Complet list of 3gdr hssp fileClick here to see the 3D structure Complete list of 3gdr.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      3GDR
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-09-29
HEADER     orotidine 5'-monophosphate decarboxylas 2009-06-23 3GDR
COMPND     Orotidine 5'-phosphate decarboxylase
SOURCE     Saccharomyces cerevisiae
AUTHOR     Fedorov, A.A.; Fedorov, E.V.; Wood, B.M.; Gerlt, J.A.; Almo, S.C.
SEQLENGTH   512
NCHAIN        4 chain(s) in 3GDR data set
KCHAIN        2 chain(s) used here ; chains(s) : A, C
NALIGN      548
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : A6ZQS7_YEAS7        1.00  1.00    1  260    3  262  260    0    0  267  A6ZQS7     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain YJM789) GN=URA3 PE=3 SV=1
    2 : C7GX21_YEAS2        1.00  1.00    1  260    3  262  260    0    0  267  C7GX21     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain JAY291) GN=URA3 PE=3 SV=1
    3 : C8Z6X5_YEAS8        1.00  1.00    1  260    3  262  260    0    0  267  C8Z6X5     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1E8_0639g PE=3 SV=1
    4 : D4AHU8_SACPS        1.00  1.00    1  260    3  262  260    0    0  267  D4AHU8     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces pastorianus GN=SC-URA3 PE=3 SV=1
    5 : E7KMH6_YEASL        1.00  1.00    1  260    3  262  260    0    0  267  E7KMH6     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=QA23_1258 PE=3 SV=1
    6 : E7LTM6_YEASV        1.00  1.00    1  260    3  262  260    0    0  267  E7LTM6     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain VIN 13) GN=VIN13_1253 PE=3 SV=1
    7 : E7QDQ0_YEASZ        1.00  1.00    1  260    3  262  260    0    0  267  E7QDQ0     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=VL3_1252 PE=3 SV=1
    8 : G2WCL0_YEASK        1.00  1.00    1  260    3  262  260    0    0  267  G2WCL0     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) GN=K7_URA3 PE=3 SV=1
    9 : H0GEX4_9SACH        1.00  1.00    1  260    3  262  260    0    0  267  H0GEX4     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7 GN=VIN7_1269 PE=3 SV=1
   10 : PYRF_YEAST  3GDL    1.00  1.00    1  260    3  262  260    0    0  267  P03962     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA3 PE=1 SV=2
   11 : B5VHB5_YEAS6        0.99  1.00    1  260    3  262  260    0    0  267  B5VHB5     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AWRI1631_50500 PE=3 SV=1
   12 : E7KBL2_YEASA        0.99  1.00    1  260    3  262  260    0    0  267  E7KBL2     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain AWRI796) GN=AWRI796_1264 PE=3 SV=1
   13 : E7NGX8_YEASO        0.99  1.00    1  260    3  262  260    0    0  283  E7NGX8     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain FostersO) GN=FOSTERSO_1225 PE=3 SV=1
   14 : E7Q370_YEASB        0.99  1.00    1  260    3  262  260    0    0  267  E7Q370     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain FostersB) GN=FOSTERSB_1242 PE=3 SV=1
   15 : L0PID4_PNEJ8        0.99  1.00    1  260    3  262  260    0    0  267  L0PID4     Orotidine 5'-phosphate decarboxylase OS=Pneumocystis jiroveci (strain SE8) GN=PNEJI1_003696 PE=3 SV=1
   16 : M2V1L5_BACIU        0.99  1.00    1  260    3  262  260    0    0  267  M2V1L5     Orotidine 5'-phosphate decarboxylase OS=Bacillus subtilis MB73/2 GN=BS732_4446 PE=3 SV=1
   17 : N1P5L4_YEASC        0.99  1.00    1  260    3  262  260    0    0  267  N1P5L4     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) GN=CENPK1137D_3634 PE=3 SV=1
   18 : H0GTP2_9SACH        0.97  0.99   23  260    1  238  238    0    0  243  H0GTP2     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7 GN=VIN7_6631 PE=3 SV=1
   19 : J4TU41_SACK1        0.96  0.99    1  260    3  262  260    0    0  267  J4TU41     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=YEL021W PE=3 SV=1
   20 : A6ZQS7_YEAS7        0.95  0.95  262  514    3  266  264    1   12  267  A6ZQS7     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain YJM789) GN=URA3 PE=3 SV=1
   21 : B5VHB5_YEAS6        0.95  0.95  262  514    3  266  264    1   12  267  B5VHB5     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AWRI1631_50500 PE=3 SV=1
   22 : C7GX21_YEAS2        0.95  0.95  262  514    3  266  264    1   12  267  C7GX21     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain JAY291) GN=URA3 PE=3 SV=1
   23 : C8Z6X5_YEAS8        0.95  0.95  262  514    3  266  264    1   12  267  C8Z6X5     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1E8_0639g PE=3 SV=1
   24 : D4AHU8_SACPS        0.95  0.95  262  514    3  266  264    1   12  267  D4AHU8     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces pastorianus GN=SC-URA3 PE=3 SV=1
   25 : E7KBL2_YEASA        0.95  0.95  262  514    3  266  264    1   12  267  E7KBL2     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain AWRI796) GN=AWRI796_1264 PE=3 SV=1
   26 : E7KMH6_YEASL        0.95  0.95  262  514    3  266  264    1   12  267  E7KMH6     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=QA23_1258 PE=3 SV=1
   27 : E7LTM6_YEASV        0.95  0.95  262  514    3  266  264    1   12  267  E7LTM6     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain VIN 13) GN=VIN13_1253 PE=3 SV=1
   28 : E7NGX8_YEASO        0.95  0.95  262  514    3  266  264    1   12  283  E7NGX8     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain FostersO) GN=FOSTERSO_1225 PE=3 SV=1
   29 : E7Q370_YEASB        0.95  0.95  262  514    3  266  264    1   12  267  E7Q370     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain FostersB) GN=FOSTERSB_1242 PE=3 SV=1
   30 : E7QDQ0_YEASZ        0.95  0.95  262  514    3  266  264    1   12  267  E7QDQ0     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=VL3_1252 PE=3 SV=1
   31 : G2WCL0_YEASK        0.95  0.95  262  514    3  266  264    1   12  267  G2WCL0     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) GN=K7_URA3 PE=3 SV=1
   32 : H0GEX4_9SACH        0.95  0.95  262  514    3  266  264    1   12  267  H0GEX4     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7 GN=VIN7_1269 PE=3 SV=1
   33 : J8LPV3_SACAR        0.95  0.99    1  260    3  262  260    0    0  267  J8LPV3     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644) GN=SU7_0821 PE=3 SV=1
   34 : L0PID4_PNEJ8        0.95  0.95  262  514    3  266  264    1   12  267  L0PID4     Orotidine 5'-phosphate decarboxylase OS=Pneumocystis jiroveci (strain SE8) GN=PNEJI1_003696 PE=3 SV=1
   35 : M2V1L5_BACIU        0.95  0.95  262  514    3  266  264    1   12  267  M2V1L5     Orotidine 5'-phosphate decarboxylase OS=Bacillus subtilis MB73/2 GN=BS732_4446 PE=3 SV=1
   36 : N1P5L4_YEASC        0.95  0.95  262  514    3  266  264    1   12  267  N1P5L4     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) GN=CENPK1137D_3634 PE=3 SV=1
   37 : PYRF_YEAST  3GDL    0.95  0.95  262  514    3  266  264    1   12  267  P03962     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA3 PE=1 SV=2
   38 : D4AHU9_SACPS        0.94  0.98    1  260    3  262  260    0    0  267  D4AHU9     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces pastorianus GN=SB-URA3 PE=3 SV=1
   39 : H0GTP2_9SACH        0.92  0.94  284  513    1  241  241    1   12  243  H0GTP2     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7 GN=VIN7_6631 PE=3 SV=1
   40 : J4TU41_SACK1        0.91  0.94  262  513    3  265  263    1   12  267  J4TU41     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=YEL021W PE=3 SV=1
   41 : J8LPV3_SACAR        0.90  0.95  262  514    3  266  264    1   12  267  J8LPV3     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644) GN=SU7_0821 PE=3 SV=1
   42 : D4AHU9_SACPS        0.89  0.94  262  514    3  266  264    1   12  267  D4AHU9     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces pastorianus GN=SB-URA3 PE=3 SV=1
   43 : G0VHI0_NAUCC        0.86  0.95    3  260    5  262  258    0    0  267  G0VHI0     Orotidine 5'-phosphate decarboxylase OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=NCAS0G03990 PE=3 SV=1
   44 : B2G4H8_ZYGRO        0.85  0.94    3  260    5  262  258    0    0  265  B2G4H8     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces rouxii GN=Zr_URA3 PE=3 SV=1
   45 : C5E470_ZYGRC        0.85  0.94    3  260    5  262  258    0    0  265  C5E470     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0E03366g PE=3 SV=1
   46 : G1UJA6_ZYGRO        0.84  0.94    3  260    5  262  258    0    0  265  G1UJA6     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces rouxii GN=URA3 PE=3 SV=1
   47 : PYRF_KLULA          0.84  0.93    4  260    6  262  257    0    0  267  P07922     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URA3 PE=3 SV=1
   48 : PYRF_TORDE          0.84  0.95    2  260    4  262  259    0    0  264  Q8J0E6     Orotidine 5'-phosphate decarboxylase OS=Torulaspora delbrueckii GN=URA3 PE=3 SV=1
   49 : G0WDG2_NAUDC        0.83  0.93    3  260    5  262  258    0    0  266  G0WDG2     Orotidine 5'-phosphate decarboxylase OS=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) GN=NDAI0G00470 PE=3 SV=2
   50 : G8ZPW2_TORDC        0.83  0.95    2  260    4  262  259    0    0  264  G8ZPW2     Orotidine 5'-phosphate decarboxylase OS=Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) GN=TDEL0B05270 PE=3 SV=1
   51 : PYRF_ZYGBA          0.83  0.95    2  260    4  262  259    0    0  265  Q9HFX0     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces bailii GN=URA3 PE=3 SV=1
   52 : A4Z4U5_KLUMA        0.82  0.92    3  260    5  262  258    0    0  267  A4Z4U5     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
   53 : C5E3J8_LACTC        0.82  0.93    4  260    6  262  257    0    0  265  C5E3J8     Orotidine 5'-phosphate decarboxylase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0H14168g PE=3 SV=1
   54 : D5G2K0_KLUMA        0.82  0.92    3  260    5  262  258    0    0  267  D5G2K0     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
   55 : PYRF_CANGA          0.82  0.93    1  260    3  262  260    0    0  265  P33283     Orotidine 5'-phosphate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA3 PE=3 SV=1
   56 : PYRF_KLUMA          0.82  0.92    3  260    5  262  258    0    0  267  P41769     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
   57 : G0VHI0_NAUCC        0.81  0.91  264  513    5  265  261    1   12  267  G0VHI0     Orotidine 5'-phosphate decarboxylase OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=NCAS0G03990 PE=3 SV=1
   58 : G8C1L9_TETPH        0.81  0.93    3  260    5  262  258    0    0  265  G8C1L9     Orotidine 5'-phosphate decarboxylase OS=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) GN=TPHA0O00780 PE=3 SV=1
   59 : H2AZE0_KAZAF        0.81  0.93    3  260    5  262  258    0    0  264  H2AZE0     Orotidine 5'-phosphate decarboxylase OS=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) GN=KAFR0H02870 PE=3 SV=1
   60 : B2G4H8_ZYGRO        0.80  0.89  264  513    5  265  261    1   12  265  B2G4H8     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces rouxii GN=Zr_URA3 PE=3 SV=1
   61 : C5E470_ZYGRC        0.80  0.89  264  513    5  265  261    1   12  265  C5E470     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0E03366g PE=3 SV=1
   62 : H9BS77_CANMI        0.80  0.88    3  260    5  265  261    1    3  269  H9BS77     Orotidine 5'-phosphate decarboxylase OS=Candida milleri GN=URA3 PE=3 SV=1
   63 : J7R9N5_KAZNA        0.80  0.91    2  260    4  262  259    0    0  268  J7R9N5     Orotidine 5'-phosphate decarboxylase OS=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) GN=KNAG0H01560 PE=3 SV=1
   64 : PYRF_SACEX          0.80  0.91    2  260    4  262  259    0    0  268  Q9Y726     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces exiguus GN=URA4 PE=3 SV=1
   65 : A7TLN1_VANPO        0.79  0.93    2  260    4  262  259    0    0  266  A7TLN1     Orotidine 5'-phosphate decarboxylase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1056p24 PE=3 SV=1
   66 : G1UJA6_ZYGRO        0.79  0.90  264  513    5  265  261    1   12  265  G1UJA6     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces rouxii GN=URA3 PE=3 SV=1
   67 : G8ZPW2_TORDC        0.79  0.90  263  511    4  263  260    1   12  264  G8ZPW2     Orotidine 5'-phosphate decarboxylase OS=Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) GN=TDEL0B05270 PE=3 SV=1
   68 : PYRF_KLULA          0.79  0.89  264  510    5  262  258    1   12  267  P07922     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URA3 PE=3 SV=1
   69 : PYRF_TORDE          0.79  0.90  263  511    4  263  260    1   12  264  Q8J0E6     Orotidine 5'-phosphate decarboxylase OS=Torulaspora delbrueckii GN=URA3 PE=3 SV=1
   70 : PYRF_ZYGBA          0.79  0.90  263  511    4  263  260    1   12  265  Q9HFX0     Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces bailii GN=URA3 PE=3 SV=1
   71 : C5E3J8_LACTC        0.78  0.89  265  513    6  265  260    1   12  265  C5E3J8     Orotidine 5'-phosphate decarboxylase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0H14168g PE=3 SV=1
   72 : G0WDG2_NAUDC        0.78  0.89  264  511    5  263  259    1   12  266  G0WDG2     Orotidine 5'-phosphate decarboxylase OS=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) GN=NDAI0G00470 PE=3 SV=2
   73 : R9XED2_9SACH        0.78  0.91    3  260    5  262  258    0    0  267  R9XED2     AaceriAEL059Wp OS=Saccharomycetaceae sp. 'Ashbya aceri' GN=AACERI_AaceriAEL059W PE=4 SV=1
   74 : A4Z4U5_KLUMA        0.77  0.87  264  513    5  265  261    1   12  267  A4Z4U5     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
   75 : D5G2K0_KLUMA        0.77  0.87  264  513    5  265  261    1   12  267  D5G2K0     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
   76 : D9IXA1_9ASCO        0.77  0.93    3  260    6  263  258    0    0  267  D9IXA1     Orotidine 5'-phosphate decarboxylase OS=Pichia onychis GN=Ura3 PE=3 SV=1
   77 : G8C1L9_TETPH        0.77  0.88  264  513    5  265  261    1   12  265  G8C1L9     Orotidine 5'-phosphate decarboxylase OS=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) GN=TPHA0O00780 PE=3 SV=1
   78 : M9N2F1_ASHGS        0.77  0.90    3  260    5  262  258    0    0  267  M9N2F1     Orotidine 5'-phosphate decarboxylase OS=Ashbya gossypii FDAG1 GN=FAGOS_FAEL059W PE=3 SV=1
   79 : PYRF_ASHGO          0.77  0.90    3  260    5  262  258    0    0  267  Q757S1     Orotidine 5'-phosphate decarboxylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA3 PE=3 SV=1
   80 : PYRF_CANGA          0.77  0.88  262  513    3  265  263    1   12  265  P33283     Orotidine 5'-phosphate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA3 PE=3 SV=1
   81 : PYRF_KLUMA          0.77  0.87  264  513    5  265  261    1   12  267  P41769     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
   82 : D2D5G5_WICCI        0.76  0.90    4  260    7  263  257    0    0  267  D2D5G5     Orotidine 5'-phosphate decarboxylase OS=Wickerhamomyces ciferrii GN=URA3 PE=3 SV=1
   83 : D9IXA2_9ASCO        0.76  0.92    3  260    6  263  258    0    0  267  D9IXA2     Orotidine 5'-phosphate decarboxylase OS=Pichia sp. JP-2008 GN=Ura3 PE=3 SV=1
   84 : H2AZE0_KAZAF        0.76  0.88  264  511    5  263  259    1   12  264  H2AZE0     Orotidine 5'-phosphate decarboxylase OS=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) GN=KAFR0H02870 PE=3 SV=1
   85 : J7R9N5_KAZNA        0.76  0.87  263  511    4  263  260    1   12  268  J7R9N5     Orotidine 5'-phosphate decarboxylase OS=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) GN=KNAG0H01560 PE=3 SV=1
   86 : K0KK24_WICCF        0.76  0.90    4  260    7  263  257    0    0  267  K0KK24     Orotidine 5'-phosphate decarboxylase OS=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) GN=URA3 PE=3 SV=1
   87 : PYRF_HANAN          0.76  0.91    3  260    6  263  258    0    0  267  P78724     Orotidine 5'-phosphate decarboxylase OS=Hansenula anomala GN=URA3 PE=3 SV=1
   88 : PYRF_SACEX          0.76  0.87  263  511    4  263  260    1   12  268  Q9Y726     Orotidine 5'-phosphate decarboxylase OS=Saccharomyces exiguus GN=URA4 PE=3 SV=1
   89 : E7R7L7_PICAD        0.75  0.89    3  260    4  261  258    0    0  263  E7R7L7     Orotidine 5'-phosphate decarboxylase OS=Pichia angusta (strain ATCC 26012 / NRRL Y-7560 / DL-1) GN=HPODL_2689 PE=3 SV=1
   90 : G8JND2_ERECY        0.75  0.91    3  260    5  262  258    0    0  265  G8JND2     Orotidine 5'-phosphate decarboxylase OS=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) GN=Ecym_1363 PE=3 SV=1
   91 : H9BS77_CANMI        0.75  0.83  264  513    5  268  264    2   15  269  H9BS77     Orotidine 5'-phosphate decarboxylase OS=Candida milleri GN=URA3 PE=3 SV=1
   92 : PYRF_CYBFA          0.75  0.91    4  260    7  263  257    0    0  265  P79075     Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera fabianii GN=URA3 PE=3 SV=1
   93 : PYRF_CYBJA          0.75  0.89   11  260   13  262  250    0    0  266  O94127     Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera jadinii GN=URA3 PE=3 SV=1
   94 : PYRF_PICAN          0.75  0.90    3  260    4  261  258    0    0  263  Q06375     Orotidine 5'-phosphate decarboxylase OS=Pichia angusta GN=URA3 PE=3 SV=1
   95 : Q1JUK9_9ASCO        0.75  0.88    3  260    6  263  258    0    0  265  Q1JUK9     Orotidine 5'-phosphate decarboxylase OS=Ogataea minuta var. minuta GN=OmURA3 PE=3 SV=1
   96 : A7TLN1_VANPO        0.74  0.88  263  514    4  266  263    1   12  266  A7TLN1     Orotidine 5'-phosphate decarboxylase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1056p24 PE=3 SV=1
   97 : C4R4E0_PICPG        0.74  0.87    4  257    5  258  254    0    0  263  C4R4E0     Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0381 PE=3 SV=1
   98 : C4Y878_CLAL4        0.74  0.88    3  260    4  261  258    0    0  264  C4Y878     Orotidine 5'-phosphate decarboxylase OS=Clavispora lusitaniae (strain ATCC 42720) GN=CLUG_04406 PE=3 SV=1
   99 : F2QWK8_PICP7        0.74  0.87    4  257    5  258  254    0    0  263  F2QWK8     Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) GN=URA3 PE=3 SV=1
