILLFLLFLLVVVLIVVILLLLLFLLL
   226  664 B I  H >X S+     0   0    0   63   16  IIIIIIIIIVVVVVVVVVLIIVIIIIIIILIIVIVVVLIVIIIIIVVVIVVVVVIIIIIIII
   227  665 B Q  H 3X S+     0   0   64   63   71  QQQQQQRQQKRRRRRRRRQQRDTCQNRNSAKNSSSSRKNRKRVRRRRRRRRRRQTVASRSES
   228  666 B G  H << S+     0   0    6   63   81  GGGGGGGEEGGGGGGGGGGGGGGKRCSGHAKCHKIIKRKEKGHRNKKKHKKKKKKNRRHRRR
   229  667 B L  H << S+     0   0    4   63   18  LLLLLLLLLLLLLLLLLLLLLLLMCFLMLMMLLLMMLIMCLLLMILLLLLLLLLMLMMLLLM
   230  668 B L  H  < S+     0   0    0   63    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLL
   231  669 B T     <  -     0   0   12   63   71  TTTTTTTTTTTTTTTTTTTTTTTVTTVNVQTTEVHHKETTRRQCVKKKNKKKKVVQTAEEET
   232  670 B V        +     0   0   37   62   47  VVVVVVVVVVVVVVVVVVVVVVVVIVRVRMIVKRVVVPIITTKRVVVVTVVVVST.VVRVMV
   233  671 B D  S    S-     0   0   85   63   43  DDDDDDDDDDDDDDDDDDDEEDDQDDNDDDDESDSSKNNDDDDDDKKKDKKKKNNKDDDCDD
   234  672 B P  S    S-     0   0   76   63   18  PPPPPPPPPPPPPPTPPPPAAPPPSPPPAPPPPAPPPPPPPPPVVPPPPPPPPPPPPPPPPP
   235  673 B N  S    S+     0   0  133   63   77  NNNNNNNNDEATAAAAATKSQKKSTAAVSAVSDKGGEMSAATATHEEEVEEEEDNKKSQERH
   236  674 B K        +     0   0  128   63   40  KKKKKKKKKTKKKKKKKKKERKKKKKEKQKKKKKKKEKKSEKKKEEEEKEEEESDKKKKKKE
   237  675 B R        -     0   0   45   63    0  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   238  676 B L        -     0   0   41   63   48  LLLLLLIIILLLLLLLLMLMLLLLIYLLYAPYYLPPLIIPLFFLYLLLMLLLLIYLIAFLFI
   239  677 B K     >  -     0   0  143   62   59  KKKKKKKKKKKKKKKKKKTTTKSSTTNSTTTSTSTTTNTTSTNSTTTTTTTTTT NTTTTSS
   240  678 B M  H  > S+     0   0   29   61   64  MMMMMMMMMLLLILLLLMMMMIMA AAIALIAIAASIMAAIVCAAIIIIIIIIA ILVCALL
   241  679 B S  H  4 S+     0   0   74   61   64  SSSSSSSCCSAEEEEEEAEQASQQ KDDEQEADSAAEAADQEEHAEEENEEEEN DEEQESD
   242  680 B G  H >4 S+     0   0   32   61   59  GGGGGGSGGDDGGGGGGNAAEDEE MQDMQEQQEQQGEEEEEQQMGGGDGGGGE QGEQQKG
   243  681 B L  H >< S+     0   0    1   61   56  LLLLLLLLLLLLLLLLLVLVLLLV ALVVLIACVLLVIAAFVAVCVVVFVVVVA CIIAAVV
   244  682 B R  T 3< S+     0   0  130   61   78  RRRRRRRRRKRRRRRRRRRKRLTL LMILKMLLLDDLKLLMMSLLLLLMLLLLV LIMLLKI
   245  683 B Y  T <  S+     0   0  153   61   89  YYYYYYYYYEGDGGGGGYSNAAAD EAHTNKEHKQQALKRNNQERDDDKADDAR NAHQQRA
   246  684 B N    X>  -     0   0   29   61   51  NNNNNNNNNNSSSSSSSNDSHSHH HHNHHNHHHHHHHHHSNHHHHHHHHHHHH HHHHHHH
   247  685 B E  G >4 S+     0   0  120   61   62  EEEEEEEAASSSSSSSSEKEPPMP PPSPPKPPPPPPEPRSPPPPPPPPPPPPK KPPLSPP
   248  686 B W  G 34 S+     0   0    2   61    0  WWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWFWW
   249  687 B L  G <4 S+     0   0    9   61   28  LLLLLLLLLLLLLLLLLLILVVLF IIIIFIIVVLLLFILVIIIMLLLVLLLLL IFFIFFF
   250  688 B Q    X<  -     0   0   76   56   73  QQQQQQQQQQQQQQQQQQQMHQKN TIA  AVAQNNNQSARKS LNNNSNNNNK NA SQA 
   251  689 B D  T 3  S+     0   0  126   54   71  DDDDDDDDDGDDDDDDDDGgTGSD QGQ  QDGG  CKHDQAG ASSSGCSSCA ML GSV 
   252  690 B G  T 3  S+     0   0   66   52   75  GGGGGGGDDAGGGGGGGGSsRAS  AEY  YG C  TDRTCYG TTTTVTTTTS HG DHG 
   253  691 B S    <   -     0   0   42   49   72  SSSSSSSSSASSSSSSSGGQSCA  PGT  TN A  E S STA AEEESEEEER V  AQY 
   254  692 B Q        -     0   0  179   48   65  QQQQQQQQQSAAAAAAATHVSAA  Q A  EQ P  A T AEA AAAAVAAAAD N  ARD 
   255  693 B L        -     0   0   42   47   78  LLLLLLLLLMRRRRRRRLLYHPM  S V  VS D  L V VVL TLLLVLLLL  K  FDA 
   256  694 B S        -     0   0   51   47   70  SSSSSSSSSSSSSSSSSSSSWTD  H P  PE N  D A PPD KDDDPDDDD  S  DQE 
   257  695 B S        +     0   0   14   47   76  SSSSSSSSSTSSSSSSSSAVSTT  P Q  QP T  N S ASR INNNQNNNN  M  KDK 
   258  696 B N        -     0   0   19   46   85  NNNNNNNNNTPPPPPPPTTTAPP  L T  TL L  V   TTN VVVVTVVVV  H  DTD 
   259  697 B P  B     -R  389   0F  15   45   60  PPPPPPPPPPPPPPPPPPPPSLL  P P  PP P  L   PP  PLLLPLLLL  Q  IPA 
   260  698 B L        -     0   0   17   44   66  LLLLLLLLLLLLLLLLLLLLLLQ  H L  LH    P   LL  RPPPLPPPP  E  LVL 
   261  699 B M  S  > S+     0   0   46   43   91  MMMMMMMMMCRRRRRRRMVRMST  W H  HW    S   HH  GSSSFSSSS  M   KL 
   262  700 B T  H  > S+     0   0    0   43   58  TTTTTTTTTTTTTTTTTTTTTPP  N T  TN    A   TT  RAAASAAAA  T   RR 
   263  701 B P  H  > S+     0   0   15   43   67  PPPPPPPPPPPPPPPPPPPPPCS  D H  ND    Q   SA  GQQQAQQQQ  Q   SQ 
   264  702 B D  H  4 S+     0   0   97   43   86  DDDDDDDDDDDDDDDDDDNGDII  Q R  RQ    M   SA  PLLLRMLLM  S   QQ 
   265  703 B I  H >X S+     0   0   30   42   52  IIIIIINIIVVVVVVVVIMVVLL  I M  MI    M   VV  AMMMVMMMM  T   R  
   266  704 B L  H 3X S+     0   0    7   40   22  LLLLLLLLLLLLLLLLLLLLLSP    L  L     M   ML  LMMMLMMMM  F   F  
   267  705 B G  H 3< S+     0   0   48   36   68  GGGGGGGGGEEEEEEEEESCSPS             D   K   SDDD DDDD  V   R  
   268  706 B S  H <4 S+     0   0   99   36   71  SSSSSSSSSSSSSSSSSSLHSGS             K   E   NKKK KKKK  D   I  
   269  707 B S  H  X S+     0   0   49   36   61  SSSSSSSSSSASSSSSSSnSsHA             a   E   Raaa aaaa  T   A  
   270  708 B G  H  X S+     0   0   19   34   67  GGGGGGGTTGGGGGGGGGvNp..             v   G   Dvvv vvvv  Q   A  
   271  709 B A  H  > S+     0   0   76   32   61  AAAAAAAAAPPPPPPPPSVTR..             A        AAA AAAA  S   W  
   272  710 B A  H  > S+     0   0   64   33   60  AAAAAAASSTAAAAAAATTVAR.             G        GGG GGGG  L   A  
   273  711 B V  H  X S+     0   0   20   33   32  VVVVVVVVVVVVVVVVVVVVAA.             I        III IIII  I   A  
   274  712 B H  H  X S+     0   0   72   33   66  HHHHHHHHHRRRRRRRRRQHETD             Q        QQQ QQQQ      L  
   275  713 B T  H  X S+     0   0   85   25   63  TTTTTTTTTTSSSSSSSTHSSTE                                    A  
   276  714 B b  H  X S+     0   0   10   25   77  CCCCCCYCCYGGGGGGGYQQACT                                    C  
   277  715 B V  H  X S+     0   0    5   25   35  VVVVVVVVVVVLLLLLLVILLFF                                    V  
   278  716 B K  H  X S+     0   0   99   25   60  KKKKKKKKKNNNNNNNNNSSRNN                                    R  
   279  717 B A  H  X S+     0   0   30   24   10  AAAAAAAAAAAAAAAAAAAAAAE                                       
   280  718 B T  H  X S+     0   0    0   24    0  TTTTTTTTTTTTTTTTTTTTTTT                                       
   281  719 B F  H  X S+     0   0   11   24   23  FFFFFFFFFYFFFFFFFFMMFML                                       
   282  720 B H  H  X S+     0   0  100   22   91  HHHHHHHNNKMMM MMM DDDKR                                       
   283  721 B A  H  X S+     0   0    0   22    0  AAAAAAAAAAAAA AAA AAAAA                                       
   284  722 B F  H  X S+     0   0   11   22    0  FFFFFFFFFFFFF FFF FFFYF                                       