  100 : PYRF_CANBO          0.74  0.88    3  260    9  266  258    0    0  270  Q01378     Orotidine 5'-phosphate decarboxylase OS=Candida boidinii GN=URA3 PE=3 SV=1
  101 : PYRF_PICPA          0.74  0.87    4  257    5  258  254    0    0  263  Q9C1J2     Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris GN=URA3 PE=3 SV=1
  102 : Q8X197_CLALS        0.74  0.88    3  260    4  261  258    0    0  264  Q8X197     Orotidine 5'-phosphate decarboxylase OS=Clavispora lusitaniae GN=URA3 PE=3 SV=1
  103 : A4IEX0_DEKBR        0.73  0.87    3  260    6  263  258    0    0  268  A4IEX0     Orotidine 5'-phosphate decarboxylase OS=Dekkera bruxellensis GN=URA3 PE=3 SV=1
  104 : D9IXA1_9ASCO        0.73  0.88  264  514    6  267  262    1   12  267  D9IXA1     Orotidine 5'-phosphate decarboxylase OS=Pichia onychis GN=Ura3 PE=3 SV=1
  105 : G3AXP3_CANTC        0.73  0.88    3  260    6  263  258    0    0  266  G3AXP3     Orotidine 5'-phosphate decarboxylase OS=Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) GN=CANTEDRAFT_91982 PE=3 SV=1
  106 : M3K3N3_CANMX        0.73  0.89    3  260    6  263  258    0    0  266  M3K3N3     Orotidine 5'-phosphate decarboxylase (Fragment) OS=Candida maltosa (strain Xu316) GN=G210_5265 PE=3 SV=1
  107 : PYRF_CANRU          0.73  0.88    2  260    4  262  259    0    0  265  Q9HFN9     Orotidine 5'-phosphate decarboxylase OS=Candida rugosa GN=URA3 PE=3 SV=1
  108 : PYRF_DEBHA          0.73  0.91    3  260    6  263  258    0    0  267  Q6BY69     Orotidine 5'-phosphate decarboxylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URA3 PE=3 SV=1
  109 : PYRF_KODOH          0.73  0.89    3  260    2  259  258    0    0  261  P48844     Orotidine 5'-phosphate decarboxylase OS=Kodamaea ohmeri GN=URA3 PE=3 SV=1
  110 : PYRF_PACTA          0.73  0.87    1  260    5  264  260    0    0  268  O93864     Orotidine 5'-phosphate decarboxylase OS=Pachysolen tannophilus GN=URA3 PE=3 SV=1
  111 : Q873Y6_KLUMA        0.73  0.82  264  513    5  265  268    2   26  267  Q873Y6     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
  112 : R9XED2_9SACH        0.73  0.86  264  513    5  265  261    1   12  267  R9XED2     AaceriAEL059Wp OS=Saccharomycetaceae sp. 'Ashbya aceri' GN=AACERI_AaceriAEL059W PE=4 SV=1
  113 : A5DF69_PICGU        0.72  0.86    1  260    4  263  260    0    0  266  A5DF69     Orotidine 5'-phosphate decarboxylase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_01920 PE=3 SV=2
  114 : A5DXW7_LODEL        0.72  0.88    1  260    4  263  260    0    0  265  A5DXW7     Orotidine 5'-phosphate decarboxylase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_02204 PE=3 SV=1
  115 : A9YSL3_CANTR        0.72  0.89    1  260    4  263  260    0    0  268  A9YSL3     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  116 : A9YSL4_CANTR        0.72  0.89    1  260    4  263  260    0    0  268  A9YSL4     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  117 : C4YPR6_CANAW        0.72  0.88    3  260    7  266  260    1    2  270  C4YPR6     Orotidine 5'-phosphate decarboxylase OS=Candida albicans (strain WO-1) GN=CAWG_02468 PE=3 SV=1
  118 : C5M9L3_CANTT        0.72  0.89    1  260    4  263  260    0    0  268  C5M9L3     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_02175 PE=3 SV=1
  119 : C7EDT1_CANTR        0.72  0.88    1  260    4  263  260    0    0  268  C7EDT1     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  120 : D2D5G5_WICCI        0.72  0.85  265  513    7  266  260    1   12  267  D2D5G5     Orotidine 5'-phosphate decarboxylase OS=Wickerhamomyces ciferrii GN=URA3 PE=3 SV=1
  121 : D9IXA2_9ASCO        0.72  0.87  264  514    6  267  262    1   12  267  D9IXA2     Orotidine 5'-phosphate decarboxylase OS=Pichia sp. JP-2008 GN=Ura3 PE=3 SV=1
  122 : E1CG14_ISSOR        0.72  0.89    2  260    2  260  259    0    0  262  E1CG14     Orotidine 5'-phosphate decarboxylase OS=Issatchenkia orientalis GN=URA3 PE=3 SV=1
  123 : G3ARU7_SPAPN        0.72  0.89    1  260    4  263  260    0    0  267  G3ARU7     Orotidine 5'-phosphate decarboxylase OS=Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) GN=PYRF PE=3 SV=1
  124 : G8YME9_PICSO        0.72  0.85    1  260    4  263  260    0    0  267  G8YME9     Orotidine 5'-phosphate decarboxylase OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=Piso0_001312 PE=3 SV=1
  125 : G8YMU2_PICSO        0.72  0.85    1  260    4  263  260    0    0  266  G8YMU2     Orotidine 5'-phosphate decarboxylase OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=Piso0_001312 PE=3 SV=1
  126 : K0KK24_WICCF        0.72  0.85  265  513    7  266  260    1   12  267  K0KK24     Orotidine 5'-phosphate decarboxylase OS=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) GN=URA3 PE=3 SV=1
  127 : M4MC29_ISSOR        0.72  0.89    2  260    2  260  259    0    0  262  M4MC29     Orotidine 5'-phosphate decarboxylase OS=Issatchenkia orientalis GN=URA3 PE=3 SV=1
  128 : M9N2F1_ASHGS        0.72  0.85  264  513    5  265  261    1   12  267  M9N2F1     Orotidine 5'-phosphate decarboxylase OS=Ashbya gossypii FDAG1 GN=FAGOS_FAEL059W PE=3 SV=1
  129 : O94164_CANTR        0.72  0.89    3  260    6  263  258    0    0  266  O94164     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=2
  130 : PYRF_ASHGO          0.72  0.85  264  513    5  265  261    1   12  267  Q757S1     Orotidine 5'-phosphate decarboxylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA3 PE=3 SV=1
  131 : PYRF_CANAL          0.72  0.87    3  260    7  266  260    1    2  270  P13649     Orotidine 5'-phosphate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA3 PE=3 SV=3
  132 : PYRF_CANGY          0.72  0.89    2  260    2  260  259    0    0  262  Q6IUR4     Orotidine 5'-phosphate decarboxylase OS=Candida glycerinogenes GN=URA3 PE=2 SV=1
  133 : PYRF_CANMA          0.72  0.89    3  260    6  263  258    0    0  266  P32430     Orotidine 5'-phosphate decarboxylase OS=Candida maltosa GN=URA3 PE=3 SV=1
  134 : PYRF_CANTR          0.72  0.89    1  260    4  263  260    0    0  268  O42771     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  135 : PYRF_PICST          0.72  0.88    2  260    5  263  259    0    0  267  P49434     Orotidine 5'-phosphate decarboxylase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=URA3 PE=3 SV=1
  136 : Q76D22_MILFA        0.72  0.85    1  260    4  263  260    0    0  266  Q76D22     Orotidine 5'-phosphate decarboxylase OS=Millerozyma farinosa GN=PsURA30 PE=3 SV=1
  137 : Q76D23_MILFA        0.72  0.85    1  260    4  263  260    0    0  267  Q76D23     Orotidine 5'-phosphate decarboxylase OS=Millerozyma farinosa GN=PsURA3 PE=3 SV=1
  138 : G8JND2_ERECY        0.71  0.86  264  510    5  262  258    1   12  265  G8JND2     Orotidine 5'-phosphate decarboxylase OS=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) GN=Ecym_1363 PE=3 SV=1
  139 : O42694_CANTR        0.71  0.87    3  260    6  262  258    1    1  267  O42694     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=2
  140 : PYRF_CANDC          0.71  0.87    3  260    7  266  260    1    2  270  Q9C150     Orotidine 5'-phosphate decarboxylase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=URA3 PE=3 SV=1
  141 : PYRF_CYBFA          0.71  0.86  265  511    7  264  258    1   12  265  P79075     Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera fabianii GN=URA3 PE=3 SV=1
  142 : PYRF_HANAN          0.71  0.86  264  513    6  266  261    1   12  267  P78724     Orotidine 5'-phosphate decarboxylase OS=Hansenula anomala GN=URA3 PE=3 SV=1
  143 : Q8J2U5_MILFA        0.71  0.85    1  260    4  263  260    0    0  267  Q8J2U5     Orotidine 5'-phosphate decarboxylase OS=Millerozyma farinosa GN=PfURA3 PE=3 SV=1
  144 : R9QWG1_SCHOC        0.71  0.87    1  260    4  261  260    1    2  266  R9QWG1     Orotidine-5'-phosphate decarboxylase OS=Schwanniomyces occidentalis GN=URA3 PE=4 SV=1
  145 : C4R4E0_PICPG        0.70  0.83  265  507    5  258  254    1   12  263  C4R4E0     Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0381 PE=3 SV=1
  146 : E7R7L7_PICAD        0.70  0.84  264  512    4  263  260    1   12  263  E7R7L7     Orotidine 5'-phosphate decarboxylase OS=Pichia angusta (strain ATCC 26012 / NRRL Y-7560 / DL-1) GN=HPODL_2689 PE=3 SV=1
  147 : F2QWK8_PICP7        0.70  0.83  265  507    5  258  254    1   12  263  F2QWK8     Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) GN=URA3 PE=3 SV=1
  148 : G8BGR7_CANPC        0.70  0.87    1  260    4  263  260    0    0  268  G8BGR7     Orotidine 5'-phosphate decarboxylase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) GN=CPAR2_502890 PE=3 SV=1
  149 : H8X5L6_CANO9        0.70  0.88    3  260    6  263  258    0    0  267  H8X5L6     Orotidine 5'-phosphate decarboxylase OS=Candida orthopsilosis (strain 90-125) GN=CORT_0D06380 PE=3 SV=1
  150 : PYRF_CANPA          0.70  0.87    1  260    4  263  260    0    0  268  Q12595     Orotidine 5'-phosphate decarboxylase OS=Candida parapsilosis GN=URA3 PE=3 SV=1
  151 : PYRF_CYBJA          0.70  0.83  272  514   13  266  254    1   12  266  O94127     Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera jadinii GN=URA3 PE=3 SV=1
  152 : PYRF_PICAN          0.70  0.85  264  512    4  263  260    1   12  263  Q06375     Orotidine 5'-phosphate decarboxylase OS=Pichia angusta GN=URA3 PE=3 SV=1
  153 : PYRF_PICPA          0.70  0.83  265  507    5  258  254    1   12  263  Q9C1J2     Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris GN=URA3 PE=3 SV=1
  154 : Q1JUK9_9ASCO        0.70  0.83  264  512    6  265  260    1   12  265  Q1JUK9     Orotidine 5'-phosphate decarboxylase OS=Ogataea minuta var. minuta GN=OmURA3 PE=3 SV=1
  155 : Q873Y6_KLUMA        0.70  0.78    3  260    5  262  277    2   38  267  Q873Y6     Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1
  156 : A4IEX0_DEKBR        0.69  0.83  264  510    6  263  258    1   12  268  A4IEX0     Orotidine 5'-phosphate decarboxylase OS=Dekkera bruxellensis GN=URA3 PE=3 SV=1
  157 : C4Y878_CLAL4        0.69  0.83  264  513    4  264  261    1   12  264  C4Y878     Orotidine 5'-phosphate decarboxylase OS=Clavispora lusitaniae (strain ATCC 42720) GN=CLUG_04406 PE=3 SV=1
  158 : G3AXP3_CANTC        0.69  0.83  264  513    6  266  261    1   12  266  G3AXP3     Orotidine 5'-phosphate decarboxylase OS=Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) GN=CANTEDRAFT_91982 PE=3 SV=1
  159 : M3K3N3_CANMX        0.69  0.84  264  513    6  266  261    1   12  266  M3K3N3     Orotidine 5'-phosphate decarboxylase (Fragment) OS=Candida maltosa (strain Xu316) GN=G210_5265 PE=3 SV=1
  160 : PYRF_CANBO          0.69  0.83  264  513    9  269  261    1   12  270  Q01378     Orotidine 5'-phosphate decarboxylase OS=Candida boidinii GN=URA3 PE=3 SV=1
  161 : PYRF_DEBHA          0.69  0.86  264  512    6  265  260    1   12  267  Q6BY69     Orotidine 5'-phosphate decarboxylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URA3 PE=3 SV=1
  162 : PYRF_KODOH          0.69  0.84  264  510    2  259  258    1   12  261  P48844     Orotidine 5'-phosphate decarboxylase OS=Kodamaea ohmeri GN=URA3 PE=3 SV=1
  163 : PYRF_SACFI          0.69  0.86    3  260    5  263  259    1    1  265  Q9UVZ5     Orotidine 5'-phosphate decarboxylase OS=Saccharomycopsis fibuligera GN=URA3 PE=3 SV=1
  164 : Q8X197_CLALS        0.69  0.83  264  513    4  264  261    1   12  264  Q8X197     Orotidine 5'-phosphate decarboxylase OS=Clavispora lusitaniae GN=URA3 PE=3 SV=1
  165 : A5DF69_PICGU        0.68  0.81  262  510    4  263  260    1   12  266  A5DF69     Orotidine 5'-phosphate decarboxylase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_01920 PE=3 SV=2
  166 : A5DXW7_LODEL        0.68  0.83  262  510    4  263  260    1   12  265  A5DXW7     Orotidine 5'-phosphate decarboxylase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_02204 PE=3 SV=1
  167 : A9YSL3_CANTR        0.68  0.84  262  513    4  266  263    1   12  268  A9YSL3     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  168 : B2ZBW6_9ASCO        0.68  0.85    1  260    4  261  260    1    2  265  B2ZBW6     Orotidine-5'-phosphate decarboxylase OS=Schwanniomyces polymorphus GN=URA3 PE=4 SV=1
  169 : C5M9L3_CANTT        0.68  0.84  262  513    4  266  263    1   12  268  C5M9L3     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_02175 PE=3 SV=1
  170 : G3ARU7_SPAPN        0.68  0.84  262  513    4  266  263    1   12  267  G3ARU7     Orotidine 5'-phosphate decarboxylase OS=Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) GN=PYRF PE=3 SV=1
  171 : O94164_CANTR        0.68  0.84  264  513    6  266  261    1   12  266  O94164     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=2
  172 : PYRF_CANMA          0.68  0.84  264  513    6  266  261    1   12  266  P32430     Orotidine 5'-phosphate decarboxylase OS=Candida maltosa GN=URA3 PE=3 SV=1
  173 : PYRF_CANRU          0.68  0.84  263  512    4  264  261    1   12  265  Q9HFN9     Orotidine 5'-phosphate decarboxylase OS=Candida rugosa GN=URA3 PE=3 SV=1
  174 : PYRF_PACTA          0.68  0.83  262  513    5  267  263    1   12  268  O93864     Orotidine 5'-phosphate decarboxylase OS=Pachysolen tannophilus GN=URA3 PE=3 SV=1
  175 : PYRF_PICST          0.68  0.84  263  513    5  266  262    1   12  267  P49434     Orotidine 5'-phosphate decarboxylase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=URA3 PE=3 SV=1
  176 : A4GGM1_9ASCO        0.67  0.86   15  260   15  258  246    1    2  262  A4GGM1     Orotidine 5'-phosphate decarboxylase OS=Starmerella bombicola GN=URA3 PE=3 SV=1
  177 : A9YSL4_CANTR        0.67  0.84  262  513    4  266  263    1   12  268  A9YSL4     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  178 : C4YPR6_CANAW        0.67  0.83  264  513    7  269  263    2   14  270  C4YPR6     Orotidine 5'-phosphate decarboxylase OS=Candida albicans (strain WO-1) GN=CAWG_02468 PE=3 SV=1
  179 : C7EDT1_CANTR        0.67  0.84  262  513    4  266  263    1   12  268  C7EDT1     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  180 : E1CG14_ISSOR        0.67  0.85  263  510    2  260  259    1   12  262  E1CG14     Orotidine 5'-phosphate decarboxylase OS=Issatchenkia orientalis GN=URA3 PE=3 SV=1
  181 : G3FCI2_9ASCO        0.67  0.85    1  260    4  261  260    1    2  264  G3FCI2     Orotidine 5'-phosphate decarboxylase OS=Candida magnoliae GN=URA3 PE=3 SV=1
  182 : G8YME9_PICSO        0.67  0.80  262  514    4  267  264    1   12  267  G8YME9     Orotidine 5'-phosphate decarboxylase OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=Piso0_001312 PE=3 SV=1
  183 : G8YMU2_PICSO        0.67  0.80  262  513    4  266  263    1   12  266  G8YMU2     Orotidine 5'-phosphate decarboxylase OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=Piso0_001312 PE=3 SV=1
  184 : M4MC29_ISSOR        0.67  0.85  263  510    2  260  259    1   12  262  M4MC29     Orotidine 5'-phosphate decarboxylase OS=Issatchenkia orientalis GN=URA3 PE=3 SV=1
  185 : O42694_CANTR        0.67  0.82  264  513    6  265  261    2   13  267  O42694     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=2
  186 : PYRF_CANAL          0.67  0.83  264  513    7  269  263    2   14  270  P13649     Orotidine 5'-phosphate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA3 PE=3 SV=3
  187 : PYRF_CANDC          0.67  0.82  264  513    7  269  263    2   14  270  Q9C150     Orotidine 5'-phosphate decarboxylase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=URA3 PE=3 SV=1
  188 : PYRF_CANGY          0.67  0.85  263  510    2  260  259    1   12  262  Q6IUR4     Orotidine 5'-phosphate decarboxylase OS=Candida glycerinogenes GN=URA3 PE=2 SV=1
  189 : PYRF_CANTR          0.67  0.84  262  513    4  266  263    1   12  268  O42771     Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1
  190 : Q76D22_MILFA        0.67  0.80  262  513    4  266  263    1   12  266  Q76D22     Orotidine 5'-phosphate decarboxylase OS=Millerozyma farinosa GN=PsURA30 PE=3 SV=1
  191 : Q76D23_MILFA        0.67  0.80  262  514    4  267  264    1   12  267  Q76D23     Orotidine 5'-phosphate decarboxylase OS=Millerozyma farinosa GN=PsURA3 PE=3 SV=1
  192 : R9QWG1_SCHOC        0.67  0.83  262  513    4  264  263    2   14  266  R9QWG1     Orotidine-5'-phosphate decarboxylase OS=Schwanniomyces occidentalis GN=URA3 PE=4 SV=1
  193 : H8WR54_BLAAD        0.66  0.85    3  242    8  247  240    0    0  270  H8WR54     Orotidine 5'-phosphate decarboxylase OS=Blastobotrys adeninivorans GN=AURA3 PE=3 SV=1
  194 : Q8J2U5_MILFA        0.66  0.80  262  514    4  267  264    1   12  267  Q8J2U5     Orotidine 5'-phosphate decarboxylase OS=Millerozyma farinosa GN=PfURA3 PE=3 SV=1
  195 : G8BGR7_CANPC        0.65  0.83  262  512    4  265  262    1   12  268  G8BGR7     Orotidine 5'-phosphate decarboxylase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) GN=CPAR2_502890 PE=3 SV=1
  196 : H8X5L6_CANO9        0.65  0.83  264  514    6  267  262    1   12  267  H8X5L6     Orotidine 5'-phosphate decarboxylase OS=Candida orthopsilosis (strain 90-125) GN=CORT_0D06380 PE=3 SV=1
  197 : PYRF_CANPA          0.65  0.83  262  512    4  265  262    1   12  268  Q12595     Orotidine 5'-phosphate decarboxylase OS=Candida parapsilosis GN=URA3 PE=3 SV=1
  198 : PYRF_SACFI          0.65  0.81  264  510    5  263  259    2   13  265  Q9UVZ5     Orotidine 5'-phosphate decarboxylase OS=Saccharomycopsis fibuligera GN=URA3 PE=3 SV=1
  199 : I2JZP4_DEKBR        0.64  0.80    3  260    6  264  259    1    1  269  I2JZP4     Orotidine 5'-phosphate decarboxylase OS=Dekkera bruxellensis AWRI1499 GN=AWRI1499_1576 PE=3 SV=1
  200 : M1X4Q4_9ASCO        0.64  0.78    4  260    9  268  261    3    5  271  M1X4Q4     Orotidine 5'-phosphate decarboxylase OS=Galactomyces candidum GN=URA3 PE=3 SV=1
  201 : B2ZBW6_9ASCO        0.63  0.79  262  513    4  264  263    2   14  265  B2ZBW6     Orotidine-5'-phosphate decarboxylase OS=Schwanniomyces polymorphus GN=URA3 PE=4 SV=1
  202 : G3FCI2_9ASCO        0.63  0.80  262  513    4  264  263    2   14  264  G3FCI2     Orotidine 5'-phosphate decarboxylase OS=Candida magnoliae GN=URA3 PE=3 SV=1
  203 : H8WR54_BLAAD        0.62  0.80  264  492    8  247  240    1   12  270  H8WR54     Orotidine 5'-phosphate decarboxylase OS=Blastobotrys adeninivorans GN=AURA3 PE=3 SV=1
  204 : A4GGM1_9ASCO        0.61  0.81  276  510   15  258  244    1   10  262  A4GGM1     Orotidine 5'-phosphate decarboxylase OS=Starmerella bombicola GN=URA3 PE=3 SV=1
  205 : I2JZP4_DEKBR        0.60  0.76  264  510    6  264  259    2   13  269  I2JZP4     Orotidine 5'-phosphate decarboxylase OS=Dekkera bruxellensis AWRI1499 GN=AWRI1499_1576 PE=3 SV=1
  206 : PYRF_DIPMG          0.60  0.75    1  260    8  282  275    5   15  284  Q12604     Orotidine 5'-phosphate decarboxylase OS=Dipodascus magnusii GN=URA3 PE=3 SV=1
  207 : M1X4Q4_9ASCO        0.59  0.73  265  513    9  271  264    4   17  271  M1X4Q4     Orotidine 5'-phosphate decarboxylase OS=Galactomyces candidum GN=URA3 PE=3 SV=1
  208 : B6K3I0_SCHJY        0.58  0.78    3  260    8  260  259    5    7  264  B6K3I0     Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_03164 PE=3 SV=1
  209 : PYRF_YARLI          0.56  0.74    2  259    2  283  284    5   28  286  Q12724     Orotidine 5'-phosphate decarboxylase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URA3 PE=3 SV=1
  210 : PYRF_DIPMG          0.55  0.70  262  512    8  284  277    6   27  284  Q12604     Orotidine 5'-phosphate decarboxylase OS=Dipodascus magnusii GN=URA3 PE=3 SV=1
  211 : B6K3I0_SCHJY        0.54  0.73  264  514    8  264  263    6   19  264  B6K3I0     Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_03164 PE=3 SV=1
  212 : E9CB35_CAPO3        0.52  0.72    1  260    5  259  261    6    7  263  E9CB35     Orotidine 5'-phosphate decarboxylase OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_05236 PE=3 SV=1
  213 : I4Y6H3_WALSC        0.52  0.76    4  259    4  258  262    6   13  262  I4Y6H3     Orotidine 5'-phosphate decarboxylase OS=Wallemia sebi (strain ATCC MYA-4683 / CBS 633.66) GN=WALSEDRAFT_48813 PE=3 SV=1
  214 : J4UF38_TRIAS        0.52  0.73    3  260    9  270  266    9   12  274  J4UF38     Orotidine 5'-phosphate decarboxylase OS=Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NCYC 2677 / UAMH 7654) GN=A1Q1_00953 PE=3 SV=1
  215 : K1VQK1_TRIAC        0.52  0.73    3  260    9  270  266    9   12  274  K1VQK1     Orotidine 5'-phosphate decarboxylase OS=Trichosporon asahii var. asahii (strain CBS 8904) GN=A1Q2_06776 PE=3 SV=1
  216 : M5GBC2_DACSP        0.52  0.72    1  260    7  258  261    5   10  267  M5GBC2     Orotidine 5'-phosphate decarboxylase OS=Dacryopinax sp. (strain DJM 731) GN=DACRYDRAFT_86026 PE=3 SV=1
  217 : PYRF_PHYB8          0.52  0.73    3  260    8  261  261    7   10  267  P21593     Orotidine 5'-phosphate decarboxylase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=pyrG PE=3 SV=1
  218 : PYRF_RHIPU          0.52  0.73    3  260    6  259  260    6    8  263  Q9Y720     Orotidine 5'-phosphate decarboxylase OS=Rhizomucor pusillus GN=PYR4 PE=3 SV=1
  219 : PYRF_YARLI          0.52  0.70  263  509    2  283  284    6   40  286  Q12724     Orotidine 5'-phosphate decarboxylase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URA3 PE=3 SV=1
  220 : R9AH76_WALI9        0.52  0.75   15  256   12  252  248    6   13  259  R9AH76     Orotidine 5'-phosphate decarboxylase OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=J056_001951 PE=4 SV=1
  221 : E6ZNG6_SPORE        0.51  0.69    1  260    6  279  279    9   24  282  E6ZNG6     Orotidine 5'-phosphate decarboxylase OS=Sporisorium reilianum (strain SRZ2) GN=Pyr6 PE=3 SV=1
  222 : F4R6A6_MELLP        0.51  0.75    4  260   10  265  261    7    9  269  F4R6A6     Orotidine 5'-phosphate decarboxylase OS=Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) GN=MELLADRAFT_51404 PE=3 SV=1
  223 : G7E9N2_MIXOS        0.51  0.71    4  260    8  273  272    9   21  275  G7E9N2     Orotidine 5'-phosphate decarboxylase OS=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) GN=Mo06046 PE=3 SV=1
  224 : I2H0S3_TETBL        0.51  0.74    1  259    3  268  268    6   11  271  I2H0S3     Orotidine 5'-phosphate decarboxylase OS=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) GN=TBLA0C01610 PE=3 SV=1
  225 : J9VIF2_CRYNH        0.51  0.71    3  260    9  266  265   10   14  270  J9VIF2     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_04961 PE=3 SV=1
  226 : PYRF_MUCCL          0.51  0.74    3  260    6  259  261    7   10  265  P32431     Orotidine 5'-phosphate decarboxylase OS=Mucor circinelloides f. lusitanicus GN=pyrG PE=3 SV=1
  227 : PYRF_SCHPO          0.51  0.71    2  260    7  260  261    6    9  264  P14965     Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura4 PE=3 SV=1
  228 : Q6X1B7_BLATR        0.51  0.74    3  260    6  259  261    7   10  266  Q6X1B7     Orotidine 5'-phosphate decarboxylase OS=Blakeslea trispora GN=pryG PE=3 SV=1
  229 : Q870M2_BLATR        0.51  0.75    3  260    6  259  261    7   10  266  Q870M2     Orotidine 5'-phosphate decarboxylase OS=Blakeslea trispora GN=pyrG PE=3 SV=1
  230 : R4XAF6_TAPDE        0.51  0.74    3  260    5  257  259    6    7  270  R4XAF6     Orotidine 5'-phosphate decarboxylase5 / FY16936 OS=Taphrina deformans (strain PYCC 5710 / ATCC 11124 / CBS 356.35 / IMI 108563 / JCM 9778 / NBRC 8474) GN=TAPDE_000980 PE=4 SV=1
  231 : S2J7X8_MUCC1        0.51  0.74    3  260    6  259  261    7   10  265  S2J7X8     Orotidine 5'-phosphate decarboxylase OS=Mucor circinelloides f. circinelloides (strain 1006PhL) GN=HMPREF1544_08806 PE=4 SV=1
  232 : B8P340_POSPM        0.50  0.70    2  260    7  271  272    9   20  276  B8P340     Orotidine 5'-phosphate decarboxylase OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=POSPLDRAFT_88293 PE=3 SV=1
  233 : C4PB22_9AGAR        0.50  0.72    3  260    8  264  264    9   13  266  C4PB22     Orotidine 5'-phosphate decarboxylase OS=Volvariella volvacea GN=pyrG PE=3 SV=1
  234 : D8PPL1_SCHCM        0.50  0.72    1  260    6  273  275    8   22  278  D8PPL1     Orotidine 5'-phosphate decarboxylase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_71804 PE=3 SV=1
  235 : E3VW03_PLEOS        0.50  0.71    4  260   11  267  264    8   14  270  E3VW03     Orotidine 5'-phosphate decarboxylase OS=Pleurotus ostreatus GN=pyrG PE=2 SV=1
  236 : E6R594_CRYGW        0.50  0.70    3  260    9  272  269   10   16  274  E6R594     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=CGB_D0260W PE=3 SV=1
  237 : I1CMW7_RHIO9        0.50  0.74    3  260    6  259  261    7   10  265  I1CMW7     Orotidine 5'-phosphate decarboxylase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=RO3G_14508 PE=3 SV=1
  238 : J9QY96_GANLU        0.50  0.71    1  260    6  274  276    9   23  279  J9QY96     Orotidine 5'-phosphate decarboxylase OS=Ganoderma lucidum GN=URA3 PE=2 SV=1
  239 : K9LTS7_PLEER        0.50  0.71    4  260   11  267  264    8   14  270  K9LTS7     Orotidine 5'-phosphate decarboxylase OS=Pleurotus eryngii GN=pyrG PE=3 SV=1
  240 : M7XB86_RHOT1        0.50  0.68    3  260    8  276  274    8   21  279  M7XB86     Orotidine-5'-phosphate decarboxylase OS=Rhodosporidium toruloides (strain NP11) GN=RHTO_02309 PE=4 SV=1
  241 : PYRF_RHINI          0.50  0.74    3  260    6  259  261    7   10  265  P43230     Orotidine 5'-phosphate decarboxylase OS=Rhizopus niveus GN=PYR4 PE=3 SV=1
  242 : PYRF_RHIOR          0.50  0.74    3  260    6  259  261    7   10  265  Q71HN5     Orotidine 5'-phosphate decarboxylase OS=Rhizopus oryzae GN=pyrG PE=3 SV=1
  243 : PYRF_SCHCO          0.50  0.72    1  260    6  273  275    8   22  278  P14964     Orotidine 5'-phosphate decarboxylase OS=Schizophyllum commune GN=URA1 PE=3 SV=1
  244 : Q5K890_CRYNJ        0.50  0.72    3  260    9  266  265   10   14  269  Q5K890     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL06550 PE=3 SV=1
  245 : A1DGE0_NEOFI        0.49  0.70    3  260    8  273  271    8   18  278  A1DGE0     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_083990 PE=3 SV=1
  246 : A7M6E5_9HOMO        0.49  0.71    1  260    4  270  274    9   21  272  A7M6E5     Orotidine 5'-phosphate decarboxylase OS=Phanerochaete sordida GN=PsURA3 PE=3 SV=1
  247 : B0CYI9_LACBS        0.49  0.69    3  260    9  274  273    8   22  276  B0CYI9     Orotidine 5'-phosphate decarboxylase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_290932 PE=3 SV=1
  248 : B3GF12_RHOTO        0.49  0.67    3  260    8  276  277    9   27  279  B3GF12     Orotidine 5'-phosphate decarboxylase OS=Rhodosporidium toruloides GN=ura3 PE=2 SV=1
  249 : E3VW02_PLEER        0.49  0.70    4  260   11  267  264    8   14  270  E3VW02     Orotidine 5'-phosphate decarboxylase OS=Pleurotus eryngii GN=pyrG PE=2 SV=1
  250 : E9CB35_CAPO3        0.49  0.69  262  511    5  260  262    7   19  263  E9CB35     Orotidine 5'-phosphate decarboxylase OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_05236 PE=3 SV=1
  251 : G0SZD4_RHOG2        0.49  0.67    3  260    8  276  277    9   27  279  G0SZD4     Orotidine 5'-phosphate decarboxylase OS=Rhodotorula glutinis (strain ATCC 204091 / IIP 30 / MTCC 1151) GN=RTG_02093 PE=4 SV=1
  252 : I2FV40_USTH4        0.49  0.69    1  260    6  279  279    9   24  283  I2FV40     Orotidine 5'-phosphate decarboxylase OS=Ustilago hordei (strain Uh4875-4) GN=UHOR_06322 PE=3 SV=1
  253 : J4UF38_TRIAS        0.49  0.69  264  510    9  270  266   10   24  274  J4UF38     Orotidine 5'-phosphate decarboxylase OS=Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NCYC 2677 / UAMH 7654) GN=A1Q1_00953 PE=3 SV=1
  254 : K1VQK1_TRIAC        0.49  0.69  264  510    9  270  266   10   24  274  K1VQK1     Orotidine 5'-phosphate decarboxylase OS=Trichosporon asahii var. asahii (strain CBS 8904) GN=A1Q2_06776 PE=3 SV=1
  255 : K2B793_9BACT        0.49  0.71   13  260    3  242  249    8   10  244  K2B793     Orotidine 5'-phosphate decarboxylase OS=uncultured bacterium GN=ACD_43C00175G0003 PE=3 SV=1
  256 : M5GBC2_DACSP        0.49  0.68  262  512    7  260  263    6   22  267  M5GBC2     Orotidine 5'-phosphate decarboxylase OS=Dacryopinax sp. (strain DJM 731) GN=DACRYDRAFT_86026 PE=3 SV=1
  257 : PYRF_ASPFU          0.49  0.71    3  260    8  273  271    8   18  278  O13410     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pyrG PE=3 SV=1
  258 : PYRF_USTMA          0.49  0.68    2  260    7  279  280    9   28  283  P15188     Orotidine 5'-phosphate decarboxylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PYR6 PE=2 SV=2
  259 : Q0C9F9_ASPTN        0.49  0.70    3  260    8  273  271    8   18  279  Q0C9F9     Orotidine 5'-phosphate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_09675 PE=3 SV=1
  260 : Q55MI1_CRYNB        0.49  0.72    3  260    9  266  265   10   14  271  Q55MI1     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBI0310 PE=3 SV=1
  261 : Q6F5H7_MORAP        0.49  0.72    1  260    4  259  263    7   10  262  Q6F5H7     Orotidine 5'-phosphate decarboxylase OS=Mortierella alpina GN=ura3 PE=3 SV=1
  262 : A8PME6_9COXI        0.48  0.71    1  259    7  259  261    9   10  261  A8PME6     Orotidine 5'-phosphate decarboxylase OS=Rickettsiella grylli GN=pyrF PE=3 SV=1
  263 : B0B072_RHOTO        0.48  0.65    3  260    8  275  277   10   28  278  B0B072     Orotidine 5'-phosphate decarboxylase OS=Rhodosporidium toruloides GN=ura3 PE=2 SV=1
  264 : B3VUH8_ASPPA        0.48  0.68    3  260    8  273  274    8   24  277  B3VUH8     Orotidine 5'-phosphate decarboxylase OS=Aspergillus parasiticus GN=pyrG PE=3 SV=1
  265 : B6H2A4_PENCW        0.48  0.70    3  260    8  272  270    8   17  276  B6H2A4     Orotidine 5'-phosphate decarboxylase OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=pyrG PE=3 SV=1
  266 : C5PHT0_COCP7        0.48  0.70    4  260    9  271  271    8   22  274  C5PHT0     Orotidine 5'-phosphate decarboxylase OS=Coccidioides posadasii (strain C735) GN=CPC735_054530 PE=3 SV=1
  267 : C7BUR9_AGABI        0.48  0.69    4  260    9  273  276    9   30  276  C7BUR9     Orotidine 5'-phosphate decarboxylase OS=Agaricus bisporus var. bisporus GN=ura3 PE=3 SV=1
  268 : D5GIU0_TUBMM        0.48  0.70    1  260    4  270  269    7   11  275  D5GIU0     Orotidine 5'-phosphate decarboxylase OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00008673001 PE=3 SV=1
  269 : F4R6A6_MELLP        0.48  0.71  265  511   10  266  262    8   21  269  F4R6A6     Orotidine 5'-phosphate decarboxylase OS=Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) GN=MELLADRAFT_51404 PE=3 SV=1
  270 : G8G324_EURHE        0.48  0.70    3  260    8  273  271    8   18  277  G8G324     Orotidine 5'-phosphate decarboxylase OS=Eurotium herbariorum GN=pyrG PE=3 SV=1
  271 : I2H0S3_TETBL        0.48  0.71  262  509    3  268  268    7   23  271  I2H0S3     Orotidine 5'-phosphate decarboxylase OS=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) GN=TBLA0C01610 PE=3 SV=1
  272 : I4Y6H3_WALSC        0.48  0.73  265  509    4  258  262    7   25  262  I4Y6H3     Orotidine 5'-phosphate decarboxylase OS=Wallemia sebi (strain ATCC MYA-4683 / CBS 633.66) GN=WALSEDRAFT_48813 PE=3 SV=1
  273 : J4G8Y6_FIBRA        0.48  0.70    3  260    8  273  274    9   24  279  J4G8Y6     Orotidine 5'-phosphate decarboxylase OS=Fibroporia radiculosa (strain TFFH 294) GN=FIBRA_05270 PE=3 SV=1
  274 : K2ABY9_9BACT        0.48  0.71    3  257    5  252  257    8   11  257  K2ABY9     Orotidine 5'-phosphate decarboxylase OS=uncultured bacterium GN=ACD_60C00160G0010 PE=3 SV=1
  275 : K5WXD9_AGABU        0.48  0.69    4  260    9  273  276    9   30  276  K5WXD9     Orotidine 5'-phosphate decarboxylase OS=Agaricus bisporus var. burnettii (strain JB137-S8 / ATCC MYA-4627 / FGSC 10392) GN=AGABI1DRAFT_120163 PE=3 SV=1
  276 : K9HPU6_AGABB        0.48  0.69    4  260    9  273  276    9   30  276  K9HPU6     Orotidine 5'-phosphate decarboxylase OS=Agaricus bisporus var. bisporus (strain H97 / ATCC MYA-4626 / FGSC 10389) GN=AGABI2DRAFT_184750 PE=3 SV=1
  277 : M9LYD3_PSEA3        0.48  0.66    2  260    7  289  288   10   34  293  M9LYD3     Uridine 5'-monophosphate synthase OS=Pseudozyma antarctica (strain T-34) GN=PANT_18c00050 PE=4 SV=1
  278 : PYRF_COCIM          0.48  0.70    1  260    6  271  274    8   22  274  Q1E9A1     Orotidine 5'-phosphate decarboxylase OS=Coccidioides immitis (strain RS) GN=URA3 PE=3 SV=1
  279 : PYRF_COCPS          0.48  0.70    4  260    9  271  271    8   22  274  Q4VWW3     Orotidine 5'-phosphate decarboxylase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=URA3 PE=3 SV=1
  280 : PYRF_PENCA          0.48  0.70    3  260    8  272  270    8   17  276  Q7Z8L4     Orotidine 5'-phosphate decarboxylase OS=Penicillium camembertii GN=pyrG PE=3 SV=1
  281 : PYRF_PENCH          0.48  0.68    3  260    8  274  272    9   19  278  P09463     Orotidine 5'-phosphate decarboxylase OS=Penicillium chrysogenum GN=pyrG PE=3 SV=1
  282 : PYRF_PENNA          0.48  0.70    3  260    8  272  270    8   17  276  Q8J269     Orotidine 5'-phosphate decarboxylase OS=Penicillium nalgiovense GN=pyrG PE=3 SV=1
  283 : PYRF_PHYB8          0.48  0.69  264  511    8  262  262    8   22  267  P21593     Orotidine 5'-phosphate decarboxylase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=pyrG PE=3 SV=1
  284 : PYRF_RHIPU          0.48  0.69  264  514    6  263  264    7   20  263  Q9Y720     Orotidine 5'-phosphate decarboxylase OS=Rhizomucor pusillus GN=PYR4 PE=3 SV=1
  285 : R9AH76_WALI9        0.48  0.71  276  506   12  252  248    7   25  259  R9AH76     Orotidine 5'-phosphate decarboxylase OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=J056_001951 PE=4 SV=1
  286 : R9E3L6_PISSA        0.48  0.70    3  260    2  252  261    8   13  253  R9E3L6     Uridine 5'-monophosphate synthase OS=Piscirickettsia salmonis LF-89 = ATCC VR-1361 GN=K661_0976 PE=4 SV=1
  287 : A1CSP8_ASPCL        0.47  0.69    3  260    8  273  274    8   24  278  A1CSP8     Orotidine 5'-phosphate decarboxylase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_080190 PE=3 SV=1
  288 : A2QZ43_ASPNC        0.47  0.69    3  260    8  273  274    8   24  280  A2QZ43     Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pyrA PE=3 SV=1
  289 : A8NXS9_COPC7        0.47  0.68    1  260    3  272  277    9   24  276  A8NXS9     Orotidine 5'-phosphate decarboxylase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00393 PE=3 SV=2
  290 : B0XWC3_ASPFC        0.47  0.69  264  511    8  259  260    9   21  263  B0XWC3     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_024310 PE=3 SV=1
  291 : B0XX31_ASPFC        0.47  0.69    3  260    8  273  274    8   24  277  B0XX31     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_047540 PE=3 SV=1
  292 : B3VP25_PENCA        0.47  0.70    3  260    8  272  270    8   17  276  B3VP25     Orotidine 5'-phosphate decarboxylase OS=Penicillium camembertii GN=pyrG PE=3 SV=1
  293 : B6Q930_PENMQ        0.47  0.65    1  260    6  273  273    8   18  276  B6Q930     Orotidine 5'-phosphate decarboxylase OS=Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_070700 PE=3 SV=1
  294 : B8M1G2_TALSN        0.47  0.64    1  260    6  273  276    8   24  276  B8M1G2     Orotidine 5'-phosphate decarboxylase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_090980 PE=3 SV=1
  295 : C4PB22_9AGAR        0.47  0.68  264  510    8  264  264   10   25  266  C4PB22     Orotidine 5'-phosphate decarboxylase OS=Volvariella volvacea GN=pyrG PE=3 SV=1
  296 : C9EFL8_ASPOZ        0.47  0.68    3  260    8  273  274    8   24  277  C9EFL8     Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae GN=pyrG PE=3 SV=1
  297 : D5GIU0_TUBMM        0.47  0.67  262  511    4  271  270    7   23  275  D5GIU0     Orotidine 5'-phosphate decarboxylase OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00008673001 PE=3 SV=1
  298 : D5KXY4_9EURO        0.47  0.69    4  260    9  269  270    8   22  275  D5KXY4     Orotidine 5'-phosphate decarboxylase OS=Monascus aurantiacus GN=pyrG PE=3 SV=1
  299 : E3L0A1_PUCGT        0.47  0.70    1  260    8  282  281    9   27  287  E3L0A1     Orotidine 5'-phosphate decarboxylase OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_16276 PE=3 SV=1