   285  723 B N  H  X S+     0   0   56   22   46  NNNNNNNNNNNNN NNN HKHHL                                       
   286  724 B K  H >X S+     0   0   71   22   66  KKKKKKKKKLRRR RRR KKLLH                                       
   287  725 B Y  H 3< S+     0   0   59   22   90  YYYYYYYCCGGGG GGG AAAAA                                       
   288  726 B K  H 3< S+     0   0   64   22   48  KKKKKKKKKKKKK KKK HTTSN                                       
   289  727 B R  H << S+     0   0  162   22   16  RRRRRRRRRRRRR RRR RMRKR                                       
   290  728 B E     <        0   0  117   22   21  EEEEEEEEEEEEE EEE AEGED                                       
   291  729 B G              0   0  106   22    0  GGGGGGGGGGGGG GGG GGGGG                                       
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1  415 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  69  25   3   3   0    32    0    0   0.821     27  0.61
    2  416 B   0   0   0   0   0   0   0   0   0   0   6   0   0   0   0   0   0  29   9  56    34    0    0   1.066     35  0.62
    3  417 B   3   0   0   0   0   0   0   3   0   0  71  24   0   0   0   0   0   0   0   0    34    0    0   0.794     26  0.49
    4  418 B   0   0   0   0   0   0   0   0   6  59  29   0   0   0   0   0   3   3   0   0    34    0    0   1.046     34  0.47
    5  419 B   0   3  26   0  71   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    34    0    0   0.701     23  0.69
    6  420 B   0  24   3   0  41   0  29   0   0   0   0   0   0   0   0   0   0   0   3   0    34    0    0   1.273     42  0.62
    7  421 B   0   0   0   6   0   0   0   0   3   0   0   3   0   3   0   0  59  18   3   6    34    0    0   1.366     45  0.48
    8  422 B   0   6   0   0   0   0   0   0   3   0   3   0   0  29   0   3  18  24  12   3    34    0    0   1.840     61  0.29
    9  423 B   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0    34    0    0   0.000      0  1.00
   10  424 B   0   0   3   0   0   0   0   0   0   0   6   3   0   0   0   3   0  47  15  24    34    0    0   1.455     48  0.45
   11  425 B   0  59  32   9   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    34    0    0   0.891     29  0.70
   12  426 B   0   0   3   0   0   0   0   3   0   0   3   0   3   0   0   0   0   0  24  65    34    0    0   1.037     34  0.52
   13  427 B   0  68   0   0   0  24   0   0   0   0   0   3   0   0   0   3   0   0   3   0    34    0    0   0.916     30  0.45
   14  428 B   0   0   0   0   0   0   0   0   0   0   6  24   0   3  29  26   6   0   3   3    34    0    0   1.697     56  0.20
   15  429 B   3   0   0   0   0   0   0   3   0   0   0   3   0   0   0   0  22  44   0  25    36    0    0   1.340     44  0.53
   16  430 B   0   3   0   0   0   0   0   3   0  21   5   0   0   0   0  51   0  10   8   0    39    0    0   1.438     48  0.33
   17  431 B  13  21   3   0   0   0   0   5  21  33   0   0   0   0   0   0   0   3   3   0    39    0    0   1.714     57  0.16
   18  432 B   0  74   7   0   0   0   0  19   0   0   0   0   0   0   0   0   0   0   0   0    42    0    0   0.729     24  0.43
   19  433 B   0   0   0   0   0   0   0  97   0   0   0   0   0   0   0   3   0   0   0   0    39    0    0   0.119      3  0.93
   20  434 B   2   4   4   0   0   0   0   0  19   0   2   0   0   0  11   2  17  30   0   9    47    0    0   1.941     64  0.20
   21  435 B   0   0   0   0   0   0   0  96   0   0   4   0   0   0   0   0   0   0   0   0    57    0    0   0.152      5  0.96
   22  436 B   2   2  18   0   0   0   0   2  12   0  47   4   0   0   2   2   0   2   9   0    57    0    0   1.673     55  0.26
   23  437 B   0   0   0   0  65   0  10   0   2   2  15   0   0   2   0   2   0   0   3   0    60    0    0   1.181     39  0.43
   24  438 B   2   0   0   0   0   0   0  25   7   0  67   0   0   0   0   0   0   0   0   0    61    0    0   0.858     28  0.65
   25  439 B  28   2  30   0   0   0   3   0   0  11   0   7   0   0   2  15   0   3   0   0    61    0    0   1.785     59  0.24
   26  440 B  56   0   2   0   0   0   0   0   0   0   2   0  41   0   0   0   0   0   0   0    61    0    0   0.826     27  0.51
   27  441 B   7   3   0   0   2   0   2   0   0   0   0   0   2   2  67  15   2   0   0   0    61    0    0   1.177     39  0.49
   28  442 B  15  10   3   0   0   0   0   2   2   0   2   0   0   2  26  21   2  16   0   0    61    0    0   1.936     64  0.14
   29  443 B   3   0   0   0   0   0   0   8  13   0   0   0  76   0   0   0   0   0   0   0    62    0    0   0.788     26  0.63
   30  444 B  32   5  13   2   5   0   0   0   0   0   0  16   2   0  19   2   3   2   0   0    62    0    0   1.911     63  0.23
   31  445 B   0   0   0   0   0   0   0   0   0   0   2   0   0  37   2  15  13   8  16   8    62    0    0   1.746     58  0.39
   32  446 B   3   5   7   2   0   0   0   0   0   0   0   3   0   0  28  51   0   0   2   0    61    0    0   1.386     46  0.44
   33  447 B   2   2   5   0   0   0   0   3  15   2  15   2   2   0   2  27  16   5   2   3    62    0    0   2.190     73  0.19
   34  448 B   0   0   0   0   0   0   0   0   0   0  35  60   0   0   0   0   2   0   0   3    62    0    0   0.853     28  0.56
   35  449 B   0   0   0   0   0   0   0  53   0   0   3   0   0   2   0  10  16   0  16   0    62    0    0   1.328     44  0.42
   36  450 B   0   5   0   0   0   0   0   0   2   0   0   0   0   2   6  15  42  23   2   5    62    0    0   1.650     55  0.41
   37  451 B   0   3   0   2   0   0   3   0  11   0   0   0   0   2  18  19  13  29   0   0    62    0    0   1.849     61  0.24
   38  452 B   8   3   0   0  46   8  30   0   2   0   0   0   2   2   0   0   0   0   0   0    63    0    0   1.428     47  0.67
   39  453 B   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.000      0  1.00
   40  454 B  59  22  10   3   0   0   0   0   3   0   0   0   3   0   0   0   0   0   0   0    63    0    0   1.199     40  0.64
   41  455 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0    63    0    0   0.000      0  1.00
   42  456 B  13   0  76   0   0   0   0   0   0   0   2   2   8   0   0   0   0   0   0   0    63    0    0   0.802     26  0.74
   43  457 B  14  35  51   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.989     33  0.74
   44  458 B   0   8   5   0   3   0   0   0   3   0  40   0   0   3   3   5   2   8   8  13    63    0    0   2.026     67  0.16
   45  459 B   2   0   2   0   0   0   0   0   0   0   0   3   0   0  29  44   2   0   0  19    63    0    0   1.341     44  0.45
   46  460 B   0   0   0   2   0   0   0   3   5   0   6   2   2   0  56  10   3   6   5   2    63    0    0   1.673     55  0.35