  300 : E3VW03_PLEOS        0.47  0.67  265  511   11  268  265    9   26  270  E3VW03     Orotidine 5'-phosphate decarboxylase OS=Pleurotus ostreatus GN=pyrG PE=2 SV=1
  301 : E6ZNG6_SPORE        0.47  0.65  262  510    6  279  279   10   36  282  E6ZNG6     Orotidine 5'-phosphate decarboxylase OS=Sporisorium reilianum (strain SRZ2) GN=Pyr6 PE=3 SV=1
  302 : F2SK36_TRIRC        0.47  0.67    1  260    6  273  276    7   24  276  F2SK36     Orotidine 5'-phosphate decarboxylase OS=Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) GN=TERG_03389 PE=3 SV=1
  303 : F8LBT2_9CHLA        0.47  0.69    4  256    7  252  255    9   11  254  F8LBT2     Uridine 5'-monophosphate synthase OS=Waddlia chondrophila 2032/99 GN=pyrE-F-B PE=3 SV=1
  304 : F8NM27_SERL9        0.47  0.70    2  260    7  274  275    8   23  279  F8NM27     Orotidine 5'-phosphate decarboxylase OS=Serpula lacrymans var. lacrymans (strain S7.9) GN=SERLADRAFT_461916 PE=3 SV=1
  305 : F8PQ91_SERL3        0.47  0.70    2  260    7  274  275    8   23  279  F8PQ91     Orotidine 5'-phosphate decarboxylase OS=Serpula lacrymans var. lacrymans (strain S7.3) GN=SERLA73DRAFT_178009 PE=3 SV=1
  306 : G3XVA2_ASPNA        0.47  0.69    3  260    8  273  274    8   24  277  G3XVA2     Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) GN=ASPNIDRAFT_56726 PE=3 SV=1
  307 : G4T9V9_PIRID        0.47  0.64    1  260    7  270  279    9   34  276  G4T9V9     Orotidine 5'-phosphate decarboxylase OS=Piriformospora indica (strain DSM 11827) GN=PIIN_01970 PE=3 SV=1
  308 : G7E9N2_MIXOS        0.47  0.67  265  512    8  275  274   10   33  275  G7E9N2     Orotidine 5'-phosphate decarboxylase OS=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) GN=Mo06046 PE=3 SV=1
  309 : G7XHJ2_ASPKW        0.47  0.68    3  260    8  273  274    8   24  277  G7XHJ2     Orotidine 5'-phosphate decarboxylase OS=Aspergillus kawachii (strain NBRC 4308) GN=AKAW_04515 PE=3 SV=1
  310 : H6C6Y4_EXODN        0.47  0.69    1  260    6  267  269    8   16  273  H6C6Y4     Orotidine 5'-phosphate decarboxylase OS=Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) GN=HMPREF1120_07468 PE=3 SV=1
  311 : I8TWX4_ASPO3        0.47  0.68    3  260    8  273  274    8   24  277  I8TWX4     Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae (strain 3.042) GN=Ao3042_05022 PE=3 SV=1
  312 : J9QY96_GANLU        0.47  0.67  262  512    6  276  278   10   35  279  J9QY96     Orotidine 5'-phosphate decarboxylase OS=Ganoderma lucidum GN=URA3 PE=2 SV=1
  313 : J9VIF2_CRYNH        0.47  0.68  264  510    9  266  265   11   26  270  J9VIF2     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_04961 PE=3 SV=1
  314 : K9F6W8_PEND1        0.47  0.70    3  260    8  272  270    8   17  276  K9F6W8     Orotidine 5'-phosphate decarboxylase OS=Penicillium digitatum (strain Pd1 / CECT 20795) GN=PDIP_85020 PE=3 SV=1
  315 : K9FY65_PEND2        0.47  0.70    3  260    8  272  270    8   17  276  K9FY65     Orotidine 5'-phosphate decarboxylase OS=Penicillium digitatum (strain PHI26 / CECT 20796) GN=PDIG_38390 PE=3 SV=1
  316 : K9LT35_FLAVE        0.47  0.68    2  260    2  265  274    9   25  267  K9LT35     Orotidine 5'-phosphate decarboxylase OS=Flammulina velutipes GN=pyrG PE=3 SV=1
  317 : K9LTS7_PLEER        0.47  0.67  265  511   11  268  265    9   26  270  K9LTS7     Orotidine 5'-phosphate decarboxylase OS=Pleurotus eryngii GN=pyrG PE=3 SV=1
  318 : L8X5K0_THACA        0.47  0.67    2  260    6  257  269   10   27  260  L8X5K0     Orotidine 5'-phosphate decarboxylase OS=Thanatephorus cucumeris (strain AG1-IA) GN=AG1IA_00379 PE=4 SV=1
  319 : PYRF_ASPAW          0.47  0.68    3  260    8  273  274    8   24  277  Q5J2D0     Orotidine 5'-phosphate decarboxylase OS=Aspergillus awamori GN=pyrG PE=3 SV=1
  320 : PYRF_ASPKA          0.47  0.68    3  260    8  273  274    8   24  277  Q96WP7     Orotidine 5'-phosphate decarboxylase OS=Aspergillus kawachii GN=pyrG PE=3 SV=1
  321 : PYRF_ASPNG          0.47  0.68    3  260    8  273  274    8   24  277  P07817     Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger GN=pyrG PE=3 SV=1
  322 : PYRF_ASPOR          0.47  0.68    3  260    8  273  274    8   24  277  O13416     Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pyrG PE=3 SV=1
  323 : PYRF_MUCCL          0.47  0.69  264  511    6  260  262    8   22  265  P32431     Orotidine 5'-phosphate decarboxylase OS=Mucor circinelloides f. lusitanicus GN=pyrG PE=3 SV=1
  324 : PYRF_SCHPO          0.47  0.67  263  514    7  264  265    7   21  264  P14965     Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura4 PE=3 SV=1
  325 : Q6X1B7_BLATR        0.47  0.70  264  511    6  260  262    8   22  266  Q6X1B7     Orotidine 5'-phosphate decarboxylase OS=Blakeslea trispora GN=pryG PE=3 SV=1
  326 : Q7Z7W9_9TREE        0.47  0.71    1  260    8  264  264    8   11  269  Q7Z7W9     Orotidine 5'-phosphate decarboxylase OS=Asterotremella humicola GN=URA3 PE=3 SV=1
  327 : Q870M2_BLATR        0.47  0.70  264  511    6  260  262    8   22  266  Q870M2     Orotidine 5'-phosphate decarboxylase OS=Blakeslea trispora GN=pyrG PE=3 SV=1
  328 : S2J7X8_MUCC1        0.47  0.70  264  511    6  260  262    8   22  265  S2J7X8     Orotidine 5'-phosphate decarboxylase OS=Mucor circinelloides f. circinelloides (strain 1006PhL) GN=HMPREF1544_08806 PE=4 SV=1
  329 : A8PME6_9COXI        0.46  0.68  262  509    7  259  261    9   22  261  A8PME6     Orotidine 5'-phosphate decarboxylase OS=Rickettsiella grylli GN=pyrF PE=3 SV=1
  330 : B8P340_POSPM        0.46  0.66  263  514    7  275  276   10   32  276  B8P340     Orotidine 5'-phosphate decarboxylase OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=POSPLDRAFT_88293 PE=3 SV=1
  331 : C0SHV5_PARBP        0.46  0.66    4  260    9  279  278    8   28  285  C0SHV5     Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_07260 PE=3 SV=1
  332 : C1GD89_PARBD        0.46  0.66    4  260    9  279  278    8   28  285  C1GD89     Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_05225 PE=3 SV=1
  333 : C4JEI1_UNCRE        0.46  0.69    3  260    8  271  272    8   22  274  C4JEI1     Orotidine 5'-phosphate decarboxylase OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_00820 PE=3 SV=1
  334 : D4P5A3_9EURO        0.46  0.67    3  260    8  272  274    8   25  276  D4P5A3     Orotidine 5'-phosphate decarboxylase OS=Penicillium decumbens GN=pyrG PE=3 SV=1
  335 : D8PPL1_SCHCM        0.46  0.67  262  512    6  275  277   10   34  278  D8PPL1     Orotidine 5'-phosphate decarboxylase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_71804 PE=3 SV=1
  336 : E3VW02_PLEER        0.46  0.66  265  511   11  268  265    9   26  270  E3VW02     Orotidine 5'-phosphate decarboxylase OS=Pleurotus eryngii GN=pyrG PE=2 SV=1
  337 : E4UPY2_ARTGP        0.46  0.68    1  260    6  273  276    7   24  277  E4UPY2     Orotidine 5'-phosphate decarboxylase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02129 PE=3 SV=1
  338 : E6R594_CRYGW        0.46  0.67  264  512    9  274  271   11   28  274  E6R594     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=CGB_D0260W PE=3 SV=1
  339 : F2PM31_TRIEC        0.46  0.68    1  260    6  273  277    8   26  276  F2PM31     Orotidine 5'-phosphate decarboxylase OS=Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) GN=TEQG_01987 PE=3 SV=1
  340 : F2RQE4_TRIT1        0.46  0.68    1  260    6  273  277    8   26  276  F2RQE4     Orotidine 5'-phosphate decarboxylase OS=Trichophyton tonsurans (strain CBS 112818) GN=TESG_01087 PE=3 SV=1
  341 : G0SZD4_RHOG2        0.46  0.63  264  510    8  276  277   10   39  279  G0SZD4     Orotidine 5'-phosphate decarboxylase OS=Rhodotorula glutinis (strain ATCC 204091 / IIP 30 / MTCC 1151) GN=RTG_02093 PE=4 SV=1
  342 : G1XK55_ARTOA        0.46  0.65    4  260    9  272  269    8   17  276  G1XK55     Orotidine 5'-phosphate decarboxylase OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) GN=AOL_s00109g84 PE=3 SV=1
  343 : I1CMW7_RHIO9        0.46  0.70  264  510    6  259  261    8   22  265  I1CMW7     Orotidine 5'-phosphate decarboxylase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=RO3G_14508 PE=3 SV=1
  344 : I2FV40_USTH4        0.46  0.65  262  513    6  282  282   10   36  283  I2FV40     Orotidine 5'-phosphate decarboxylase OS=Ustilago hordei (strain Uh4875-4) GN=UHOR_06322 PE=3 SV=1
  345 : K2AUF0_9BACT        0.46  0.70    3  260    3  253  259    8    9  259  K2AUF0     Orotidine 5'-phosphate decarboxylase OS=uncultured bacterium GN=ACD_46C00145G0003 PE=3 SV=1
  346 : K2B793_9BACT        0.46  0.67  274  510    3  242  249    9   22  244  K2B793     Orotidine 5'-phosphate decarboxylase OS=uncultured bacterium GN=ACD_43C00175G0003 PE=3 SV=1
  347 : M5AYH3_9AGAR        0.46  0.67    3  260    7  269  272    9   23  274  M5AYH3     Orotidine 5'-phosphate decarboxylase OS=Cyathus stercoreus GN=CsURA3 PE=3 SV=1
  348 : M7NLL2_PNEMU        0.46  0.69    1  260    7  273  273    6   19  275  M7NLL2     Orotidine 5'-phosphate decarboxylase OS=Pneumocystis murina (strain B123) GN=PNEG_02139 PE=3 SV=1
  349 : M7XB86_RHOT1        0.46  0.63  264  510    8  276  277   10   39  279  M7XB86     Orotidine-5'-phosphate decarboxylase OS=Rhodosporidium toruloides (strain NP11) GN=RHTO_02309 PE=4 SV=1
  350 : PYRF_EMENI          0.46  0.69    4  260    9  271  271    8   22  274  P10652     Orotidine 5'-phosphate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrG PE=3 SV=2
  351 : PYRF_PARBR          0.46  0.66    4  260    9  279  278    8   28  285  Q9C131     Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis GN=URA3 PE=3 SV=1
  352 : PYRF_RHINI          0.46  0.70  264  510    6  259  261    8   22  265  P43230     Orotidine 5'-phosphate decarboxylase OS=Rhizopus niveus GN=PYR4 PE=3 SV=1
  353 : PYRF_RHIOR          0.46  0.70  264  510    6  259  261    8   22  265  Q71HN5     Orotidine 5'-phosphate decarboxylase OS=Rhizopus oryzae GN=pyrG PE=3 SV=1
  354 : PYRF_SCHCO          0.46  0.67  262  512    6  275  277   10   34  278  P14964     Orotidine 5'-phosphate decarboxylase OS=Schizophyllum commune GN=URA1 PE=3 SV=1
  355 : PYRF_SOLCC          0.46  0.66    4  260    9  272  273    7   25  280  Q9HF68     Orotidine 5'-phosphate decarboxylase OS=Solorina crocea GN=PYRG PE=3 SV=1
  356 : Q55MI1_CRYNB        0.46  0.69  264  510    9  266  265   11   26  271  Q55MI1     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBI0310 PE=3 SV=1
  357 : Q5K890_CRYNJ        0.46  0.69  264  510    9  266  265   11   26  269  Q5K890     Orotidine 5'-phosphate decarboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL06550 PE=3 SV=1
  358 : Q6F5H7_MORAP        0.46  0.68  262  513    4  262  266    8   22  262  Q6F5H7     Orotidine 5'-phosphate decarboxylase OS=Mortierella alpina GN=ura3 PE=3 SV=1
  359 : R4XAF6_TAPDE        0.46  0.69  264  514    5  261  265    8   23  270  R4XAF6     Orotidine 5'-phosphate decarboxylase5 / FY16936 OS=Taphrina deformans (strain PYCC 5710 / ATCC 11124 / CBS 356.35 / IMI 108563 / JCM 9778 / NBRC 8474) GN=TAPDE_000980 PE=4 SV=1
  360 : A1DGE0_NEOFI        0.45  0.65  264  514    8  277  278    9   36  278  A1DGE0     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_083990 PE=3 SV=1
  361 : A7M6E5_9HOMO        0.45  0.66  262  511    4  271  277   10   37  272  A7M6E5     Orotidine 5'-phosphate decarboxylase OS=Phanerochaete sordida GN=PsURA3 PE=3 SV=1
  362 : B0CYI9_LACBS        0.45  0.65  264  510    9  274  273    9   34  276  B0CYI9     Orotidine 5'-phosphate decarboxylase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_290932 PE=3 SV=1
  363 : B3GF12_RHOTO        0.45  0.63  264  510    8  276  277   10   39  279  B3GF12     Orotidine 5'-phosphate decarboxylase OS=Rhodosporidium toruloides GN=ura3 PE=2 SV=1
  364 : B3VUH8_ASPPA        0.45  0.64  264  514    8  277  278    9   36  277  B3VUH8     Orotidine 5'-phosphate decarboxylase OS=Aspergillus parasiticus GN=pyrG PE=3 SV=1
  365 : C5FPT0_ARTOC        0.45  0.65    1  260    6  272  276    8   25  275  C5FPT0     Orotidine 5'-phosphate decarboxylase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04504 PE=3 SV=1
  366 : C7BUR9_AGABI        0.45  0.65  265  510    9  273  276   10   42  276  C7BUR9     Orotidine 5'-phosphate decarboxylase OS=Agaricus bisporus var. bisporus GN=ura3 PE=3 SV=1
  367 : C8AU74_LENED        0.45  0.68    1  260    6  270  274    8   23  275  C8AU74     Orotidine 5'-phosphate decarboxylase OS=Lentinula edodes GN=pyrG PE=3 SV=1
  368 : D6YU99_WADCW        0.45  0.65  265  506    7  252  257   11   27  254  D6YU99     Orotidine 5'-phosphate decarboxylase OS=Waddlia chondrophila (strain ATCC VR-1470 / WSU 86-1044) GN=pyrF PE=3 SV=1
  369 : F0U914_AJEC8        0.45  0.66    4  260    9  281  277    7   24  287  F0U914     Orotidine 5'-phosphate decarboxylase OS=Ajellomyces capsulata (strain H88) GN=HCEG_01170 PE=3 SV=1
  370 : F8LBT2_9CHLA        0.45  0.65  265  506    7  252  255   10   23  254  F8LBT2     Uridine 5'-monophosphate synthase OS=Waddlia chondrophila 2032/99 GN=pyrE-F-B PE=3 SV=1
  371 : J3P069_GAGT3        0.45  0.67    3  260    8  270  272    8   23  278  J3P069     Orotidine 5'-phosphate decarboxylase OS=Gaeumannomyces graminis var. tritici (strain R3-111a-1) GN=GGTG_06916 PE=3 SV=1
  372 : J3PPM9_PUCT1        0.45  0.70    1  260    8  282  281    9   27  287  J3PPM9     Orotidine 5'-phosphate decarboxylase OS=Puccinia triticina (isolate 1-1 / race 1 (BBBD)) GN=PTTG_01095 PE=3 SV=1
  373 : J4G8Y6_FIBRA        0.45  0.66  264  514    8  277  277   10   34  279  J4G8Y6     Orotidine 5'-phosphate decarboxylase OS=Fibroporia radiculosa (strain TFFH 294) GN=FIBRA_05270 PE=3 SV=1
  374 : K2ABY9_9BACT        0.45  0.66  264  507    5  252  259   10   27  257  K2ABY9     Orotidine 5'-phosphate decarboxylase OS=uncultured bacterium GN=ACD_60C00160G0010 PE=3 SV=1
  375 : K5WXD9_AGABU        0.45  0.65  265  510    9  273  276   10   42  276  K5WXD9     Orotidine 5'-phosphate decarboxylase OS=Agaricus bisporus var. burnettii (strain JB137-S8 / ATCC MYA-4627 / FGSC 10392) GN=AGABI1DRAFT_120163 PE=3 SV=1
  376 : K9HPU6_AGABB        0.45  0.65  265  510    9  273  276   10   42  276  K9HPU6     Orotidine 5'-phosphate decarboxylase OS=Agaricus bisporus var. bisporus (strain H97 / ATCC MYA-4626 / FGSC 10389) GN=AGABI2DRAFT_184750 PE=3 SV=1
  377 : PYRF_ASPFU          0.45  0.67  264  511    8  274  272    9   30  278  O13410     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pyrG PE=3 SV=1
  378 : PYRF_USTMA          0.45  0.64  263  514    7  283  284   10   40  283  P15188     Orotidine 5'-phosphate decarboxylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PYR6 PE=2 SV=2
  379 : Q0C9F9_ASPTN        0.45  0.66  264  514    8  277  276   10   32  279  Q0C9F9     Orotidine 5'-phosphate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_09675 PE=3 SV=1
  380 : R9E3L6_PISSA        0.45  0.67  264  510    2  252  261    9   25  253  R9E3L6     Uridine 5'-monophosphate synthase OS=Piscirickettsia salmonis LF-89 = ATCC VR-1361 GN=K661_0976 PE=4 SV=1
  381 : B0B072_RHOTO        0.44  0.61  264  510    8  275  277   11   40  278  B0B072     Orotidine 5'-phosphate decarboxylase OS=Rhodosporidium toruloides GN=ura3 PE=2 SV=1
  382 : B0XWC3_ASPFC        0.44  0.65    3  260    8  258  274    9   39  263  B0XWC3     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_024310 PE=3 SV=1
  383 : B3VP25_PENCA        0.44  0.66  264  514    8  276  275   10   31  276  B3VP25     Orotidine 5'-phosphate decarboxylase OS=Penicillium camembertii GN=pyrG PE=3 SV=1
  384 : B6H2A4_PENCW        0.44  0.66  264  514    8  276  275   10   31  276  B6H2A4     Orotidine 5'-phosphate decarboxylase OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=pyrG PE=3 SV=1
  385 : C5G822_AJEDR        0.44  0.65    4  260    9  289  285    7   32  295  C5G822     Orotidine 5'-phosphate decarboxylase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00181 PE=3 SV=1
  386 : C5PHT0_COCP7        0.44  0.66  265  513    9  274  275   10   36  274  C5PHT0     Orotidine 5'-phosphate decarboxylase OS=Coccidioides posadasii (strain C735) GN=CPC735_054530 PE=3 SV=1
  387 : C9EFL8_ASPOZ        0.44  0.64  264  514    8  277  279   10   38  277  C9EFL8     Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae GN=pyrG PE=3 SV=1
  388 : D5KXY4_9EURO        0.44  0.66  265  513    9  272  273    9   34  275  D5KXY4     Orotidine 5'-phosphate decarboxylase OS=Monascus aurantiacus GN=pyrG PE=3 SV=1
  389 : E3L0A1_PUCGT        0.44  0.66  262  510    8  282  283   11   43  287  E3L0A1     Orotidine 5'-phosphate decarboxylase OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_16276 PE=3 SV=1
  390 : G4T9V9_PIRID        0.44  0.61  262  510    7  270  279   10   46  276  G4T9V9     Orotidine 5'-phosphate decarboxylase OS=Piriformospora indica (strain DSM 11827) GN=PIIN_01970 PE=3 SV=1
  391 : G8G324_EURHE        0.44  0.66  264  512    8  275  274   10   32  277  G8G324     Orotidine 5'-phosphate decarboxylase OS=Eurotium herbariorum GN=pyrG PE=3 SV=1
  392 : I8TWX4_ASPO3        0.44  0.64  264  514    8  277  279   10   38  277  I8TWX4     Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae (strain 3.042) GN=Ao3042_05022 PE=3 SV=1
  393 : K9F6W8_PEND1        0.44  0.66  264  514    8  276  275   10   31  276  K9F6W8     Orotidine 5'-phosphate decarboxylase OS=Penicillium digitatum (strain Pd1 / CECT 20795) GN=PDIP_85020 PE=3 SV=1
  394 : K9FY65_PEND2        0.44  0.66  264  514    8  276  275   10   31  276  K9FY65     Orotidine 5'-phosphate decarboxylase OS=Penicillium digitatum (strain PHI26 / CECT 20796) GN=PDIG_38390 PE=3 SV=1
  395 : M9LYD3_PSEA3        0.44  0.62  263  514    7  293  292   11   46  293  M9LYD3     Uridine 5'-monophosphate synthase OS=Pseudozyma antarctica (strain T-34) GN=PANT_18c00050 PE=4 SV=1
  396 : PYRF_ASPOR          0.44  0.64  264  514    8  277  279   10   38  277  O13416     Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pyrG PE=3 SV=1
  397 : PYRF_COCIM          0.44  0.66  262  513    6  274  278   10   36  274  Q1E9A1     Orotidine 5'-phosphate decarboxylase OS=Coccidioides immitis (strain RS) GN=URA3 PE=3 SV=1
  398 : PYRF_COCPS          0.44  0.66  265  513    9  274  275   10   36  274  Q4VWW3     Orotidine 5'-phosphate decarboxylase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=URA3 PE=3 SV=1
  399 : PYRF_PASFU          0.44  0.68    4  260    9  272  273    8   25  278  Q9HFV8     Orotidine 5'-phosphate decarboxylase OS=Passalora fulva GN=PYR1 PE=3 SV=1
  400 : PYRF_PENCA          0.44  0.66  264  514    8  276  275   10   31  276  Q7Z8L4     Orotidine 5'-phosphate decarboxylase OS=Penicillium camembertii GN=pyrG PE=3 SV=1
  401 : PYRF_PENCH          0.44  0.65  264  514    8  278  277   11   33  278  P09463     Orotidine 5'-phosphate decarboxylase OS=Penicillium chrysogenum GN=pyrG PE=3 SV=1
  402 : PYRF_PENNA          0.44  0.66  264  514    8  276  275   10   31  276  Q8J269     Orotidine 5'-phosphate decarboxylase OS=Penicillium nalgiovense GN=pyrG PE=3 SV=1
  403 : Q7Z7W9_9TREE        0.44  0.67  262  510    8  264  264    9   23  269  Q7Z7W9     Orotidine 5'-phosphate decarboxylase OS=Asterotremella humicola GN=URA3 PE=3 SV=1
  404 : A1CSP8_ASPCL        0.43  0.65  264  514    8  277  279   10   38  278  A1CSP8     Orotidine 5'-phosphate decarboxylase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_080190 PE=3 SV=1
  405 : A2QZ43_ASPNC        0.43  0.65  264  514    8  277  279   10   38  280  A2QZ43     Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pyrA PE=3 SV=1
  406 : A8NXS9_COPC7        0.43  0.64  262  512    3  274  281   12   40  276  A8NXS9     Orotidine 5'-phosphate decarboxylase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00393 PE=3 SV=2
  407 : B0XX31_ASPFC        0.43  0.65  264  514    8  277  279   10   38  277  B0XX31     Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_047540 PE=3 SV=1
  408 : B6Q930_PENMQ        0.43  0.61  262  513    6  276  277   10   32  276  B6Q930     Orotidine 5'-phosphate decarboxylase OS=Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_070700 PE=3 SV=1
  409 : B8M1G2_TALSN        0.43  0.61  262  512    6  275  279   10   38  276  B8M1G2     Orotidine 5'-phosphate decarboxylase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_090980 PE=3 SV=1
  410 : C5FPT0_ARTOC        0.43  0.64  262  513    6  275  280   10   39  275  C5FPT0     Orotidine 5'-phosphate decarboxylase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04504 PE=3 SV=1
  411 : C5JZY0_AJEDS        0.43  0.64    4  260    9  294  290    7   37  300  C5JZY0     Orotidine 5'-phosphate decarboxylase OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_08124 PE=3 SV=1
  412 : D4P5A3_9EURO        0.43  0.63  264  514    8  276  279   10   39  276  D4P5A3     Orotidine 5'-phosphate decarboxylase OS=Penicillium decumbens GN=pyrG PE=3 SV=1
  413 : E9E7A5_METAQ        0.43  0.66    1  260    6  269  271    9   18  273  E9E7A5     Orotidine 5'-phosphate decarboxylase OS=Metarhizium acridum (strain CQMa 102) GN=MAC_05753 PE=3 SV=1
  414 : E9EPS8_METAR        0.43  0.64    1  260    6  269  272    9   20  273  E9EPS8     Orotidine 5'-phosphate decarboxylase OS=Metarhizium anisopliae (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_01713 PE=3 SV=1
  415 : F2SK36_TRIRC        0.43  0.64  262  513    6  276  280    9   38  276  F2SK36     Orotidine 5'-phosphate decarboxylase OS=Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) GN=TERG_03389 PE=3 SV=1
  416 : F4P383_BATDJ        0.43  0.67    1  260    5  278  283   11   32  285  F4P383     Orotidine 5'-phosphate decarboxylase OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_88516 PE=3 SV=1
  417 : F8NM27_SERL9        0.43  0.66  263  512    7  276  279   10   39  279  F8NM27     Orotidine 5'-phosphate decarboxylase OS=Serpula lacrymans var. lacrymans (strain S7.9) GN=SERLADRAFT_461916 PE=3 SV=1
  418 : F8PQ91_SERL3        0.43  0.66  263  512    7  276  279   10   39  279  F8PQ91     Orotidine 5'-phosphate decarboxylase OS=Serpula lacrymans var. lacrymans (strain S7.3) GN=SERLA73DRAFT_178009 PE=3 SV=1
  419 : G3XVA2_ASPNA        0.43  0.65  264  514    8  277  279   10   38  277  G3XVA2     Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) GN=ASPNIDRAFT_56726 PE=3 SV=1
  420 : G7XHJ2_ASPKW        0.43  0.64  264  514    8  277  279   10   38  277  G7XHJ2     Orotidine 5'-phosphate decarboxylase OS=Aspergillus kawachii (strain NBRC 4308) GN=AKAW_04515 PE=3 SV=1
  421 : H6C6Y4_EXODN        0.43  0.64  262  510    6  267  270   10   30  273  H6C6Y4     Orotidine 5'-phosphate decarboxylase OS=Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) GN=HMPREF1120_07468 PE=3 SV=1
  422 : K2AUF0_9BACT        0.43  0.66  264  510    3  253  261   10   25  259  K2AUF0     Orotidine 5'-phosphate decarboxylase OS=uncultured bacterium GN=ACD_46C00145G0003 PE=3 SV=1
  423 : K2CHL4_9BACT        0.43  0.68  265  514    6  259  264    9   25  259  K2CHL4     Orotidine 5'-phosphate decarboxylase OS=uncultured bacterium GN=ACD_45C00182G0002 PE=3 SV=1
  424 : K9LT35_FLAVE        0.43  0.64  263  512    2  267  277   11   39  267  K9LT35     Orotidine 5'-phosphate decarboxylase OS=Flammulina velutipes GN=pyrG PE=3 SV=1
  425 : L8X5K0_THACA        0.43  0.63  263  511    6  258  270   11   39  260  L8X5K0     Orotidine 5'-phosphate decarboxylase OS=Thanatephorus cucumeris (strain AG1-IA) GN=AG1IA_00379 PE=4 SV=1
  426 : M5AYH3_9AGAR        0.43  0.63  264  510    7  269  274   11   39  274  M5AYH3     Orotidine 5'-phosphate decarboxylase OS=Cyathus stercoreus GN=CsURA3 PE=3 SV=1
  427 : M7NLL2_PNEMU        0.43  0.64  262  512    7  275  277    9   35  275  M7NLL2     Orotidine 5'-phosphate decarboxylase OS=Pneumocystis murina (strain B123) GN=PNEG_02139 PE=3 SV=1
  428 : PYRF_ASPAW          0.43  0.64  264  514    8  277  279   10   38  277  Q5J2D0     Orotidine 5'-phosphate decarboxylase OS=Aspergillus awamori GN=pyrG PE=3 SV=1
  429 : PYRF_ASPKA          0.43  0.64  264  514    8  277  279   10   38  277  Q96WP7     Orotidine 5'-phosphate decarboxylase OS=Aspergillus kawachii GN=pyrG PE=3 SV=1
  430 : PYRF_ASPNG          0.43  0.64  264  514    8  277  279   10   38  277  P07817     Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger GN=pyrG PE=3 SV=1
  431 : C0SHV5_PARBP        0.42  0.62  265  511    9  280  280   10   42  285  C0SHV5     Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_07260 PE=3 SV=1
  432 : C1GD89_PARBD        0.42  0.62  265  511    9  280  280   10   42  285  C1GD89     Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_05225 PE=3 SV=1
  433 : C4JEI1_UNCRE        0.42  0.65  264  511    8  272  271   10   30  274  C4JEI1     Orotidine 5'-phosphate decarboxylase OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_00820 PE=3 SV=1
  434 : E4UPY2_ARTGP        0.42  0.64  262  514    6  277  281    9   38  277  E4UPY2     Orotidine 5'-phosphate decarboxylase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02129 PE=3 SV=1
  435 : E9FAY9_METAR        0.42  0.58    3  260    8  292  290   11   37  295  E9FAY9     Orotidine 5'-phosphate decarboxylase OS=Metarhizium anisopliae (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_09438 PE=3 SV=1
  436 : F0U914_AJEC8        0.42  0.62  265  511    9  282  279    9   38  287  F0U914     Orotidine 5'-phosphate decarboxylase OS=Ajellomyces capsulata (strain H88) GN=HCEG_01170 PE=3 SV=1
  437 : F2PM31_TRIEC        0.42  0.64  262  513    6  276  281   10   40  276  F2PM31     Orotidine 5'-phosphate decarboxylase OS=Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) GN=TEQG_01987 PE=3 SV=1
  438 : F2RQE4_TRIT1        0.42  0.64  262  513    6  276  281   10   40  276  F2RQE4     Orotidine 5'-phosphate decarboxylase OS=Trichophyton tonsurans (strain CBS 112818) GN=TESG_01087 PE=3 SV=1
  439 : F4P383_BATDJ        0.42  0.63  262  511    5  279  287   11   50  285  F4P383     Orotidine 5'-phosphate decarboxylase OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_88516 PE=3 SV=1
  440 : G1XK55_ARTOA        0.42  0.62  265  514    9  276  273    9   29  276  G1XK55     Orotidine 5'-phosphate decarboxylase OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) GN=AOL_s00109g84 PE=3 SV=1
  441 : J3P069_GAGT3        0.42  0.63  264  510    8  270  273   10   37  278  J3P069     Orotidine 5'-phosphate decarboxylase OS=Gaeumannomyces graminis var. tritici (strain R3-111a-1) GN=GGTG_06916 PE=3 SV=1
  442 : J3PPM9_PUCT1        0.42  0.67  262  510    8  282  283   11   43  287  J3PPM9     Orotidine 5'-phosphate decarboxylase OS=Puccinia triticina (isolate 1-1 / race 1 (BBBD)) GN=PTTG_01095 PE=3 SV=1
  443 : L2F9X8_COLGN        0.42  0.62  262  514   13  277  271    9   25  277  L2F9X8     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum gloeosporioides (strain Nara gc5) GN=CGGC5_14995 PE=3 SV=1
  444 : PYRF_EMENI          0.42  0.65  265  512    9  273  274   10   36  274  P10652     Orotidine 5'-phosphate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrG PE=3 SV=2
  445 : PYRF_PARBR          0.42  0.62  265  511    9  280  280   10   42  285  Q9C131     Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis GN=URA3 PE=3 SV=1
  446 : PYRF_SOLCC          0.42  0.62  265  514    9  276  278    9   39  280  Q9HF68     Orotidine 5'-phosphate decarboxylase OS=Solorina crocea GN=PYRG PE=3 SV=1
  447 : C8AU74_LENED        0.41  0.64  262  514    6  274  278    9   35  275  C8AU74     Orotidine 5'-phosphate decarboxylase OS=Lentinula edodes GN=pyrG PE=3 SV=1
  448 : PYRF_PASFU          0.41  0.64  265  512    9  274  276   10   39  278  Q9HFV8     Orotidine 5'-phosphate decarboxylase OS=Passalora fulva GN=PYR1 PE=3 SV=1
  449 : C5G822_AJEDR        0.40  0.61  265  511    9  290  287    9   46  295  C5G822     Orotidine 5'-phosphate decarboxylase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00181 PE=3 SV=1
  450 : C5JZY0_AJEDS        0.40  0.60  265  511    9  295  292    9   51  300  C5JZY0     Orotidine 5'-phosphate decarboxylase OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_08124 PE=3 SV=1
  451 : E9E7A5_METAQ        0.40  0.62  262  512    6  271  274   11   32  273  E9E7A5     Orotidine 5'-phosphate decarboxylase OS=Metarhizium acridum (strain CQMa 102) GN=MAC_05753 PE=3 SV=1
  452 : E9EPS8_METAR        0.40  0.60  262  512    6  271  275   11   34  273  E9EPS8     Orotidine 5'-phosphate decarboxylase OS=Metarhizium anisopliae (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_01713 PE=3 SV=1
  453 : E9FAY9_METAR        0.40  0.55  264  512    8  294  293   13   51  295  E9FAY9     Orotidine 5'-phosphate decarboxylase OS=Metarhizium anisopliae (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_09438 PE=3 SV=1
  454 : Q2HZ31_9HYPO        0.38  0.58  265  513    9  279  280   12   41  282  Q2HZ31     Orotidine 5'-phosphate decarboxylase OS=Myrothecium gramineum GN=pyrG PE=3 SV=1
  455 : K2RCH2_MACPH        0.35  0.51    1  260    9  356  356   11  104  360  K2RCH2     Orotidine 5'-phosphate decarboxylase OS=Macrophomina phaseolina (strain MS6) GN=MPH_10558 PE=3 SV=1
  456 : R1GBE9_BOTPV        0.35  0.51    1  260    9  357  357   11  105  361  R1GBE9     Orotidine 5'-phosphate decarboxylase OS=Botryosphaeria parva (strain UCR-NP2) GN=UCRNP2_7798 PE=3 SV=1
  457 : E3RNL2_PYRTT        0.34  0.47    1  260    8  374  375   12  123  378  E3RNL2     Orotidine 5'-phosphate decarboxylase OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_10167 PE=3 SV=1
  458 : G3JIQ0_CORMM        0.34  0.50    1  260    9  365  361   10  105  367  G3JIQ0     Orotidine 5'-phosphate decarboxylase OS=Cordyceps militaris (strain CM01) GN=CCM_05256 PE=3 SV=1
  459 : J4ULP6_BEAB2        0.34  0.50    1  260    7  363  361   10  105  365  J4ULP6     Orotidine 5'-phosphate decarboxylase OS=Beauveria bassiana (strain ARSEF 2860) GN=BBA_05406 PE=3 SV=1
  460 : K2RYG3_MACPH        0.34  0.49    1  260    9  358  358   12  106  362  K2RYG3     Uncharacterized protein OS=Macrophomina phaseolina (strain MS6) GN=MPH_13483 PE=4 SV=1
  461 : M2SV13_COCSN        0.34  0.49    1  260    8  379  380   12  128  383  M2SV13     Orotidine 5'-phosphate decarboxylase OS=Cochliobolus sativus (strain ND90Pr / ATCC 201652) GN=COCSADRAFT_179464 PE=3 SV=1
  462 : M2TBC8_COCH5        0.34  0.49    1  260    8  379  380   12  128  383  M2TBC8     Orotidine 5'-phosphate decarboxylase OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) GN=COCHEDRAFT_1128706 PE=3 SV=1
  463 : N4X051_COCH4        0.34  0.49    1  260    8  379  380   12  128  383  N4X051     Orotidine 5'-phosphate decarboxylase OS=Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T) GN=COCC4DRAFT_147213 PE=3 SV=1
  464 : B2B1R9_PODAN        0.33  0.49    2  260   10  358  358   12  108  360  B2B1R9     Orotidine 5'-phosphate decarboxylase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) PE=3 SV=1
  465 : B2WJM0_PYRTR        0.33  0.47    1  260    8  374  375   12  123  378  B2WJM0     Orotidine 5'-phosphate decarboxylase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_10366 PE=3 SV=1
  466 : C1KGD7_9HYPO        0.33  0.48    1  260    8  364  361   11  105  366  C1KGD7     Orotidine 5'-phosphate decarboxylase OS=Epichloe festucae GN=pyrG PE=3 SV=1
  467 : K2RCH2_MACPH        0.33  0.48  275  514   23  360  343   11  109  360  K2RCH2     Orotidine 5'-phosphate decarboxylase OS=Macrophomina phaseolina (strain MS6) GN=MPH_10558 PE=3 SV=1
  468 : M2SV13_COCSN        0.33  0.48  273  511   20  380  366   12  133  383  M2SV13     Orotidine 5'-phosphate decarboxylase OS=Cochliobolus sativus (strain ND90Pr / ATCC 201652) GN=COCSADRAFT_179464 PE=3 SV=1
  469 : M2TBC8_COCH5        0.33  0.48  273  511   20  380  366   12  133  383  M2TBC8     Orotidine 5'-phosphate decarboxylase OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) GN=COCHEDRAFT_1128706 PE=3 SV=1
  470 : N4X051_COCH4        0.33  0.48  273  511   20  380  366   12  133  383  N4X051     Orotidine 5'-phosphate decarboxylase OS=Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T) GN=COCC4DRAFT_147213 PE=3 SV=1
  471 : Q0V123_PHANO        0.33  0.47    1  260    8  382  383   12  131  386  Q0V123     Orotidine 5'-phosphate decarboxylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02291 PE=3 SV=1
  472 : Q12566_EPINE        0.33  0.48    1  260    8  364  361   11  105  366  Q12566     Orotidine 5'-phosphate decarboxylase OS=Epichloe typhina x Neotyphodium lolii GN=pyr4-2 PE=3 SV=1
  473 : R7YKD0_9EURO        0.33  0.46    1  260   11  380  380   12  130  385  R7YKD0     Uncharacterized protein OS=Coniosporium apollinis CBS 100218 GN=W97_01604 PE=4 SV=1
  474 : B2WJM0_PYRTR        0.32  0.46  275  511   22  375  359   12  128  378  B2WJM0     Orotidine 5'-phosphate decarboxylase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_10366 PE=3 SV=1
  475 : C7YPL8_NECH7        0.32  0.48    1  260    8  364  366   11  115  366  C7YPL8     Orotidine 5'-phosphate decarboxylase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_99952 PE=3 SV=1
  476 : D2CPB2_9PLEO        0.32  0.46    1  260    9  381  383   12  133  387  D2CPB2     Orotidine 5'-phosphate decarboxylase OS=Phoma herbarum GN=pyrG PE=2 SV=1
  477 : E3QRA2_COLGM        0.32  0.49    1  260    8  367  369   11  118  369  E3QRA2     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_08669 PE=3 SV=1
  478 : E3RNL2_PYRTT        0.32  0.46  275  511   22  375  359   12  128  378  E3RNL2     Orotidine 5'-phosphate decarboxylase OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_10167 PE=3 SV=1
  479 : E9EBI9_METAQ        0.32  0.48    1  260    8  364  361   10  105  366  E9EBI9     Orotidine 5'-phosphate decarboxylase OS=Metarhizium acridum (strain CQMa 102) GN=MAC_07237 PE=3 SV=1
  480 : E9F9A6_METAR        0.32  0.48    1  260    8  364  361   11  105  366  E9F9A6     Orotidine 5'-phosphate decarboxylase OS=Metarhizium anisopliae (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_08855 PE=3 SV=1
  481 : F8MP45_NEUT8        0.32  0.48    1  260   14  380  371   11  115  385  F8MP45     Orotidine 5'-phosphate decarboxylase OS=Neurospora tetrasperma (strain FGSC 2508 / ATCC MYA-4615 / P0657) GN=NEUTE1DRAFT_45649 PE=3 SV=1
  482 : F9X2C8_MYCGM        0.32  0.49    3  260   15  379  369    9  115  389  F9X2C8     Orotidine 5'-phosphate decarboxylase OS=Mycosphaerella graminicola (strain CBS 115943 / IPO323) GN=MYCGRDRAFT_68326 PE=3 SV=1
  483 : G0RYJ1_CHATD        0.32  0.49    1  260   10  364  363   11  111  369  G0RYJ1     Orotidine 5'-phosphate decarboxylase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0006880 PE=3 SV=1
  484 : G4UTT8_NEUT9        0.32  0.48    1  260   14  380  371   11  115  385  G4UTT8     Orotidine 5'-phosphate decarboxylase OS=Neurospora tetrasperma (strain FGSC 2509 / P0656) GN=NEUTE2DRAFT_67643 PE=3 SV=1
  485 : H1VUH4_COLHI        0.32  0.49    1  260    8  365  367   10  116  367  H1VUH4     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum higginsianum (strain IMI 349063) GN=CH063_13461 PE=3 SV=1
  486 : I1RMG6_GIBZE        0.32  0.48    1  260    8  363  365   11  114  365  I1RMG6     Orotidine 5'-phosphate decarboxylase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FG05156.1 PE=3 SV=1
  487 : J4ULP6_BEAB2        0.32  0.47  262  511    7  364  367   12  127  365  J4ULP6     Orotidine 5'-phosphate decarboxylase OS=Beauveria bassiana (strain ARSEF 2860) GN=BBA_05406 PE=3 SV=1
  488 : K3W001_FUSPC        0.32  0.48    1  260    8  363  365   11  114  365  K3W001     Orotidine 5'-phosphate decarboxylase OS=Fusarium pseudograminearum (strain CS3096) GN=FPSE_06555 PE=3 SV=1
  489 : L2GHZ1_COLGN        0.32  0.48    1  260    8  368  370   11  119  370  L2GHZ1     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum gloeosporioides (strain Nara gc5) GN=CGGC5_2889 PE=3 SV=1
  490 : L8FLD5_GEOD2        0.32  0.50    1  260    7  354  360   11  112  357  L8FLD5     Orotidine 5'-phosphate decarboxylase OS=Geomyces destructans (strain ATCC MYA-4855 / 20631-21) GN=GMDG_00071 PE=3 SV=1
  491 : L8FLD5_GEOD2        0.32  0.50  262  512    7  356  357   12  114  357  L8FLD5     Orotidine 5'-phosphate decarboxylase OS=Geomyces destructans (strain ATCC MYA-4855 / 20631-21) GN=GMDG_00071 PE=3 SV=1