   47  461 B   2  21   2  19   3   2   0   2   6  16   5   3   0   0   6   2   6   2   2   3    63    0    0   2.393     79  0.11
   48  462 B   0   2   2   0   0   0   0   0   2   2   2   0   0   2   9   4   0  64   2   7    45    0    0   1.409     47  0.46
   49  463 B   2   2   2   2   0   0   2   4  43   0  11   0   4   2   4   4   2  11   0   4    47    0    0   2.085     69  0.22
   50  464 B   0   5   0   5   0   0   0   0  10   0   0   0   2   0   5  22  13   2  29  10    63    0    0   1.969     65  0.23
   51  465 B   8  21   5   2   0   0   0   0  22   0   5  32   5   0   2   0   0   0   0   0    63    0    0   1.792     59  0.21
   52  466 B   2   3   0   3   2   0   2   0   0   2   2   6   0   0  27   6  38   5   2   2    63    0    0   1.896     63  0.26
   53  467 B   0   2   0   0   0   0   0   0   0   0   3   6   0   0  46  11   5   5  21   2    63    0    0   1.633     54  0.35
   54  468 B   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2  97   0   0    63    0    0   0.163      5  0.94
   55  469 B  49   3  43   0   0   0   0   0   3   0   0   0   0   2   0   0   0   0   0   0    63    0    0   0.997     33  0.75
   56  470 B   0   0   0   0   0   0   0   0  35   0   0  16   0   2  17   3   2  19   3   3    63    0    0   1.740     58  0.25
   57  471 B  13  27  21   2   0   0   0   0  32   0   2   2   0   0   0   0   0   2   2   0    63    0    0   1.634     54  0.32
   58  472 B   2  60   0  13   0   0   0   0   2   0   0   2   2  21   0   0   0   0   0   0    63    0    0   1.156     38  0.45
   59  473 B   0   0   0  13   0   6   5   0   2   0   3   2   0   0  33  33   2   2   0   0    63    0    0   1.687     56  0.36
   60  474 B   0  37   2  21   0   0   2   0   2   0   3   0   0   2  14  11   6   0   0   2    63    0    0   1.829     61  0.27
   61  475 B  13  16   6   0   0   0   3   0   6   0   3   0  52   0   0   0   0   0   0   0    63    0    0   1.462     48  0.28
   62  476 B   0   0   0   0   0   0   0   2  16   0  17   2   0   2   5   2  21  16   8  11    63    0    0   2.068     69  0.28
   63  477 B   0   2   0   0   2   0   0  51   2   0  14  14   0   0   0   0   4   2   6   2    49    0    0   1.598     53  0.41
   64  478 B   0   0   0   0   2   0   0   0   0   2   0   0   5  89   0   0   3   0   0   0    63    0    0   0.491     16  0.80
   65  479 B   0   0   2   0   0   0   0   0   0  81   3   2   0   0   6   2   2   3   0   0    63    0    0   0.828     27  0.68
   66  480 B   0   0   0   0   0   0   2   2   2   0   5   2   0   8   0   0   0   0  81   0    63    0    0   0.780     26  0.71
   67  481 B  17   0  81   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    63    0    0   0.542     18  0.89
   68  482 B  84   6   8   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.587     19  0.88
   69  483 B   0   0   2   0   0   0   0   2   6   2   6   5   2   2   6  32  16   6  14   0    63    0    0   2.108     70  0.26
   70  484 B   2  68  22   3   2   0   2   0   0   0   0   0   2   0   0   0   0   0   0   0    63    0    0   0.968     32  0.73
   71  485 B   5   3  17   2   3   0   8   0   0   0   0   0   2  43   5   5   3   3   2   0    63    0    0   1.939     64  0.20
   72  486 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   3   0   0  63   2  32    63    0    0   0.828     27  0.77
   73  487 B  70   0   6   0   6   0   8   0   2   0   5   3   0   0   0   0   0   0   0   0    63    0    0   1.122     37  0.55
   74  488 B   0   3   2   6  41   0  32   0   2   0   0   0   0  14   0   0   0   0   0   0    63    0    0   1.424     47  0.57
   75  489 B   2   0   2   0   0   0   2   0  16   0   3   2   0  25   0   0  11  33   0   5    63    0    0   1.768     59  0.33
   76  490 B   0   0   0   0   0   0   0   2   0   0  11  11   0   0   0   0   0   6  21  49    63    0    0   1.404     46  0.47
   77  491 B   0   0   0   2   0   0   0   3   0  19   3  11   0   0   2  11  30  11   5   3    63    0    0   2.015     67  0.26
   78  492 B   0  27   2   0   5   0   3   3   2   0   2   3   0   8  16   5   5   2  10  10    63    0    0   2.321     77  0.05
   79  493 B   0   0   0   2   2   0   3   0   0   0   3   0  13  49  18   7   0   0   3   0    61    0    0   1.574     52  0.29
   80  494 B   6  30  11   2   5   0   6   0   0   0   2  33   2   3   0   0   0   0   0   0    63    0    0   1.774     59  0.26
   81  495 B   2  17   0   0  24   0  52   0   0   0   0   0   0   5   0   0   0   0   0   0    63    0    0   1.196     39  0.68
   82  496 B   6  65  22   3   2   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    63    0    0   1.030     34  0.74
   83  497 B  89   2   8   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.437     14  0.91
   84  498 B   3  33   2  49  10   0   0   0   0   0   0   3   0   0   0   0   0   0   0   0    63    0    0   1.224     40  0.75
   85  499 B   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0  92   0   6    63    0    0   0.317     10  0.93
   86  500 B   0  65   0  17   3   0   3   0   0   0   0   0   6   0   2   3   0   0   0   0    63    0    0   1.154     38  0.60
   87  501 B  16  41   0  30   0   0   0   0   5   0   2   0   6   0   0   0   0   0   0   0    63    0    0   1.405     46  0.53
   88  502 B   0   2   0   2   0   0   0   3   2   3   5  17   0   2  16  10   3  22  14   0    63    0    0   2.170     72  0.22
   89  503 B   0   0   0   0   0   0   0  97   0   0   2   0   0   0   2   0   0   0   0   0    63    0    0   0.163      5  0.94
   90  504 B   0   0   0   0   0   0   0  97   0   0   2   0   0   0   0   0   0   0   2   0    63    0    0   0.163      5  0.96
   91  505 B   0   0   2   0   0   0   0   0   0   3   2   0   0   0   0   0   2  86   0   6    63    0    0   0.614     20  0.81
   92  506 B   2  95   2   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0    63    0    0   0.244      8  0.93
   93  507 B   0  33   0   0  65   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.712     23  0.90
   94  508 B   0   0   0   0   0   0   0   0   0   0   5   2   0  13   0   2   5  41   5  29    63    0    0   1.552     51  0.52
   95  509 B   2   0   0   3   0   0   5   0   0   0   2   0   2  16  62   8   0   0   0   2    63    0    0   1.308     43  0.47
   96  510 B   2   3  90   3   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0    62    0    0   0.447     14  0.88
   97  511 B  16   3   2   3   0   0   0   2   5   0  14   2   3   2  24  13   8   2   2   2    63    0    0   2.309     77  0.10
   98  512 B   2   0   0   5   0   0   0   0   6   0   0   5   0   0  13  35  16  13   2   5    63    0    0   1.925     64  0.30
   99  513 B   0   3   0   0   0   0   0   0   5   0   2   2   0  16  16  57   0   0   0   0    63    0    0   1.290     43  0.45