  492 : N1PYD0_MYCP1        0.32  0.49    1  260    8  363  360    9  104  372  N1PYD0     Orotidine 5'-phosphate decarboxylase OS=Mycosphaerella pini (strain NZE10 / CBS 128990) GN=DOTSEDRAFT_69232 PE=3 SV=1
  493 : N4W2V7_COLOR        0.32  0.48    1  260    8  369  371   11  120  371  N4W2V7     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=Cob_03887 PE=3 SV=1
  494 : Q0V123_PHANO        0.32  0.47  262  514    8  386  384   13  137  386  Q0V123     Orotidine 5'-phosphate decarboxylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02291 PE=3 SV=1
  495 : Q12565_EPINE        0.32  0.47    1  260    8  365  367   12  116  367  Q12565     Orotidine 5'-phosphate decarboxylase OS=Epichloe typhina x Neotyphodium lolii GN=pyr4-1 PE=3 SV=1
  496 : R0JWG5_SETT2        0.32  0.48    1  260    8  376  377   12  125  380  R0JWG5     Orotidine 5'-phosphate decarboxylase OS=Setosphaeria turcica (strain 28A) GN=SETTUDRAFT_163968 PE=3 SV=1
  497 : R1GBE9_BOTPV        0.32  0.49  280  514   28  361  339   10  110  361  R1GBE9     Orotidine 5'-phosphate decarboxylase OS=Botryosphaeria parva (strain UCR-NP2) GN=UCRNP2_7798 PE=3 SV=1
  498 : R8BAE0_TOGMI        0.32  0.49    1  260    9  367  363   11  107  369  R8BAE0     Putative orotidine 5-phosphate decarboxylase protein OS=Togninia minima (strain UCR-PA7) GN=UCRPA7_8226 PE=4 SV=1
  499 : B2B1R9_PODAN        0.31  0.47  263  510   10  358  358   10  120  360  B2B1R9     Orotidine 5'-phosphate decarboxylase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) PE=3 SV=1
  500 : C1KGD7_9HYPO        0.31  0.47  262  511    8  365  363   10  119  366  C1KGD7     Orotidine 5'-phosphate decarboxylase OS=Epichloe festucae GN=pyrG PE=3 SV=1
  501 : D2CPB2_9PLEO        0.31  0.45  262  512    9  383  382   13  139  387  D2CPB2     Orotidine 5'-phosphate decarboxylase OS=Phoma herbarum GN=pyrG PE=2 SV=1
  502 : E5A7A6_LEPMJ        0.31  0.46    1  260  223  608  394   12  142  614  E5A7A6     Orotidine 5'-phosphate decarboxylase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LEMA_P087400.1 PE=3 SV=1
  503 : F9FF90_FUSOF        0.31  0.49    1  260    8  364  366   11  115 1061  F9FF90     Orotidine 5'-phosphate decarboxylase OS=Fusarium oxysporum (strain Fo5176) GN=FOXB_05069 PE=3 SV=1
  504 : G0R8C8_HYPJQ        0.31  0.46    1  260    8  378  380   12  129  381  G0R8C8     Orotidine 5'-phosphate decarboxylase OS=Hypocrea jecorina (strain QM6a) GN=TRIREDRAFT_74020 PE=3 SV=1
  505 : G0RYJ1_CHATD        0.31  0.48  262  514   10  368  363    9  115  369  G0RYJ1     Orotidine 5'-phosphate decarboxylase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0006880 PE=3 SV=1
  506 : G3JIQ0_CORMM        0.31  0.47  262  511    9  366  367   12  127  367  G3JIQ0     Orotidine 5'-phosphate decarboxylase OS=Cordyceps militaris (strain CM01) GN=CCM_05256 PE=3 SV=1
  507 : G9MME7_HYPVG        0.31  0.47    1  260    8  379  377   11  122  382  G9MME7     Orotidine 5'-phosphate decarboxylase OS=Hypocrea virens (strain Gv29-8 / FGSC 10586) GN=TRIVIDRAFT_178135 PE=3 SV=1
  508 : K1Y3P9_MARBU        0.31  0.49    1  260   11  367  369   12  121  370  K1Y3P9     Orotidine 5'-phosphate decarboxylase OS=Marssonina brunnea f. sp. multigermtubi (strain MB_m1) GN=MBM_01766 PE=3 SV=1
  509 : K2RYG3_MACPH        0.31  0.47  275  513   23  361  345   11  113  362  K2RYG3     Uncharacterized protein OS=Macrophomina phaseolina (strain MS6) GN=MPH_13483 PE=4 SV=1
  510 : M1W3T6_CLAP2        0.31  0.47    1  260    8  366  368   12  117  368  M1W3T6     Orotidine 5'-phosphate decarboxylase OS=Claviceps purpurea (strain 20.1) GN=CPUR_06934 PE=3 SV=1
  511 : M3DBG6_MYCPS        0.31  0.47    9  260   22  379  366    8  122  388  M3DBG6     Orotidine 5'-phosphate decarboxylase OS=Mycosphaerella populorum (strain SO2202) GN=SEPMUDRAFT_147295 PE=3 SV=1
  512 : N1JH16_BLUG1        0.31  0.48    1  260   11  370  371   11  122  374  N1JH16     Orotidine 5'-phosphate decarboxylase OS=Blumeria graminis f. sp. hordei (strain DH14) GN=BGHDH14_bgh01165 PE=3 SV=1
  513 : N1RSQ8_FUSC4        0.31  0.49    1  260    8  364  366   11  115  366  N1RSQ8     Orotidine 5'-phosphate decarboxylase OS=Fusarium oxysporum f. sp. cubense (strain race 4) GN=FOC4_g10012832 PE=3 SV=1
  514 : N4UAV6_FUSC1        0.31  0.49    1  260    8  364  366   11  115  366  N4UAV6     Orotidine 5'-phosphate decarboxylase OS=Fusarium oxysporum f. sp. cubense (strain race 1) GN=FOC1_g10014298 PE=3 SV=1
  515 : PYRF_HYPAT          0.31  0.47    1  260    8  376  373   11  117  379  Q12709     Orotidine 5'-phosphate decarboxylase OS=Hypocrea atroviridis GN=pyr4 PE=3 SV=1
  516 : PYRF_NEUCR          0.31  0.46    1  260   14  392  383   11  127  397  P05035     Orotidine 5'-phosphate decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-4 PE=3 SV=1
  517 : PYRF_SORMK          0.31  0.46    1  260   12  391  384   11  128  396  P78748     Orotidine 5'-phosphate decarboxylase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=URA3 PE=3 SV=2
  518 : Q12566_EPINE        0.31  0.47  262  511    8  365  363   10  119  366  Q12566     Orotidine 5'-phosphate decarboxylase OS=Epichloe typhina x Neotyphodium lolii GN=pyr4-2 PE=3 SV=1
  519 : R0JWG5_SETT2        0.31  0.48  262  513    8  379  377   13  131  380  R0JWG5     Orotidine 5'-phosphate decarboxylase OS=Setosphaeria turcica (strain 28A) GN=SETTUDRAFT_163968 PE=3 SV=1
  520 : R7YKD0_9EURO        0.31  0.45  262  512   11  382  379   13  136  385  R7YKD0     Uncharacterized protein OS=Coniosporium apollinis CBS 100218 GN=W97_01604 PE=4 SV=1
  521 : S0E0L4_GIBFU        0.31  0.48    1  260    8  364  366   11  115  366  S0E0L4     Probable orotidine-5`-phosphate decarboxylase Pyr-4 OS=Fusarium fujikuroi IMI 58289 GN=FFUJ_13391 PE=4 SV=1
  522 : A7E4B8_SCLS1        0.30  0.48    1  260   11  376  369    9  112  379  A7E4B8     Orotidine 5'-phosphate decarboxylase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_00140 PE=3 SV=1
  523 : C7YPL8_NECH7        0.30  0.46  262  511    8  365  367   10  127  366  C7YPL8     Orotidine 5'-phosphate decarboxylase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_99952 PE=3 SV=1
  524 : E3QRA2_COLGM        0.30  0.48  262  512    8  369  371   11  130  369  E3QRA2     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_08669 PE=3 SV=1
  525 : E5A7A6_LEPMJ        0.30  0.45  262  513  223  611  394   13  148  614  E5A7A6     Orotidine 5'-phosphate decarboxylase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LEMA_P087400.1 PE=3 SV=1
  526 : F8MP45_NEUT8        0.30  0.46  262  510   14  380  371   10  127  385  F8MP45     Orotidine 5'-phosphate decarboxylase OS=Neurospora tetrasperma (strain FGSC 2508 / ATCC MYA-4615 / P0657) GN=NEUTE1DRAFT_45649 PE=3 SV=1
  527 : F9FF90_FUSOF        0.30  0.48  262  514    8  368  370   10  127 1061  F9FF90     Orotidine 5'-phosphate decarboxylase OS=Fusarium oxysporum (strain Fo5176) GN=FOXB_05069 PE=3 SV=1
  528 : F9X2C8_MYCGM        0.30  0.45  264  511   15  380  371   11  129  389  F9X2C8     Orotidine 5'-phosphate decarboxylase OS=Mycosphaerella graminicola (strain CBS 115943 / IPO323) GN=MYCGRDRAFT_68326 PE=3 SV=1
  529 : G2XAB0_VERDV        0.30  0.47    1  260    8  363  365   11  114  367  G2XAB0     Orotidine 5'-phosphate decarboxylase OS=Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) GN=VDAG_07013 PE=3 SV=1
  530 : G2YI50_BOTF4        0.30  0.47    1  260   11  376  375    9  124  379  G2YI50     Orotidine 5'-phosphate decarboxylase OS=Botryotinia fuckeliana (strain T4) GN=BofuT4_P016930.1 PE=3 SV=1
  531 : G4NH74_MAGO7        0.30  0.47    1  260   10  386  381   10  125  389  G4NH74     Orotidine 5'-phosphate decarboxylase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_12098 PE=3 SV=1
  532 : G4UTT8_NEUT9        0.30  0.46  262  510   14  380  371   10  127  385  G4UTT8     Orotidine 5'-phosphate decarboxylase OS=Neurospora tetrasperma (strain FGSC 2509 / P0656) GN=NEUTE2DRAFT_67643 PE=3 SV=1
  533 : G9NJ88_HYPAI        0.30  0.47    1  260    8  376  378   12  127  379  G9NJ88     Orotidine 5'-phosphate decarboxylase OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=TRIATDRAFT_297716 PE=3 SV=1
  534 : H1VUH4_COLHI        0.30  0.47  262  512    8  367  369   11  128  367  H1VUH4     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum higginsianum (strain IMI 349063) GN=CH063_13461 PE=3 SV=1
  535 : I1RMG6_GIBZE        0.30  0.47  262  511    8  364  366   10  126  365  I1RMG6     Orotidine 5'-phosphate decarboxylase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FG05156.1 PE=3 SV=1
  536 : K1Y3P9_MARBU        0.30  0.48  262  512   11  369  368   10  127  370  K1Y3P9     Orotidine 5'-phosphate decarboxylase OS=Marssonina brunnea f. sp. multigermtubi (strain MB_m1) GN=MBM_01766 PE=3 SV=1
  537 : K3W001_FUSPC        0.30  0.47  262  511    8  364  365   10  124  365  K3W001     Orotidine 5'-phosphate decarboxylase OS=Fusarium pseudograminearum (strain CS3096) GN=FPSE_06555 PE=3 SV=1
  538 : L2GHZ1_COLGN        0.30  0.47  262  512    8  370  372   11  131  370  L2GHZ1     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum gloeosporioides (strain Nara gc5) GN=CGGC5_2889 PE=3 SV=1
  539 : L7I954_MAGOY        0.30  0.47    1  260   10  386  381   10  125 1439  L7I954     Orotidine 5'-phosphate decarboxylase OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00487g89 PE=3 SV=1
  540 : L7JIH2_MAGOP        0.30  0.47    1  260   10  386  381   10  125 1412  L7JIH2     Orotidine 5'-phosphate decarboxylase OS=Magnaporthe oryzae (strain P131) GN=OOW_P131scaffold00303g8 PE=3 SV=1
  541 : M7TNA8_BOTF1        0.30  0.47    1  260   11  376  375    9  124  379  M7TNA8     Orotidine 5'-phosphate decarboxylase OS=Botryotinia fuckeliana (strain BcDW1) GN=BcDW1_8743 PE=3 SV=1
  542 : N1JH16_BLUG1        0.30  0.47  262  512   11  372  371   10  130  374  N1JH16     Orotidine 5'-phosphate decarboxylase OS=Blumeria graminis f. sp. hordei (strain DH14) GN=BGHDH14_bgh01165 PE=3 SV=1
  543 : N1PYD0_MYCP1        0.30  0.46  262  510    8  363  361   11  118  372  N1PYD0     Orotidine 5'-phosphate decarboxylase OS=Mycosphaerella pini (strain NZE10 / CBS 128990) GN=DOTSEDRAFT_69232 PE=3 SV=1
  544 : N4W2V7_COLOR        0.30  0.47  262  512    8  371  373   11  132  371  N4W2V7     Orotidine 5'-phosphate decarboxylase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=Cob_03887 PE=3 SV=1
  545 : PYRF_ACRCH          0.30  0.47    1  260    8  374  375   11  123  376  P14017     Orotidine 5'-phosphate decarboxylase OS=Acremonium chrysogenum GN=PYR4 PE=3 SV=1
  546 : PYRF_HYPJE          0.30  0.46    1  260    8  378  380   11  129  381  P21594     Orotidine 5'-phosphate decarboxylase OS=Hypocrea jecorina GN=ura3 PE=3 SV=1
  547 : Q12565_EPINE        0.30  0.46  262  511    8  366  367    9  126  367  Q12565     Orotidine 5'-phosphate decarboxylase OS=Epichloe typhina x Neotyphodium lolii GN=pyr4-1 PE=3 SV=1
  548 : R8BAE0_TOGMI        0.30  0.47  262  511    9  368  364   10  119  369  R8BAE0     Putative orotidine 5-phosphate decarboxylase protein OS=Togninia minima (strain UCR-PA7) GN=UCRPA7_8226 PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    3 A K              0   0   88  128   55  KKKKKKKKKKKKKKKKK Q             N    N                S               
     2    4 A A        -     0   0   48  149   71  AAAAAAAAAAAAAAAAA A             A    A         A AA   A       AAP     
     3    5 A T     >  -     0   0   57  246   38  TTTTTTTTTTTTTTTTT T             T    T    TTTT TTTTS SSS TT  TTTS     
     4    6 A Y  H  > S+     0   0    0  278    1  YYYYYYYYYYYYYYYYY Y             Y    Y    YYYYYYYYYYYYYY YY  YYYY     
     5    7 A K  H  > S+     0   0  120  278   72  KKKKKKKKKKKKKKKKK K             K    K    TQQQTQEQHSLSLS ET  AEEE     
     6    8 A E  H  > S+     0   0  109  278   63  EEEEEEEEEEEEEEEEE E             Q    E    QEEESEEEDEEEQE QE  EEES     
     7    9 A R  H >X S+     0   0    6  278    0  RRRRRRRRRRRRRRRRR R             R    R    RRRRRRRRRRRRRR RR  RRRR     
     8   10 A A  H 3< S+     0   0    7  278   23  AAAAAAAAAAAAAAAAA A             A    A    AAAAAAAAAAAAAA AA  AAAA     
     9   11 A A  H 3< S+     0   0   88  279   72  AAAAAAAAAAAAAAAAA A             A    A    AAAAEAKAAAEAEA KK  ASSE     
    10   12 A T  H << S+     0   0  114  278   80  TTTTTTTTTTTTTTTTT T             T    A    SRRRTKNKKARAAA TA  VVVT     
    11   13 A H     <  -     0   0   22  279   56  HHHHHHHHHHHHHHHHH H             H    H    HHHHHHHHHHHHHH HH  HHHH     
    12   14 A P  S    S+     0   0   62  280   63  PPPPPPPPPPPPPPPPP P             P    P    PPPPAPAPARARPR PP  GAAP     
    13   15 A S     >  -     0   0    1  281   63  SSSSSSSSSSSSSSSSS S             S    S    SSSSSSSSSSSSSS NS  SSSN     
    14   16 A P  H  > S+     0   0   79  281   27  PPPPPPPPPPPPPPPPP P             P    P    PPPPPPPPPPPPPP KA  APPA     
    15   17 A V  H  > S+     0   0    0  283   52  VVVVVVVVVVVVVVVVV V             V    V    LVVVVVVVLVVVVV VV  VVVV     
    16   18 A A  H  > S+     0   0    0  283   37  AAAAAAAAAAAAAAAAA A             A    A    AAAAAAAAAAAAAA AA  AAAA     
    17   19 A A  H  X S+     0   0   18  283   69  AAAAAAAAAAAAAAAAA A             A    A    STTSSSSSSAAASA SS  ASSS     
    18   20 A K  H  X S+     0   0   72  283   81  KKKKKKKKKKKKKKKKK R             K    K    KRRRKKKKKKKKKK KK  KKKK     
    19   21 A L  H  X S+     0   0    0  283    2  LLLLLLLLLLLLLLLLL L             L    L    LLLLLLLLLLLLLL LL  LLLL     
    20   22 A F  H  X S+     0   0    0  283   14  FFFFFFFFFFFFFFFFF F             F    L    FLLLLLLLLLLLLL LL  LLLL     
    21   23 A N  H  X S+     0   0   58  283   71  NNNNNNNNNNNNNNNNN N             N    N    NNNNRNTNENKNKN NN  RRRR     
    22   24 A I  H  X S+     0   0    3  283   39  IIIIIIIIIIIIIIIII I             I    I    ILLLLLILLLLLLL LI  LIIL     
    23   25 A M  H  X>S+     0   0    0  284   48  MMMMMMMMMMMMMMMMMMM             M    M    MMMMMMMMMMMMMM MM  MMMM     
    24   26 A H  H ><5S+     0   0   74  284   50  HHHHHHHHHHHHHHHHHHH             H    H    EHHHDHFHHEHEHE AE  EAAA     
    25   27 A E  H 3<5S+     0   0  127  284   87  EEEEEEEEEEEEEEEEEEE             E    E    AEEEEEEEEEEEEE ES  ESSE     
    26   28 A K  H 3<5S-     0   0   39  284    0  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  KKKK     
    27   29 A Q  T <<5 +     0   0  110  284   53  QQQQQQQQQQQQQQQQQQQ             Q    Q    KQQQKKQKQKKKKK KK  QKKK     
    28   30 A T      < +     0   0    0  284   41  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTSTSTS TT  TTTT     
    29   31 A N        +     0   0    0  284    0  NNNNNNNNNNNNNNNNNNN             N    N    NNNNNNNNNNNNNN NN  NNNN     
    30   32 A L  E     -a  229   0A   0  284   14  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
    31   33 A C  E     -ab 230  55A   0  284   42  CCCCCCCCCCCCCCCCCCC             C    C    CCCCCCCCCCCCCC SC  CCCC     
    32   34 A A  E     -ab 231  56A   0  283   58  AAAAAAAAAAAAAXAAAAA             A    A    AAAAAAAAAAAAAA GA  AAAA     
    33   35 A S  E     - b   0  57A  15  284    9  SSSSSSSSSSSSSSSSSSS             S    S    SSSSSSSSSSSSSS SS  SSSS     
    34   36 A L        +     0   0    3  284   60  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LI  LLLL     
    35   37 A D        +     0   0   42  284    0  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
    36   38 A V        -     0   0    8  284    9  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
    37   39 A R  S    S+     0   0  162  284   66  RRRRRRRRRRRHRRRRRRR             R    H    RNNNRNRNDRHRTR RR  RRRH     
    38   40 A T     >  -     0   0   42  284   42  TTTTTTTTTTTTTTTTTTT             T    T    TTTTSTTTTKTKTK TT  TTTS     
    39   41 A T  H  > S+     0   0    4  284   55  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
    40   42 A K  H  > S+     0   0  115  284   69  KKKKKKKKKKNKKKKKKKK             K    K    EAAADEEETAKASA KQ  AAAK     
    41   43 A E  H  > S+     0   0   74  284   28  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEEEE EE  EEEE     
    42   44 A L  H  X S+     0   0    4  284   11  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
    43   45 A L  H  X S+     0   0   40  284    4  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
    44   46 A E  H  X S+     0   0  112  284   81  EEEEEEEEEEEEEEEEEEE             E    E    RHHHKKRKRRDRKR RD  ASSE     
    45   47 A L  H  X S+     0   0   19  284   26  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LI  ILLL     
    46   48 A V  H  X S+     0   0    0  283   55  VVVVVVVVVVVVVVVVVVV             V    V    VLLLVVVVVVVVVV AV  AVVA     
    47   49 A E  H  < S+     0   0   79  284   22  EEEEEEEEEEEEEEEEEEE             E    E    EDDDEDDDDEQEDE DS  EDDD     
    48   50 A A  H  < S+     0   0   24  284   75  AAAAAAAAAAAAAAAAAAA             A    A    TVVVTTITIVVVTV IK  QQQK     
    49   51 A L  H >X S+     0   0    0  282   33  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LI  VVVL     
    50   52 A G  G >< S+     0   0    0  282    3  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
    51   53 A P  G 34 S+     0   0   50  284   18  PPPPPPPPPPPPPPPPPPP             P    P    PPPPPPPPPPPPPP PP  PPPP     
    52   54 A K  G <4 S+     0   0   45  284   77  KKKKKKKKKKKKKKKKKKK             K    K    YHHHYYYYYYHYYY YN  HYYY     
    53   55 A I    <<  -     0   0    0  284   14  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
    54   56 A C  S    S+     0   0    1  283   49  CCCCCCCCCCCCCCCCCCC             C    C    CCCCCCCCCCCCCC CC  CCCC     
    55   57 A L  E     -bc  31  85A   0  283   32  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL VL  LLLL     
    56   58 A L  E     -bc  32  86A   1  283   30  LLLLLLLLLLLLLLLLLLL             L    L    LVVVLLLLVLLLLL LL  LLLV     
    57   59 A K  E     -bc  33  87A  20  283    2  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  KKKK     
    58   60 A T  E     - c   0  88A   2  281    3  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
    59   61 A H    >>  +     0   0   18  281    2  HHHHHHHHHHHHHHHHHHH             H    H    HHHHHHHHHHHHHH HH  HHHH     