  100  514 B   5   0   0   0   0   0   0  14   3   3   5   2   0   0  22  32   6   8   0   0    63    0    0   1.927     64  0.26
  101  515 B   0   2   0   2   2   0   5   3   2   0  11   6   0  44  10   6   0   3   2   3    63    0    0   1.981     66  0.21
  102  516 B   2   8   0   0  70   0  18   0   0   0   0   0   0   0   0   0   2   0   0   0    61    0    0   0.895     29  0.84
  103  517 B   0   0   2   0   2   0   2   2   0   0  46  37   0   0   0   0   0   0   3   8    63    0    0   1.299     43  0.40
  104  518 B   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0   0  98   0   0    63    0    0   0.082      2  0.95
  105  519 B   0   3   0   0   0   0   0   2  11   3  19  17   2   0  11  27   3   2   0   0    63    0    0   1.988     66  0.22
  106  520 B   0   0   0   5   0   0   0   0   0   0   0   8   0   0   0   2   8  67   0  11    63    0    0   1.127     37  0.60
  107  521 B   0   0   2   0   0   0   0   2  90   0   5   2   0   0   0   0   0   0   0   0    63    0    0   0.433     14  0.85
  108  522 B   0   0   0   0   0   0   0   0  22   0  54   0   3   0  17   3   0   0   0   0    63    0    0   1.191     39  0.41
  109  523 B   3   3   3   0   0   0  13   3   2   0   2   2   2   8  11   6  30   3   2   8    63    0    0   2.321     77  0.14
  110  524 B  27  13  51   0   0   0   6   0   0   0   0   2   2   0   0   0   0   0   0   0    63    0    0   1.266     42  0.63
  111  525 B  19  17   6  32  10   0   0   0   0   0   0  14   2   0   0   0   0   0   0   0    63    0    0   1.728     57  0.43
  112  526 B   2   2   2   0   0   0   2   2   0   0   2   0   0   6  49  25   6   0   3   0    63    0    0   1.551     51  0.44
  113  527 B   3   3   2   0   0   0   0   0   2   2  16   3   0   0   3  21  38   3   0   5    63    0    0   1.875     62  0.27
  114  528 B  10  57  29   2   0   0   0   0   2   0   0   2   0   0   0   0   0   0   0   0    63    0    0   1.099     36  0.68
  115  529 B  38  17  11   2   3   0   0   3  13   0   6   2   5   0   0   0   0   0   0   0    63    0    0   1.849     61  0.34
  116  530 B   2   8   2   0   0   0   0   2   3   0  44   3   2   0   0  10   6  10   2   8    63    0    0   1.933     64  0.23
  117  531 B   2   0   0   0   2   0   0   8  83   0   6   0   0   0   0   0   0   0   0   0    63    0    0   0.666     22  0.76
  118  532 B  62  24  13   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    63    0    0   0.966     32  0.74
  119  533 B   0   2   0   0   2   0   3   2  13   0  37   0   0   8   8  14   3   5   2   3    63    0    0   2.047     68  0.19
  120  534 B   0   2   0   0  21   0  41   0   0   0   0   0   0  35   0   0   0   0   2   0    63    0    0   1.190     39  0.54
  121  535 B   0  29   2  37   0   0   2   0   2   0   0   0  29   0   0   0   2   0   0   0    63    0    0   1.347     44  0.26
  122  536 B   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  123  537 B   2   3   0   0   0   0   0   3   5   0  16   3   0   3   3   3   3  23   3  28    61    0    0   2.102     70  0.31
  124  538 B  17  19   6   8   2   0   0   0  13   0   0   0   2   3   8  10   3   3   6   0    63    0    0   2.319     77  0.14
  125  539 B   0   0   0   0   0   0   0  70   0   0   0   2   0   0   3   2   0   0  21   3    63    0    0   0.927     30  0.60
  126  540 B  43   0  54   0   2   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0    63    0    0   0.828     27  0.80
  127  541 B  56   0   2   3   0   0   3   0  33   0   0   2   2   0   0   0   0   0   0   0    63    0    0   1.109     37  0.45
  128  542 B   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  129  543 B   0   0   0   0   0   0   0   0   0   0   0   0   2   0  97   0   0   0   2   0    63    0    0   0.163      5  0.93
  130  544 B   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  98    63    0    0   0.082      2  0.96
  131  545 B   3  94   2   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.302     10  0.95
  132  546 B   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0  98   0   0   0   0    63    0    0   0.082      2  0.96
  133  547 B   0   2   2   0   0   0   0   0   0  97   0   0   0   0   0   0   0   0   0   0    63    0    0   0.163      5  0.92
  134  548 B   0   0   0   0   0   0   0   0   3   0   0   0   0   2   0   3   2  89   0   2    63    0    0   0.521     17  0.84
  135  549 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0    63    0    0   0.000      0  1.00
  136  550 B   3  68  29   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.728     24  0.78
  137  551 B   0  94   5   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.272      9  0.95
  138  552 B   0  17   2   3  46   0  25   0   0   0   0   0   6   0   0   0   0   0   0   0    63    0    0   1.360     45  0.68
  139  553 B   5   0   2   0   0   0   0   3  25   0  10  21   0   0   5  16   0   5   2   8    63    0    0   2.067     68  0.23
  140  554 B   0   0   0   0   0   0   0   2   6   0  10   8   0   3   2   2   2   3   5  59    63    0    0   1.540     51  0.47
  141          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  142  559 B   0   2   2   0   0   0   0   0   2   8   2   2   2   3   8  10   0  27  21  14    63    0    0   2.087     69  0.28
  143  560 B   2   3   0   0   2   0   0   8   3   2  30  16   0   0   2   0   2   6  16  10    63    0    0   2.094     69  0.27
  144  561 B  34  19  47   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    62    0    0   1.040     34  0.75
  145  562 B   3   2   0   3   0   0   0   0   3   0   0   0   0   0   8  81   0   0   0   0    62    0    0   0.775     25  0.70
  146  563 B  18  34  48   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    62    0    0   1.025     34  0.72
  147  564 B   6   0  33   0   0   0   0   0  14   0  19  11  16   0   0   0   0   0   0   0    63    0    0   1.671     55  0.27
  148  565 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    63    0    0   0.000      0  1.00
  149  566 B   0   3   0   0  95   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    63    0    0   0.222      7  0.95
  150  567 B   0   0   0   0   0   0   0  95   0   0   0   0   0   0   0   0   0   0   2   3    63    0    0   0.222      7  0.94
  151  568 B   0  25   0   0  71   0   0   0   0   0   0   2   0   0   0   0   2   0   0   0    63    0    0   0.720     24  0.83
  152  569 B   0   2   0   0   0   0   0   3  70   0  22   0   2   0   2   0   0   0   0   0    63    0    0   0.892     29  0.61
  153  570 B   0   0   2   0   0   0   0   0   5   0   3   2   3   0  40  37   2   0   5   3    63    0    0   1.550     51  0.40
  154  571 B   2  46  24   5   2   0   2   2   0   2   2   0   0   0   2   2   5   8   0   0    63    0    0   1.716     57  0.37
  155  572 B   5  13   3   2   3   0   0   0   0   2   0  10   3   2  14  24   5   2   2  13    63    0    0   2.315     77  0.08
  156  573 B   0   0   0   3   0   0   0  10  11   2   2   0   0   0   6  19   5  24  16   3    63    0    0   2.088     69  0.28
  157  574 B   0   0   0   0   0   0   3   6   6  29   2   2   2  11   5   8  18   6   2   0    62    0    0   2.169     72  0.23
  158          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  159  597 B   0   2   0   0   0   0  13   5   2   5   6   6   0   0   5  10  17  10  13   8    63    0    0   2.394     79  0.12
  160  598 B   2   0   2   0   0   0   0  56   5   6   0  16   0   2   2   5   0   3   0   2    62    0    0   1.531     51  0.42
  161  599 B   0   0   0   0   0   0  97   0   0   0   0   0   0   3   0   0   0   0   0   0    63    0    0   0.141      4  0.95
  162  600 B   0   0   0   0   0   0   0  13   0   0   5   2   0   0   0   0   0   0  16  65    63    0    0   1.045     34  0.64
  163  601 B   2   0   0   0   0   0   0   8   3   0   2   0   0   0   0  40   2  44   0   0    63    0    0   1.235     41  0.41
  164  602 B   0   2   0   0   0   0   0   0  16   3  56   2   0   0   3  10   3   6   0   0    63    0    0   1.478     49  0.39
  165  603 B  19   0   0   0   0   0   0   0   6   0   3   0  70   0   0   0   0   0   2   0    63    0    0   0.917     30  0.55
  166  604 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    63    0    0   0.000      0  1.00
  167  605 B   5  62  17  11   0   0   2   0   2   0   0   0   0   0   0   0   0   0   2   0    63    0    0   1.188     39  0.69
  168  606 B   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  169  607 B   0   0   0   0   0   0   0   2  11   0  87   0   0   0   0   0   0   0   0   0    63    0    0   0.428     14  0.82
  170  608 B   8  70   6   3   0   0   0   0   2   0   0   0  11   0   0   0   0   0   0   0    63    0    0   1.046     34  0.54
  171  609 B   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  172  610 B  97   0   2   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0    63    0    0   0.163      5  0.96
  173  611 B   6   2  92   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.317     10  0.95
  174  612 B   6  57  11   8   3   0   0   0   2   0   3  10   0   0   0   0   0   0   0   0    63    0    0   1.449     48  0.54
  175  613 B   0   0   0   0  10   0  90   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.314     10  0.99
  176  614 B  19   2  35  11   3   0   0   0   2   0   2  27   0   0   0   0   0   0   0   0    63    0    0   1.588     52  0.42
  177  615 B   2  35   0  63   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.722     24  0.92
  178  616 B   2  97   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.163      5  0.98
  179  617 B   2   0   2   0   0   0   0   0   8   0  46   3  40   0   0   0   0   0   0   0    63    0    0   1.166     38  0.54
  180  618 B   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  181  619 B   2   0   0   0  11   0  34   0   2   0   3   0   5   0   3   5  34   0   2   0    62    0    0   1.694     56  0.08
  182  620 B  35   8   0   2   2   0   0   0   6  39   0   3   3   0   0   0   2   0   0   0    62    0    0   1.536     51  0.29
  183  621 B   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    61    0    0   0.000      0  1.00
  184  622 B   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    61    0    0   0.000      0  1.00
  185  623 B   3   2   0   2   0   5  34   5   0   0   2   0   0   3   0   0  34   2   2   7    61    0    0   1.770     59  0.08
  186  624 B   0   0   3   0   0   0   0  21   2   0  43   5   3   3   2   0   0   2   0  16    61    0    0   1.676     55  0.38
  187  625 B   0   0   0   0   0   4   0   2   2   2   2   0   0  13  12  17  13  15   8  10    52    0    0   2.232     74  0.27
  188  626 B   0   0   0   0   2   0   2   9   0   2   4   5   0  22   0   0   4   5  16  29    55    0    0   1.982     66  0.32
  189  627 B   4   0   4   4   0   0   0  22   0   6   2   0   0  19  13  13   6   0   4   6    54    0    0   2.220     74  0.14
  190  628 B   2   4   0   2   0   0   0   9   4   5  33   2   0   2   5   2  18   2   7   4    55    0    0   2.200     73  0.20
  191  629 B   7  18   0   4   4   0   0   4  13   0  16   0   0   0  16   5   4   9   0   0    55    0    0   2.214     73  0.07
  192  630 B   0  27  11   2   0   0   2   4   4   4   0  35   0   0   0   0   9   2   0   2    55    0    0   1.834     61  0.20
  193  631 B   0   4  16   2  18   0   7   0   9   0   9   0  18   4   5   2   7   0   0   2    57    0    0   2.305     76  0.08
  194  632 B   0   0   0   0   0   0   0   0  15  25  15  20   0   0   3   3   3  12   0   3    60    0    0   1.942     64  0.27
  195  633 B   0   5   0   2   0   0   2   6   5   2  25   2   0   2   6  27   6  10   2   0    63    0    0   2.135     71  0.20
  196  634 B   4   4  32   4   0   0   0   0  38   0   2   2   0   0   0   0  11   0   0   2    47    0    0   1.619     54  0.25
  197  635 B  19  11   6   4   4   0   0   0  13   0   4   2   0   0   4  17   0  13   2   0    47    0    0   2.259     75  0.13
  198  636 B   0   2   2   2   0   0   0   2   9   0   4   5   2   0   9  11   2  32   4  18    57    0    0   2.149     71  0.26
  199  637 B   3   5  37  22   0   0   0  17   6   0   0   0   2   0   3   2   0   3   0   0    63    0    0   1.787     59  0.23
  200  638 B   2   5   5  43   2   0   0   0   2   0   2   2   0   0  14   6   3   6   2   8    63    0    0   1.986     66  0.22
  201  639 B   3   2   0   0   5   0  16   0   0   0   3   3  10   3  21  23   8   2   2   0    62    0    0   2.176     72  0.08
  202  640 B   0   0   0   3   0   0   0   5   3   0   3   2   0   0  18  48   3   6   2   6    62    0    0   1.734     57  0.38
  203  641 B   2   0  66   5  16   2   2   3   2   0   0   0   0   0   0   0   3   0   0   0    62    0    0   1.202     40  0.54
  204  642 B   3   6   0  15   0   0   0   2   3  13   0   2   2   0  18  23   8   2   0   5    62    0    0   2.201     73  0.16
  205  643 B   0   0   0   0   2   0   2   2   2   2  11  15   0   0  10  13   3  26   6   8    62    0    0   2.190     73  0.22
  206  644 B   0   0   0   0   0   2   2  61   8  10   5   0   0   5   2   0   0   2   0   5    62    0    0   1.435     47  0.45
  207  645 B   2   5   2   0   8   0   6   0   0   2  13   0   2   0  11   5   6  15   3  21    62    0    0   2.345     78  0.07
  208  646 B   2   0   0   0  54  14  14   0   0   3   8   0   0   0   0   0   0   5   0   0    63    0    0   1.410     47  0.52
  209  647 B   2   2   0   2   0   2   0   2   2   2  43   2   0   0   0   2   5  19   3  16    63    0    0   1.818     60  0.31