    60   62 A V  G >4  +     0   0    2  283   49  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVIVIVVVVVV VV  VVVV     
    61   63 A D  G 34 S+     0   0   18  283    2  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
    62   64 A I  G <4 S+     0   0   15  283   18  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
    63   65 A L    <<  -     0   0   15  284   28  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLILILLLLLL LL  LLLL     
    64   66 A T  S    S+     0   0   99  284   65  TTTTTTTTTTTTTTTTTTT             T    T    TSSSDSSSSEDESE DE  EDDD     
    65   67 A D  S    S+     0   0   33  284    1  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
    66   68 A F        +     0   0   29  284    6  FFFFFFFFFFFFFFFFFFF             F    F    FFFFFFFFFFFFFF FF  FFFF     
    67   69 A S     >> -     0   0   39  279   61  SSSSSSSSSSSSSSSSSSS             S    S    SSSSSSSSSSSSSS SS  SSST     
    68   70 A M  I  4>S+     0   0   38  283   97  MMMMMMMMMMMMMMMMMMM             I    M    MIIIYIMIMFMFFF YM  MMMI     
    69   71 A E  I  45S+     0   0  109  157   60  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEDEDDEEEEE EE  EEEE     
    70   72 A G  I  45S+     0   0   16  283   60  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGNGNNN GG  GGGG     
    71   73 A T  I  X5S+     0   0    2  283   43  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
    72   74 A V  I  > S+     0   0   37  284   73  PPPPPPPPPPPPPPPPPPP             P    P    PPPPPPPPPPPPPP PP  PPPP     
    75   77 A L  H  X S+     0   0    2  284    1  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
    76   78 A K  H  X S+     0   0   64  283   80  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  KKKK     
    77   79 A A  H  X S+     0   0   60  284   64  AAAAAAAAAAAAAAAAAEE             E    Q    EEEEAEQEEQEQEQ EE  KEEA     
    78   80 A L  H  X S+     0   0   14  284   11  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLMLLLLLML LM  LLLL     
    79   81 A S  H  X>S+     0   0   14  284   35  SSSSSSSSSSSSSSSSSSS             S    S    AAAAAAAAAAAAAA AS  AAAA     
    80   82 A A  H  <5S+     0   0   81  284   70  AAAAAAAAAAAAAAAAAAA             A    A    KAAAEKLKAEKEAE AK  AAAE     
    81   83 A K  H  <5S+     0   0  142  284   20  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  RKKK     
    82   84 A Y  H  <5S-     0   0   52  284   36  YYYYYYYYYYYYYYYYYHH             H    H    FHHHYHYHHHFHHH HF  HYYH     
    83   85 A N  T  <5 +     0   0   64  284   57  NNNNNNNNNNNNNNNNNNN             N    N    NNNKKNNNKKNKNK KN  GNNK     
    84   86 A F      < -     0   0    3  284    0  FFFFFFFFFFFFFFFFFFF             F    F    FFFFFFFFFFFFFF FF  FFFF     
    85   87 A L  E     -c   55   0A   8  284   10  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLMLMLLMLLL LL  LLLL     
    86   88 A L  E     -c   56   0A   0  284   12  LLLLLLLLLLLLLLLLLLL             L    L    IIIIIIIIIIIIII II  IIII     
    87   89 A F  E     -cd  57 116A   0  284    0  FFFFFFFFFFFFFFFFFFF             F    F    FFFFFFFFFFFFFF FF  FFFF     
    88   90 A E  E     -c   58   0A   0  284    0  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEEEE EE  EEEE     
    89   91 A N  E     +     0   0A   4  284    0  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
    90   92 A R  E     -     0   0A  40  284    0  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RR  RRRR     
    91   93 A K  E     - d   0 118A  36  284    0  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  KKKK     
    92   94 A F  E     + d   0 119A   4  284    0  FFFFFFFFFFFFFFFFFFF             F    F    FFFFFFFFFFFFFF FF  FFFF     
    93   95 A A        +     0   0    6  283   47  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
    94   96 A D        -     0   0   13  283    0  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
    95   97 A I    >>  +     0   0   57  283    1  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
    96   98 A G  H 3> S-     0   0   37  283    0  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
    97   99 A N  H 3> S+     0   0  113  283   28  NNNNNNNNNNNNNNNNNNN             N    N    NNNNNNNNNNNNNN NN  NNNN     
    98  100 A T  H <> S+     0   0   17  283    1  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
    99  101 A V  H  X S+     0   0    0  283    3  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   100  102 A K  H  X S+     0   0   21  283   59  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  KKKK     
   101  103 A L  H  X S+     0   0   63  283   75  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   102  104 A Q  H  < S+     0   0   28  283    0  QQQQQQQQQQQQQQQQQQQ             Q    Q    QQQQQQQQQQQQQQ QQ  QQQQ     
   103  105 A Y  H  < S+     0   0    0  284    0  YYYYYYYYYYYYYYYYYYY             Y    Y    YYYYYYYYYYYYYY YY  YYYY     
   104  106 A S  H  < S+     0   0   26  284   77  SSSSSSSSSSSSSSSSSSS             S    S    SKKKTSASSTSTTT ST  SSSS     
   105  107 A A     X  +     0   0   38  284   52  AAAAAAAAAAAAAAAAAAA             A    S    SSSSSSSSSSSSSS SS  SSSS     
   106  108 A G  T  4 S-     0   0   47  284    0  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   107  109 A V  T  4 S+     0   0   67  284   67  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   108  110 A Y  T  4 S-     0   0   37  284   72  YYYYYYYYYYYYYYYYYYY             Y    Y    YYYYYYYYYYYYYY YY  YYYY     
   109  111 A R    ><  -     0   0   93  284   34  RRRRRRRRRRRRRRRRRRK             R    R    RQQQRRKRQRKRKR KK  RKKK     
   110  112 A I  G >> S+     0   0    1  284    2  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
   111  113 A A  G 34 S+     0   0    0  284   58  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAASAAAAA VV  VVVV     
   112  114 A E  G <4 S+     0   0   71  284   59  EEEEEEEEEEEEEEEEEEE             E    E    EQQQEEEEQEQEEE EE  EQQE     
   113  115 A W  T <4 S+     0   0    2  284    0  WWWWWWWWWWWWWWWWWWW             W    W    WWWWWWWWWWWWWW WW  WWWW     
   114  116 A A     <  -     0   0    0  284   29  AAAAAAAAAAAAAAAAAAA             A    A    AAAASAAAASASAS AA  AAAA     
   115  117 A D  S    S+     0   0   10  284   44  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
   116  118 A I  E     +de  87 144A   0  284    8  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
   117  119 A T  E     - e   0 145A   0  284   42  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
   118  120 A N  E     -de  91 146A   0  284    3  NNNNNNNNNNNNNNNNNNN             N    N    NNNNNNNNNNNNNN NN  NNNN     
   119  121 A A  E     -de  92 147A   0  284   46  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
   120  122 A H        -     0   0    0  284   53  HHHHHHHHHHHHHHHHHHH             H    H    HHHHHHHHHHHHHH HH  HHHH     
   121  123 A G  S >  S+     0   0    0  283   80  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   122  124 A V  T 3  S+     0   0    0  284   33  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVIVVVVVVV VV  VVVV     
   123  125 A V  T 3  S-     0   0    4  284   51  VVVVVVVVVVVVVVVVVVV             V    V    TTTTTTTTTTTTTT TT  TTTT     
   124  126 A G    X   -     0   0    0  284    1  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   125  127 A P  T >> S+     0   0   44  284   67  PPPPPPPPPPPPPPPPPPP             P    P    PPPPAAPAPAPAQA SE  PSSA     
   126  128 A G  H 3> S+     0   0   25  284   30  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   127  129 A I  H <> S+     0   0    0  284   36  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
   128  130 A V  H <> S+     0   0    2  284   13  VVVVVVVVVVVVVVVVVVV             V    V    IVVVVVVVVVVVVV VV  VVVV     
   129  131 A S  H  X S+     0   0   71  284   73  SSSSSSSSSSSSSSSSSSS             S    S    AQQQATATQAQATA AK  RKKA     
   130  132 A G  H  X S+     0   0    7  284   35  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   131  133 A L  H  X S+     0   0    0  284    1  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   132  134 A K  H  X S+     0   0   50  284   66  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  KKKK     
   133  135 A Q  H  X S+     0   0   93  284   56  QQQQQQQQQQQQQQQQQQQ             Q    E    EQQQQQEQQQQQQQ AE  QEEQ     
   134  136 A A  H  X S+     0   0    0  284   57  AAAAAAAAAAAAAAAAAAA             A    A    AAAAGAAAAGAGGG AG  AAAA     
   135  137 A A  H  X S+     0   0    6  284   28  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
   136  138 A E  H  < S+     0   0  132  284   84  EEEEEEEEEEEEEEEEEEE             E    E    SQQQQQMQEEQEEE EK  EQQE     
   137  139 A E  H  < S+     0   0  129  222   34  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEEEE EE  EEEE     
   138  140 A V  H  < S+     0   0   49  284   90  VVVVVVVVVVVVVVVVVVV             V    A    VTTTVTVTTVTVTV CN  nNNS     
   139  141 A T     <  -     0   0   33  208   67  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTSTTTTTTT TT  gSST     
   140  142 A K  S    S+     0   0  181  232   87  KKKKKKKKKKKKKKKKKKK             K    K    KQQQKNNNQKQKNK KE  DDDK     
   141  143 A E  S    S-     0   0   78  236   37  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEEEE EE  AEEE     
   142  144 A P        -     0   0   37  195   61  PPPPPPPPPPPPPPPPPPP             P    P    PPPPPPPPPPPPPP PP  PPPP     
   143  145 A R        -     0   0   15  282   12  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RR  RRRR     
   144  146 A G  E     -e  116   0A   0  284   15  GGGGGGGGGGGGGGGGGGG             A    A    GGGGGGGGGGGGGG AG  GGGA     
   145  147 A L  E     -ef 117 177A   0  284    4  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   146  148 A L  E     -ef 118 179A   0  284    8  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   147  149 A M  E     -ef 119 180A   0  284   38  MMMMMMMMMMMMMMMMMMM             M    M    MMMMMMMMMMMMMM MM  MMMM     
   148  150 A L  E     + f   0 181A   3  284    1  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   149  151 A A        +     0   0    0  284    7  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
   150  152 A E  S    S-     0   0   27  283   23  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEEEE EE  EEEE     
   151  153 A L        -     0   0   23  283    7  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   152  154 A S        +     0   0   75  283   27  SSSSSSSSSSSSSSSSSSS             S    S    SSSSSSSSSSSSSS SS  SSSS     
   153  155 A C  S >  S-     0   0   28  284   20  CCCCCCCCCCCCCCCCCCC             C    C    SSSSSSSSSSCSSS SS  SSSS     
   154  156 A K  T 3  S+     0   0  188  284   47  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  VKKK     
   155  157 A G  T 3  S+     0   0   44  283    1  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   156  158 A S    <   -     0   0   36  284   53  SSSSSSSSSSSSSSSSSSS             S    S    SSSSSSSSSSASSS SS  SSSS     
   157  159 A L        +     0   0   20  284   10  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   158  160 A A        +     0   0   18  284   49  AAAAAAAAAAAAAASSSAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
   159  161 A T     >  -     0   0   66  284   73  TTTTTTTTTTTTTTTTTTT             T    T    HHHHHHHHHHYHHH HH  HHHH     
   160  162 A G  H  > S+     0   0   48  284   37  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   161  163 A E  H  > S+     0   0  123  284   48  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEEEE EE  EEEA     
   162  164 A Y  H  > S+     0   0    9  283    0  YYYYYYYYYYYYXYYYYYY             Y    Y    YYYYYYYYYYYYYY YY  YYYY     
   163  165 A T  H  X S+     0   0    3  284   16  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
   164  166 A K  H  X S+     0   0  112  284   70  KKKKKKKKKKKKKKKKKKK             K    K    RTTTKQRQKRKRKR RA  QTTE     
   165  167 A G  H  X S+     0   0   13  284   74  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   166  168 A T  H  X S+     0   0    0  284   59  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
   167  169 A V  H  X S+     0   0   15  284   12  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   168  170 A D  H  X S+     0   0   84  284   43  DDDDDDDDDDDDDDDDDDD             E    N    EDDDDEEEEEDEDE DN  EEEG     
   169  171 A I  H >< S+     0   0    9  284   69  IIIIIIIIIIIIIIIIIII             I    I    MIIIIIIIIIIIII II  IIII     
   170  172 A A  H >< S+     0   0    0  283    1  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
   171  173 A K  H 3< S+     0   0   51  284   31  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKQKKKKKKK KK  KKKR     
   172  174 A S  T << S+     0   0   75  283   74  SSSSSSSSSSSSSSSSSGR             G    S    ISSSSTTTTSSSSS SS  STTT     
   173  175 A D    <>  +     0   0   26  284   68  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
   174  176 A K  T  4 S+     0   0   75  284   44  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  RKKK     
   175  177 A D  T  4 S+     0   0   90  284   44  DDDDDDDDDDDDDDDDDDD             D    D    EEEEDDEDDDDDDD DE  EQQE     
   176  178 A F  T  4 S+     0   0    8  284    5  FFFFFFFFFFFFFFFFFFF             F    F    FFFFFFFFFFFFFF FF  FFFF     
   177  179 A V  E  <  +f  145   0A   1  284    4  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   178  180 A I  E     -     0   0A   0  283   40  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIFIIIIIII II  IFFI     
   179  181 A G  E     -fg 146 196A   0  284    0  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   180  182 A F  E     -fg 147 197A   0  284    0  FFFFFFFFFFFFFFFFFFF             F    F    FFFFFFFFFFFFFF FF  FFFF     
   181  183 A I  E     +fg 148 198A  10  283   12  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
   182  184 A A        -     0   0    0  283   33  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA SA  AAAS     
   183  185 A Q  S    S+     0   0   34  284   49  QQQQQQQQQQQQQQQQQQQ             Q    Q    QQQQQQQQQQQQQQ QQ  QQQQ     
   184  186 A R  S    S-     0   0  108  284   68  RRRRRRRRRRRRRRRRRRR             K    K    RRRRNRRRRNNNKN KR  RRRK     
   185  187 A D        -     0   0   38  204   79  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DGGD     
   186  188 A M        -     0   0   22  215   84  MMMMMMMMMMMMMMMMMMM             M    M    MMMMMMMMMMMMMM MM  MMMM     
   187  189 A G        +     0   0   24  220   62  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   188  190 A G    > > +     0   0   12  245   65  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   189  191 A R  G > 5S+     0   0  123  260   82  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR KR  RRRR     
   190  192 A D  G 3 5S+     0   0  175  284   41  DDDDDDDDDDDDDDDDDDD             E    D    DDDDEETEDEDEDE DE  EDDD     
   191  193 A E  G < 5S-     0   0  111  284   28  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEDEE EE  EEEE     
   192  194 A G  T < 5S+     0   0   49  284   45  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   193  195 A Y      < -     0   0   42  284   24  YYYYYYYYYYYYYYYYYYY             Y    Y    FYYYFYFFYYFYFY FY  FFFF     
   194  196 A D        -     0   0   38  116    1  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
   195  197 A W        -     0   0   12  124    7  WWWWWWWWWWWWWWWWWWW             W    W    WWWWWWWWWWWWWW WW  WWWW     
   196  198 A L  E     -g  179   0A   0  284   28  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   197  199 A I  E     -g  180   0A   1  284   59  IIIIIIIIIIIIIIIIIII             I    I    IIIVIIIIIIVIII II  IIII     
   198  200 A M  E     -gh 181 228A   0  284   23  MMMMMMMMMMMMMMMMMMM             M    M    MMMMMMMMMMMMMM MM  MMMM     
   199  201 A T  E     - h   0 229A   0  284   11  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTT     
   200  202 A P        +     0   0   31  284   27  PPPPPPPPPPPPPPPPPPP             P    P    PPPPPPPPPPPPPP PP  PPPP     
   201  203 A G  S    S+     0   0   33  284    0  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   202  204 A V  E     +i  216   0B   8  284   31  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   203  205 A G  E     -i  217   0B   3  283   56  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   204  206 A L        -     0   0   35  283    8  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   205  207 A D        -     0   0   97  283   62  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDEDDDDD DD  DDDD     
   206  208 A D    >   -     0   0   41  283   76  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
   207  209 A K  T 3  S+     0   0  216  283   49  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK KK  KKKK     
   208  210 A G  T 3  S+     0   0   77  258   14  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGSGGGGG GG  GGGG     
   209  211 A D    <>  +     0   0   42  265    9  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
   210  212 A A  T  4 S+     0   0   76  266   64  AAAAAAAAAAAAAAAAAAA             A    A    ASSSAAAAAASAAA SA  AAAA     
   211  213 A L  T >4 S+     0   0   87  267   44  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   212  214 A G  G >4 S+     0   0    9  281   17  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   213  215 A Q  G 3< S+     0   0   89  282   19  QQQQQQQQQQQQQQQQQQQ             Q    Q    QQQQQQQQQQQQQQ QQ  QQQQ     
   214  216 A Q  G <  S+     0   0  148  282    3  QQQQQQQQQQQQQQQQQQQ             Q    Q    QQQQQQQQQQQQQQ QQ  QQQQ     
   215  217 A Y  S <  S-     0   0  109  282    0  YYYYYYYYYYYYYYYYYYY             Y    Y    YYYYYYYYYYYYYY YY  YYYY     
   216  218 A R  E     -i  202   0B  69  282   57  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RR  RRRR     
   217  219 A T  E  >  -i  203   0B  45  282    7  TTTTTTTTTTTTTTTTTTT             T    T    TTTTTTTTTTTTTT TT  TTTS     
   218  220 A V  H  > S+     0   0    0  282   47  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   219  221 A D  H  > S+     0   0   71  282   63  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDEDEDDDDD DD  DDDN     