  210  648 B   0  16   0   2  51   3   2   3   3   3   5   2   0   2   0   0   0   3   0   6    63    0    0   1.767     58  0.29
  211  649 B  11   0   6   0   0   2   0   3   5  21   8   2   0   0   2   3   0  22   2  14    63    0    0   2.185     72  0.17
  212  650 B   2   0   0   0   0   2   0  37   3   2  22   3   0   0   5   2   3  16   0   5    63    0    0   1.876     62  0.32
  213  651 B   0   5   0   0   0   0   0   0   0   9   2   0   0   0   0   5   2  70   0   7    43    0    0   1.118     37  0.54
  214  652 B   2   0   0   0   0   0   7   0  47   2   2   0   0   0   0   0   5  33   0   2    43    0    0   1.400     46  0.29
  215  653 B   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0    43    0    0   0.110      3  0.99
  216  654 B   0   2   0   0   0   0   0   2   2   0  23   2   0   0   9  30  20   5   0   5    44    0    0   1.865     62  0.23
  217  655 B   0   0   0   0   2   0   0  24   2   2   4   0   0   2   0   2  24   0  31   4    45    0    0   1.752     58  0.30
  218  656 B  70   4  23   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0    47    0    0   0.804     26  0.79
  219  657 B   0   0   0   0   0   0   0   0   0   0  94   6   0   0   0   0   0   0   0   0    48    0    0   0.234      7  0.89
  220  658 B   0   0   0   0   4   0   0   2   0   2   9   2   0   0   0   4  23  39   2  16    57    0    0   1.728     57  0.41
  221  659 B   2   0   0  14   0   0   0   2   2   0   5   4   0   2   0   2  11  47   2   9    57    0    0   1.778     59  0.34
  222  660 B   0   0   0   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0   0   0    58    0    0   0.087      2  0.98
  223  661 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   5  95   0   0   0   0    58    0    0   0.204      6  0.95
  224  662 B   2   0   2   0   0   0   0   0   0   0   3   0   0   3   3   3   0  16   5  63    63    0    0   1.295     43  0.61
  225  663 B  10  75   5   0  11   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.832     27  0.83
  226  664 B  37   5  59   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.825     27  0.83
  227  665 B   3   0   0   0   0   0   0   0   3   0  13   3   2   0  40   6  21   2   6   2    63    0    0   1.830     61  0.28
  228  666 B   0   0   3   0   0   0   0  38   2   0   2   0   3   8  13  24   0   5   3   0    63    0    0   1.778     59  0.19
  229  667 B   0  73   3  19   2   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0    63    0    0   0.830     27  0.82
  230  668 B   2  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.082      2  0.98
  231  669 B  11   0   0   0   0   0   0   0   2   0   0  51   2   3   3  13   5   8   3   0    63    0    0   1.656     55  0.29
  232  670 B  69   0   6   3   0   0   0   0   0   2   2   6   0   0   8   3   0   0   0   0    62    0    0   1.165     38  0.52
  233  671 B   0   0   0   0   0   0   0   0   0   0   5   0   2   0   0  14   2   5   8  65    63    0    0   1.180     39  0.57
  234  672 B   3   0   0   0   0   0   0   0   6  87   2   2   0   0   0   0   0   0   0   0    63    0    0   0.535     17  0.81
  235  673 B   5   0   0   2   0   0   0   3  19   0  10   8   0   3   2  10   3  16  16   5    63    0    0   2.299     76  0.23
  236  674 B   0   0   0   0   0   0   0   0   0   0   3   2   0   0   2  70   2  21   0   2    63    0    0   0.949     31  0.60
  237  675 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0    63    0    0   0.000      0  1.00
  238  676 B   0  56  14   5   6   0  10   0   3   6   0   0   0   0   0   0   0   0   0   0    63    0    0   1.433     47  0.52
  239  677 B   0   0   0   0   0   0   0   0   0   0  15  47   0   0   0  32   0   0   6   0    62    0    0   1.177     39  0.40
  240  678 B   3  18  26  26   0   0   0   0  21   0   2   0   3   0   0   0   0   0   0   0    61    0    0   1.632     54  0.36
  241  679 B   0   0   0   0   0   0   0   0  15   0  20   0   3   2   0   2  10  36   3  10    61    0    0   1.785     59  0.36
  242  680 B   0   0   0   5   0   0   0  41   3   0   2   0   0   0   0   2  18  20   2   8    61    0    0   1.662     55  0.40
  243  681 B  30  43   7   0   3   0   0   0  13   0   0   0   5   0   0   0   0   0   0   0    61    0    0   1.429     47  0.44
  244  682 B   2  36   5  10   0   0   0   0   0   0   2   2   0   0  33   8   0   0   0   3    61    0    0   1.629     54  0.22
  245  683 B   0   2   0   0   0   0  18  10  15   0   2   2   0   5   7   7   8   7   8  11    61    0    0   2.364     78  0.10
  246  684 B   0   0   0   0   0   0   0   0   0   0  16   0   0  57   0   0   0   0  25   2    61    0    0   1.028     34  0.48
  247  685 B   0   2   0   2   0   0   0   0   3  49  18   0   0   0   2   7   0  18   0   0    61    0    0   1.460     48  0.37
  248  686 B   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0    61    0    0   0.084      2  1.00
  249  687 B  10  54  21   2  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    61    0    0   1.224     40  0.71
  250  688 B   2   2   2   2   0   0   0   0  11   0   7   2   0   2   2   5  43   0  21   0    56    0    0   1.781     59  0.27
  251  689 B   2   2   0   2   0   0   0  19   6   0  13   2   6   2   0   2   7   0   0  39    54    0    0   1.902     63  0.28
  252  690 B   2   0   0   0   0   0   6  38   6   0   8  19   4   4   4   0   0   2   0   8    52    0    0   1.936     64  0.24
  253  691 B   2   0   0   0   0   0   2   6  12   2  43   6   2   0   2   0   4  16   2   0    49    0    0   1.865     62  0.27
  254  692 B   4   0   0   0   0   0   0   0  46   2   4   4   0   2   2   0  25   4   2   4    48    0    0   1.689     56  0.34
  255  693 B  13  45   0   4   2   0   2   0   2   2   4   2   0   2  15   2   0   0   0   4    47    0    0   1.883     62  0.21
  256  694 B   0   0   0   0   0   2   0   0   2  11  47   2   0   2   0   2   2   4   2  23    47    0    0   1.641     54  0.29
  257  695 B   2   0   2   2   0   0   0   0   4   4  45   9   0   0   2   4   6   0  17   2    47    0    0   1.859     62  0.24
  258  696 B  20   7   0   0   0   0   0   0   2  20   0  22   0   2   0   0   0   0  24   4    46    0    0   1.793     59  0.15
  259  697 B   0  22   2   0   0   0   0   0   2  69   2   0   0   0   0   0   2   0   0   0    45    0    0   0.929     31  0.39
  260  698 B   2  68   0   0   0   0   0   0   0  18   0   0   0   5   2   0   2   2   0   0    44    0    0   1.056     35  0.33
  261  699 B   2   2   0  30   2   5   0   2   0   0  21   2   2   9  19   2   0   0   0   0    43    0    0   1.978     66  0.09
  262  700 B   0   0   0   0   0   0   0   0  19   5   2  63   0   0   7   0   0   0   5   0    43    0    0   1.164     38  0.42
  263  701 B   0   0   0   0   0   0   0   2   5  51   7   0   2   2   0   0  23   0   2   5    43    0    0   1.503     50  0.33
  264  702 B   0  12   5   7   0   0   0   2   2   2   5   0   0   0   7   0   9   0   2  47    43    0    0   1.834     61  0.13
  265  703 B  31   5  29  26   0   0   0   0   2   0   0   2   0   0   2   0   0   0   2   0    42    0    0   1.573     52  0.48
  266  704 B   0  68   0  22   5   0   0   0   0   3   3   0   0   0   0   0   0   0   0   0    40    0    0   0.935     31  0.78
  267  705 B   3   0   0   0   0   0   0  28   0   3  11   0   3   0   3   3   0  25   0  22    36    0    0   1.778     59  0.31
  268  706 B   0   3   3   0   0   0   0   3   0   0  58   0   0   3   0  22   0   3   3   3    36    0    0   1.345     44  0.28
  269  707 B   0   0   0   0   0   0   0   0  31   0  56   3   0   3   3   0   0   3   3   0    36    0    0   1.187     39  0.39
  270  708 B  26   0   0   0   0   0   0  53   3   3   0   6   0   0   0   0   3   0   3   3    34    0    0   1.374     45  0.32
  271  709 B   3   0   0   0   0   3   0   0  56  25   6   3   0   0   3   0   0   0   0   0    32    0    0   1.277     42  0.39
  272  710 B   3   3   0   0   0   0   0  24  52   0   6   9   0   0   3   0   0   0   0   0    33    0    0   1.391     46  0.40
  273  711 B  64   0  27   0   0   0   0   0   9   0   0   0   0   0   0   0   0   0   0   0    33    0    0   0.860     28  0.67
  274  712 B   0   3   0   0   0   0   0   0   0   0   0   3   0  33  27   0  27   3   0   3    33    0    0   1.499     50  0.33
  275  713 B   0   0   0   0   0   0   0   0   4   0  36  52   0   4   0   0   0   4   0   0    25    0    0   1.094     36  0.37
  276  714 B   0   0   0   0   0   0  12  28   4   0   0   4  44   0   0   0   8   0   0   0    25    0    0   1.432     47  0.23
  277  715 B  56  32   4   0   8   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    25    0    0   1.020     34  0.65
  278  716 B   0   0   0   0   0   0   0   0   0   0   8   0   0   0   8  40   0   0  44   0    25    0    0   1.132     37  0.39
  279  717 B   0   0   0   0   0   0   0   0  96   0   0   0   0   0   0   0   0   4   0   0    24    0    0   0.173      5  0.90
  280  718 B   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0    24    0    0   0.000      0  1.00
  281  719 B   0   4   0  13  79   0   4   0   0   0   0   0   0   0   0   0   0   0   0   0    24    0    0   0.710     23  0.76
  282  720 B   0   0   0  27   0   0   0   0   0   0   0   0   0  36   5   9   0   0   9  14    22    0    0   1.570     52  0.09
  283  721 B   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0    22    0    0   0.000      0  1.00
  284  722 B   0   0   0   0  95   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0    22    0    0   0.185      6  0.99
  285  723 B   0   5   0   0   0   0   0   0   0   0   0   0   0  14   0   5   0   0  77   0    22    0    0   0.752     25  0.53
  286  724 B   0  14   0   0   0   0   0   0   0   0   0   0   0   5  27  55   0   0   0   0    22    0    0   1.097     36  0.34
  287  725 B   0   0   0   0   0   0  36  32  23   0   0   0   9   0   0   0   0   0   0   0    22    0    0   1.287     42  0.09
  288  726 B   0   0   0   0   0   0   0   0   0   0   5   9   0   5   0  77   0   0   5   0    22    0    0   0.839     27  0.51
  289  727 B   0   0   0   5   0   0   0   0   0   0   0   0   0   0  91   5   0   0   0   0    22    0    0   0.368     12  0.83
  290  728 B   0   0   0   0   0   0   0   5   5   0   0   0   0   0   0   0   0  86   0   5    22    0    0   0.548     18  0.79
  291  729 B   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    22    0    0   0.000      0  1.00
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     1   143   498     4 nDNLEi
     1   155   514    22 kPPDNQPLKTPCFTLHYAAPELLn
     2   143   617     4 nDNLEi
     2   155   633    22 kPPDNQPLKTPCFTLHYAAPELLn
     3   143   460     4 nDNLEi
     3   155   476    22 kPPDNQPLKTPCFTLHYAAPELLn
     4   143   523     4 nDNLEi
     4   155   539    22 kPPDNQPLKTPCFTLHYAAPELLn
     5   143   554     4 nDNLEi
     5   155   570    22 kPPDNQPLKTPCFTLHYAAPELLn
     6   143   558     4 nDNLEi
     6   155   574    22 kPPDNQPLKTPCFTLHYAAPELLn
     7   143   524     4 tDNSEi
     7   155   540    22 kPPDNQPLKTPCFTLHYAAPELLn
     8   143   503     4 sENSEi
     8   155   519    22 kPPDNQLLKTPCFTLQYAAPEILk
     9   143   544     4 sENSEi
     9   155   560    22 kPPDNQLLKTPCFTLQYAAPEILk
    10   143   536     4 aEDSMl
    10   155   552    22 cPAGSAPLQTPCFTLQYAAPELFe
    11   123   225     1 hEe
    11   143   246     4 aPGAPv
    11   155   262    23 rPQSPAGPMQTPCFTLQYAAPELLa
    12   123   148     1 hEe
    12   143   169     4 tPGAPv
    12   155   185    23 rPQSPGVPMQTPCFTLQYAAPELLa
    13   123   521     1 hEe
    13   143   542     4 tPGAPv
    13   155   558    23 rPQSPGVPMQTPCFTLQYAAPELLa
    13   185   611     3 gASGq
    14   123   522     1 hEe
    14   143   543     4 tPGAPv
    14   155   559    23 rPQSPGGPMQTPCFTLQYAAPELLa
    14   185   612     3 gTSGq
    15   123   522     1 hEe
    15   143   543     4 tPGAPv
    15   155   559    23 rPQSPGVPMQTPCFTLQYAAPELLa
    15   185   612     3 gASGq
    16   123   522     1 hEe
    16   143   543     4 tPGAPv
    16   155   559    23 rPQSPGGPMQTPCFTLQYAAPELLa
    16   185   612     3 gASGq
    17   123   522     1 hEe
    17   143   543     4 tPGAPv
    17   155   559    23 rPQSPGRPMQTPCFTLQYAAPELLa
    17   185   612     3 gASGq
    18   141   495     4 sEEAPi
    18   153   511    22 rPPNSQPMQTPCFTLQYAAPELFe
    18   192   572     1 hAa
    19   141   516     4 sDEAEi
    19   153   532    21 kPENAGLTTPCFTLHYAAPEVLk
    19   154   554     5 kRAMDKg
    19   185   590     4 sRHDRa
    19   259   668     3 nQASv
    20   141   541     4 sEDAEi
    20   153   557    21 kPEMKKLETPCFTLPYGAPEVMk
    20   154   579     5 kQMSGTk
    20   186   616     3 kNDSa
    20   242   675     2 gSDs
    21   141   545     4 sDNATi
    21   153   561    22 kPSDNQLMKTPCFTLNYAAPEVLr
    21   154   584     7 rQASAGNGa
    21   185   622     4 sRNASa
    21   259   700     2 sSSp
    22   146   549    16 nNNTMPASKQLHIKIVDf
    22   148   567     2 gFAr
    22   151   572    26 kPNTGAGASVALSTPVFTLQYAAPEVLq
    22   152   599     9 qTSGFVGTSNt
    23    18   388     1 lLg
    23   142   513     4 dSNARl
    23   149   524    18 gFARLLPNPMEQQLKSVQVl
    23   154   547    13 tPCFTLQYAAPEVLd
    23   155   561     4 dVGDSq
    23   187   597     3 rQESa
    24    29    49     5 aLNPKDr
    24    59    84     1 gPm
    24   123   149     4 tENAVi
    24   135   165    21 vTEETNMSTMCGTPGYYAPEIVr
    25    28    52     4 lMAGRe
    25    43    71     1 sMg
    25   123   152     4 eDNADl
    25   135   168    23 mDEEQFHVLTTTCGTPGYMAPEIFk
    25   184   240     1 pIe
    26    31    42     2 sSSk
    26   125   138     3 qDLTi
    26   137   153    21 lSDDVFMKTTCGTPSYVAPEVLn
    26   138   175     5 nNINNTp
    27    26    50     5 sLEEDDe
    27   120   149     4 dSSSIi
    27   132   165    20 lQGELATTACGTPGYVAPEILe
    28    30    58     4 qVLSEs
    28    59    91     3 nKLQn
    28    61    96     1 kIc
    28    78   114     1 rIq
    28    84   121     2 gTAf
    28   125   164     4 gTYGVl
    28   137   180    21 tINKDTLQTPCYTPYYVAPEVLg
    29    34    41     3 pTVEr
    29   129   139     4 nKVSPv
    29   141   155    27 iGGLTTPVTTPELQTPVGSAEYMAPEVVd
    29   142   183     5 dAFKTQa
    29   171   217     7 gKCGSKCGw
    29   180   233     1 tCq
    30    28    42     6 nTEREGAp
    30    82   102     2 gGHy
    30   116   138     1 nIl
    30   123   146     4 vLDSPi
    30   135   162    21 cADGERLTHRVGTPHYIAPEVLk
    31    73    84     3 nTYSg
    31    75    89     1 nKc
    31    98   113     2 dGAf
    31   139   156     4 sSSGIl
    31   151   172    21 tFTKDTLQTPCYTPYYVAPEVLg
    32    28    42     2 sSSk
    32   122   138     3 tDLNi
    32   134   153    21 lSDEVFMKTTCGTPSYVAPEVLn
    32   135   175     5 nNITNTp
    33    45    74     2 fIKn
    33   140   171     3 eGDEi
    33   152   186    21 fGEGDCLETCCGSPEYVAPEVLe
    34    36    40     3 lGHIr
    34   131   138     4 sQVSPv
    34   140   151     3 gSGIq
    34   143   157    26 nGDCSPISTPELLTPCGSAEYMAPEVVe
    34   144   184     5 eAFSEEa
    34   173   218     7 gHCGTDCGw
    34   182   234     1 aCq
    35   124   149     4 nAPDSv
    35   136   165    22 lKAENGLLMTPCYTKSFVAPEVLk
    36   124   149     4 nAPDSv
    36   136   165    22 lKAENGLLMTPCYTKSFVAPEVLk
    37    74    85     9 nSVQFPHESSp
    37    76    96     1 rAr
    37   140   161     4 sLDAPv
    37   152   177    19 dQGDLMTPQFTPYYVAPQVLe
    37   153   197    18 eAQRRHQKEKSGIIPTSPTp
    37   263   325     1 aVv
    38    27    60     7 rVLSLRGAd
    38   121   161     1 gNi
    38   133   174    24 pQHLGKDGLLHTTCGSPNYIAPEVLq
    38   140   205     1 gSl
    39    28    29     5 kLSTRDh
    39   122   128     4 sKGAAv
    39   134   144    22 vEGEQQAWFGFAGTPGYLSPEVLr
    40    26    48     4 lMEGRe
    40    41    67     1 sKg
    40   121   148     4 rEDADi
    40   133   164    23 lDEEKFQLLTEICGTPGYMAPEIFk
    41    46    64     5 sSLSTGf
    41    60    83     3 nMYNg
    41    62    88     1 qRc
    41   126   153     4 tPNSLl
    41   138   169    20 tTTTNLQTPCYTPYYVAPEVLg
    42    60    86     3 nKYAk
    42    62    91     1 nDc
    42    85   115     2 dNPf
    42   126   158     4 sENAAl
    42   138   174    21 tDAALTLQTPCYTPYYVAPEVLg
    42   177   234     4 gMKKRi
    43    26    53     4 aLKGKe
    43   120   151     4 lEDSKi
    43   132   167    20 eEQGALSTACGTPAYVAPELLq
    44    34    46     6 dLHDSIDr
    44    82   100     1 rIv
    44    88   107     2 tVPf
    44   129   150     5 sNFLTEi
    44   141   167    22 fSPGQGLMQGIVGTPYYVAPEVLg
    45    44    82    13 nETISEVNLLRQLAg
    45    58   109     1 tPt
    45   123   175     1 eRv
    45   135   188    21 lQPGQKLKELLGTPGYLAPETLr
    45   136   210     6 rCQMYEDa
    45   166   246     1 rRq
    46    74    85     9 nSVQFPHESSp
    46    76    96     1 rAr
    46   120   141     1 hCh
    46   121   143     1 hLl
    46   140   163     4 sLDAPv
    46   152   179    19 dQGDLMTPQFTPYYVAPQVLe
    46   153   199    18 eAQRRHQKEKSGIIPTSPTp
    46   263   327     1 aVv
    47    19    30     1 gAg
    47    75    87     9 nSVQFPHESSp
    47    77    98     1 rAr
    47   141   163     4 sLDAPv
    47   153   179    19 dQGDLMTPQFTPYYVAPQVLe
    47   154   199    18 eAQRRHQKEKSGIIPTSPTp
    47   264   327     1 aVv
    48    74    85     9 nSVQFPHESSp
    48    76    96     1 rAr
    48   140   161     4 sLDAPv
    48   152   177    19 dQGDLMTPQFTPYYVAPQVLe
    48   153   197    18 eAQRRHQKEKSGIIPTSPTp
    48   263   325     1 aVv
    49    47    56     3 nVFKn
    49    49    61     1 rRc
    49    72    85     2 eSPf
    49   113   128     4 gPDRIl
    49   125   144    21 tTSYNSLNTPCYTPYYVAPEVLg
    50    74    85     9 nSVQFPHESSp
    50    76    96     1 rAr
    50   140   161     4 sLDAPv
    50   152   177    19 dQGDLMTPQFTPYYVAPQVLe
    50   153   197    18 eAQRRHQKEKSGIIPTSPTp
    50   263   325     1 aVv
    51    74    85     9 nSVQFPHESSp
    51    76    96     1 rAr
    51   120   141     1 hLl
    51   139   161     4 sLDAPv
    51   151   177    19 dQGDLMTPQFTPYYVAPQVLe
    51   152   197    18 eAQRRHQKEKSGIIPTSPTp
    51   262   325     1 aVv
    52    74   104     9 nSVQFPHESSp
    52    76   115     1 rAr
    52   120   160     1 hLl
    52   139   180     4 sLDAPv
    52   151   196    19 dQGDLMTPQFTPYYVAPQVLe
    52   152   216    18 eAQRRHQKEKSGIIPTSPTp
    52   262   344     1 aVv
    53    74    85    11 nTVQFPHESSPSe
    53    76    98     1 rAr
    53   140   163     4 sLDAPv
    53   152   179    19 dQGDLTTPQFTPYYVAPQVLe
    53   153   199    18 eAQRRHQKEKSGIIPTSPTp
    53   263   327     1 aVv
    54    31    31     5 dLPPADd
    54   118   123     1 nLl
    54   125   131     3 nDSFi
    54   137   146    21 vHEPKCLSKQCGTPFFVSPEILm
    55    28    99     5 gLTVEDi
    55    43   119    17 sFICQLECIALTLRHDQMe
    55   123   216     4 dDDASi
    55   135   232    22 iDVHSYGLTTACGTPGYVAPEILe
    56    11    50     5 qISDKSl
    56   104   148     3 dSDDi
    56   111   158    30 gLSKQIQRQMERQNMERLELLQEEKDFLNGEf
    56   113   190     3 lKRDd
    56   116   196    27 kDDESFKFHKDLLHSIVGTPYYVAPEVLs
    56   146   253     1 rTs
    57    27    45     6 rLRQENMe
    57   121   145     1 gTl
    57   133   158    20 qQDFLLQTVCGTPNYVAPEVLm
    57   140   185     1 gLs
    58    28    46     6 qLVRERMe
    58   122   146     1 dTl
    58   134   159    26 hYGNSPGKGTMLQTVCGTPNYVAPEVLk
    58   141   192     1 gVk
    59    30    30     4 aLRGKe
    59   124   128     4 fEDSKi
    59   136   144    20 qAGNMLGTACGTPGYVAPELLe
    60    43    75    11 tAKEMEILHHVSn
    60    57   100     1 sSt
    60   122   166     1 lNi
    60   134   179    21 lKPNEKLRELCGTPGYLAPEILk
    60   135   201     6 kCSMDETh
    60   165   237     1 rRq
    61    28    43     7 aLDDDRAAd
    61   122   144     1 gEl
    61   134   157    22 rDYGAHLLHTNCGSPHYCAPEVWn
    61   135   180     2 nGTq
    61   141   188     1 gRk
    62    28    46     6 qLVRERMe
    62   122   146     1 dTl
    62   134   159    26 qRTSTSGGGTMLQTVCGTPNYVAPEVLk
    62   141   192     1 gLk
//