   220  222 A D  H  > S+     0   0   67  282   64  DDDDDDDDDDDDDDDDDDD             D    D    DDDDEEDEDEEEEE DD  DDDD     
   221  223 A V  H  X>S+     0   0    0  282   45  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   222  224 A V  H ><5S+     0   0    0  283   19  VVVVVVVVVVVVVVVVVII             I    V    VVVVVVVVIVVVFV VI  VVVV     
   223  225 A S  H 3<5S+     0   0   78  284   81  SSSSSSSSSSSSSSSSSSS             S    S    SSSSSSSSSATASA SS  ESSS     
   224  226 A T  H 3<5S-     0   0   58  284   84  TTTTTTTTTTTTTTTTTAA             T    T    TTTTGTTTTGGGTG TT  TTTT     
   225  227 A G  T <<5S+     0   0    6  284    3  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   226  228 A S      < -     0   0    0  284   59  SSSSSSSSSSSSSSSSSSS             S    S    SSSSSSSSSSSSTS SS  SSSS     
   227  229 A D  S    S+     0   0    0  284    0  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
   228  230 A I  E    S- h   0 198A   0  284   31  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
   229  231 A I  E     -ah  30 199A   0  284   19  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
   230  232 A I  E     -a   31   0A   6  284    0  IIIIIIIIIIIIIIIIIII             I    I    IIIIIIIIIIIIII II  IIII     
   231  233 A V  E     +a   32   0A   1  284   33  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVVVVVVV VV  VVVV     
   232  234 A G    >   +     0   0   23  284    0  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   233  235 A R  G >> S+     0   0  126  284    0  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RR  RRRR     
   234  236 A G  G 34 S+     0   0   18  284    0  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   235  237 A L  G <4 S+     0   0    0  284   25  LLLLLLLLLLLLLLLLLLL             L    L    LLLLLLLLLLLLLL LL  LLLL     
   236  238 A F  T <4 S+     0   0   24  284   34  FFFFFFFFFFFFFFFFFFF             F    F    FFFFFFFFFFFFFF FY  FFFF     
   237  239 A A  S >< S+     0   0   22  284   59  AAAAAAAAAAAAAAAAAAA             A    A    GAAAAAAAGAGAAA AG  GGGG     
   238  240 A K  T 3  S-     0   0  176  165   62  KKKKKKKKKKKKKKKKKKK             K    K    KKKKKKKKKKKKKK NK  KKKK     
   239  241 A G  T 3  S+     0   0   84  284   53  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   240  242 A R    <   -     0   0   78  284   77  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RR  RRRR     
   241  243 A D     >  -     0   0   91  284   27  DDDDDDDDDDDDDDDDDDD             D    D    DDDDDDDDDDDDDD DD  DDDD     
   242  244 A A  H  > S+     0   0    8  284   53  AAAAAAAAAAAAAAAAAAA             A    V    PPPPPPPPPPPPPP PP  PPPP     
   243  245 A K  H  > S+     0   0   92  283   82  KKKKKKKKKKKKKKKKKNN             N    N    RSSSKRKRKVSVKV KL  ATTT     
   244  246 A V  H  > S+     0   0   79  283   82  VVVVVVVVVVVVVVVVVVV             V    V    VVVVVVVVIVVVTV VV  RAAV     
   245  247 A E  H  X S+     0   0   23  283   47  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEEEEEEE EE  EEEE     
   246  248 A G  H  X S+     0   0    0  283   40  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GS  ASSG     
   247  249 A E  H  X S+     0   0   55  283   56  EEEEEEEEEEEEEEEEEEE             E    E    EEEEEEEEDEAEEE EE  LRRE     
   248  250 A R  H  X S+     0   0   78  283   26  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RR  RRRR     
   249  251 A Y  H  X S+     0   0    9  283    0  YYYYYYYYYYYYYYYYYYY             Y    Y    YYYYYYYYYYYYYY YY  YYYY     
   250  252 A R  H  X S+     0   0   37  283   33  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RK  RRRR     
   251  253 A K  H  X S+     0   0   95  283   64  KKKKKKKKKKKKKKKKKKK             K    K    KKKKNKKKKKKKKK KK  TDDK     
   252  254 A A  H  X S+     0   0   16  283   49  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
   253  255 A G  H  X S+     0   0    0  283   20  GGGGGGGGGGGGGGGGGGG             G    G    GGGGGGGGGGGGGG GG  GGGG     
   254  256 A W  H  X S+     0   0   19  283    0  WWWWWWWWWWWWWWWWWWW             W    W    WWWWWWWWWWWWWW WW  WWWW     
   255  257 A E  H  X S+     0   0   83  283   62  EEEEEEEEEEEEEEEEEEE             D    E    EQQQEEDEEDDDDD DE  DDDE     
   256  258 A A  H  X S+     0   0    1  283    1  AAAAAAAAAAAAAAAAAAA             A    A    AAAAAAAAAAAAAA AA  AAAA     
   257  259 A Y  H  < S+     0   0   21  281    0  YYYYYYYYYYYYYYYYYYY             Y    Y    YYYYYYYYYYYYYY YY  YYYY     
   258  260 A L  H  < S+     0   0  113  277   62  LLLLLLLLLLLLLLLLLLL             L    L    LLLLQELELLILLL LL  LLLL     
   259  261 A R  H  <        0   0  157  277   66  RRRRRRRRRRRRRRRRRRR             R    K    KKKKKKKKKKKKKK KK  RKKK     
   260  262 A R     <        0   0   89  273    4  RRRRRRRRRRRRRRRRRRR             R    R    RRRRRRRRRRRRRR RR  RRRR     
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58                     KKKKKKKKKKKKK KKKK  QNN                            
   263    4 C A        -     0   0   31  121   71                     AAAAAAAAAAAAA AAAA  AAA                        A AA
   264    5 C T     >  -     0   0   47  219   38                     TTTTTTTTTTTTT TTTT  TTT              T  TT    TTSTT
   265    6 C Y  H  > S+     0   0    0  253    0                     YYYYYYYYYYYYY YYYY  YYY              Y  YY    YYYYY
   266    7 C K  H  > S+     0   0  122  253   72                     KKKKKKKKKKKKK KKKK  KKK              T  QQ    QQTQH
   267    8 C E  H  > S+     0   0   70  253   62                     EEEEEEEEEEEEE EEEE  EQE              Q  EE    EESED
   268    9 C R  H  X S+     0   0    2  253    1                     RRRRRRRRRRRRR RRRR  RRR              R  RR    RRRRR
   269   10 C A  H  < S+     0   0   21  253   21                     AAAAAAAAAAAAA AAAA  AAA              A  AA    AAAAA
   270   11 C A  H  < S+     0   0   47  253   71                     AAAAAAAAAAAAA AAAA  AAA              A  AA    AAEAA
   271   12 C T  H  < S+     0   0   31  253   83                     TTTTTTTTTTTTT TTTT  TTA              S  RR    RKTKK
   272   13 C H     <  -     0   0   13  254   44                     HHHHHHHHHHHHH HHHH  HHH              H  HH    HHHHH
   273   14 C P  S    S+     0   0   45  257   60                     PPPPPPPPPPPPP PPPP  PPP              P  PP    PPAPA
   274   15 C S     >  -     0   0    0  257   59                     SSSSSSSSSSSSS SSSS  SSS              S  SS    SSSSS
   275   16 C P  H  > S+     0   0   82  261   28                     PPPPPPPPPPPPP PPPP  PPP              P  PP    PPPPP
   276   17 C V  H  > S+     0   0    0  264   54                     VVVVVVVVVVVVV VVVV  VVV              L  VV    VVVVL
   277   18 C A  H  > S+     0   0    0  264   29                     AAAAAAAAAAAAA AAAA  AAA              A  AA    AAAAA
   278   19 C A  H  X S+     0   0   22  264   67                     AAAAAAAAAAAAA AAAA  AAA              S  TT    SSSSS
   279   20 C K  H  X S+     0   0   73  264   74                     KKKKKKKKKKKKK KKKK  RKK              K  RR    RKKKK
   280   21 C L  H  X S+     0   0    0  265    2                     LLLLLLLLLLLLL LLLL  LLL              L  LL    LLLLL
   281   22 C F  H  X S+     0   0    0  265   13                     FFFFFFFFFFFFF FFFF  FFL              F  LL    LLLLL
   282   23 C N  H  X S+     0   0   69  265   71                     NNNNNNNNNNNNN NNNN  NNN              N  NN    NNRNE
   283   24 C I  H  X S+     0   0    2  265   41                     IIIIIIIIIIIII IIII  III              I  LL    LLLLL
   284   25 C M  H  X>S+     0   0    0  266   52                     MMMMMMMMMMMMM MMMM MMMM              M  MM    MMMMM
   285   26 C H  H  <5S+     0   0   75  266   50                     HHHHHHHHHHHHH HHHH HHHH              E  HH    HHDHH
   286   27 C E  H  <5S+     0   0  112  266   83                     EEEEEEEEEEEEE EEEE EEEE              A  EE    EEEEE
   287   28 C K  H  <5S-     0   0   40  266    0                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   288   29 C Q  T  <5 +     0   0  109  266   48                     QQQQQQQQQQQQQ QQQQ QQQQ              K  QQ    QKKKQ
   289   30 C T      < +     0   0    0  266   40                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   290   31 C N        +     0   0    0  266    0                     NNNNNNNNNNNNN NNNN NNNN              N  NN    NNNNN
   291   32 C L  E     -s  740   0E   0  266   15                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   292   33 C C  E     -st 741 577E   0  266   47                     CCCCCCCCCCCCC CCCC CCCC              C  CC    CCCCC
   293   34 C A  E     -st 742 578E   0  265   57                     AAAAAAAAAXAAA AAAA AAAA              A  AA    AAAAA
   294   35 C S  E     - t   0 579E  14  266   11                     SSSSSSSSSSSSS SSSS SSSS              S  SS    SSSSS
   295   36 C L        +     0   0    2  266   60                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   296   37 C D        +     0   0   54  266    0                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   297   38 C V        -     0   0    6  266   11                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   298   39 C R  S    S+     0   0  150  266   65                     RRRRRHRRRRRRR RRRR RRRH              R  NN    NNRND
   299   40 C T     >  -     0   0   17  266   45                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTSTT
   300   41 C T  H  > S+     0   0   13  266   53                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   301   42 C K  H  > S+     0   0  139  266   68                     KNKKKKKKKKKKK KKKK KKKK              E  AA    AEDET
   302   43 C E  H  > S+     0   0   77  266   31                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   303   44 C L  H  X S+     0   0    5  266   12                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   304   45 C L  H  X S+     0   0   40  266    4                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   305   46 C E  H  X S+     0   0  108  266   75                     EEEEEEEEEEEEE EEEE EEEE              R  HH    HKKKR
   306   47 C L  H  X S+     0   0   29  266   27                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   307   48 C V  H  X S+     0   0    0  265   56                     VVVVVVVVVVVVV VVVV VVVV              V  LL    LVVVV
   308   49 C E  H  < S+     0   0   77  266   24                     EEEEEEEEEEEEE EEEE EEEE              E  DD    DDEDD
   309   50 C A  H  < S+     0   0   26  266   77                     AAAAAAAAAAAAA AAAA AAAA              T  VV    VTTTI
   310   51 C L  H >X S+     0   0    0  263   31                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   311   52 C G  G >< S+     0   0    0  263    2                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   312   53 C P  G 34 S+     0   0   48  266   17                     PPPPPPPPPPPPP PPPP PPPP              P  PP    PPPPP
   313   54 C K  G <4 S+     0   0   30  266   73                     KKKKKKKKKKKKK KKKK KKKK              Y  HH    HYYYY
   314   55 C I    <<  -     0   0    0  266   15                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   315   56 C C  S    S+     0   0    0  265   43                     CCCCCCCCCCCCC CCCC CCCC              C  CC    CCCCC
   316   57 C L  E     -tu 553 607E   0  265   31                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   317   58 C L  E     -tu 554 608E   0  265   31                     LLLLLLLLLLLLL LLLL LLLL              L  VV    VLLLV
   318   59 C K  E     -tu 555 609E  22  265    1                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   319   60 C T  E     - u   0 610E   2  264    2                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   320   61 C H    >   +     0   0   26  264    1                     HHHHHHHHHHHHH HHHH HHHH              H  HH    HHHHH
   321   62 C V  G >   +     0   0    3  265   39                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VIVIV
   322   63 C D  G 3  S+     0   0   74  265    1                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   323   64 C I  G <  S+     0   0   82  265   11                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   324   65 C L    <   -     0   0   15  266   28                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LILIL
   325   66 C T  S    S+     0   0   88  266   64                     TTTTTTTTTTTTT TTTT TTTT              T  SS    SSDSS
   326   67 C D  S    S+     0   0   71  266   10                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   327   68 C F        +     0   0   35  266    7                     FFFFFFFFFFFFF FFFF FFFF              F  FF    FFFFF
   328   69 C S     >> -     0   0   45  202   62                     SSSSSSSSSSSSS SSSS SSSS              S  SS    SSSSS
   329   70 C M  I  4>S+     0   0   44  203   88                     MMMMMMMMMMMMM MMMM MMIM              M  II    IIYIM
   330   71 C E  I  45S+     0   0  135  194   54                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EDEDD
   331   72 C G  I  45S+     0   0   33  250   62                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   332   73 C T  I  X5S+     0   0    2  252   41                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   333   74 C V  I  > S+     0   0   37  266   72                     PPPPPPPPPPPPP PPPP PPPP              P  PP    PPPPP
   336   77 C L  H  X S+     0   0    3  266    0                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   337   78 C K  H  X S+     0   0   68  265   79                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   338   79 C A  H  X S+     0   0   60  266   62                     AAAAAAAAAAAAA AAAA EEEQ              E  EE    EEAEE
   339   80 C L  H  X S+     0   0   13  266   12                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   340   81 C S  H  X>S+     0   0   15  266   37                     SSSSSSSSSSSSS SSSS SSSS              A  AA    AAAAA
   341   82 C A  H  <5S+     0   0   80  266   70                     AAAAAAAAAAAAA AAAA AAAA              K  AA    AKEKA
   342   83 C K  H  <5S+     0   0  134  266   19                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   343   84 C Y  H  <5S-     0   0   51  266   36                     YYYYYYYYYYYYY YYYY HHHH              F  HH    HHYHH
   344   85 C N  T  <5 +     0   0   60  266   55                     NNNNNNNNNNNNN NNNN NNNN              N  NN    KNKNK
   345   86 C F      < -     0   0    0  266    0                     FFFFFFFFFFFFF FFFF FFFF              F  FF    FFFFF
   346   87 C L  E     -u  577   0E   6  266   11                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LMLML
   347   88 C L  E     -u  578   0E   0  266   12                     LLLLLLLLLLLLL LLLL LLLL              I  II    IIIII
   348   89 C F  E     -uv 579 638E   0  266    0                     FFFFFFFFFFFFF FFFF FFFF              F  FF    FFFFF
   349   90 C E  E     -u  580   0E   0  266    0                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   350   91 C N  E     +     0   0E  30  266    0                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   351   92 C R  E     -     0   0E  47  266    0                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   352   93 C K  E     - v   0 640E  85  266    0                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   353   94 C F  E     + v   0 641E   3  266    0                     FFFFFFFFFFFFF FFFF FFFF              F  FF    FFFFF
   354   95 C A        +     0   0   46  265   45                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   355   96 C D        -     0   0   67  265    0                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   356   97 C I    >>  +     0   0   79  265    1                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   357   98 C G  H 3> S-     0   0   39  265    0                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   358   99 C N  H 3> S+     0   0  113  265   28                     NNNNNNNNNNNNN NNNN NNNN              N  NN    NNNNN
   359  100 C T  H <> S+     0   0   75  265    2                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   360  101 C V  H  X S+     0   0    0  265    5                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   361  102 C K  H  X S+     0   0   23  265   59                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   362  103 C L  H  X S+     0   0   92  265   78                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   363  104 C Q  H  < S+     0   0   76  265    0                     QQQQQQQQQQQQQ QQQQ QQQQ              Q  QQ    QQQQQ
   364  105 C Y  H  < S+     0   0    0  266    0                     YYYYYYYYYYYYY YYYY YYYY              Y  YY    YYYYY
   365  106 C S  H  < S+     0   0   23  266   78                     SSSSSSSSSSSSS SSSS SSSS              S  KK    KSTSS
   366  107 C A  S  X S+     0   0   34  266   52                     AAAAAAAAAAAAA AAAA AAAS              S  SS    SSSSS
   367  108 C G  T  4 S-     0   0   60  266    0                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   368  109 C V  T  4 S+     0   0  105  266   63                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   369  110 C Y  T  4 S-     0   0   49  266   65                     YYYYYYYYYYYYY YYYY YYYY              Y  YY    YYYYY
   370  111 C R    ><  +     0   0   95  266   34                     RRRRRRRRRRRRR RRRR RKRR              R  QQ    QRRRQ
   371  112 C I  G >>  +     0   0    0  266    2                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   372  113 C A  G 34 S+     0   0    0  266   52                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAS
   373  114 C E  G <4 S+     0   0   81  266   60                     EEEEEEEEEEEEE EEEE EEEE              E  QQ    QEEEQ
   374  115 C W  T <4 S+     0   0    3  266    0                     WWWWWWWWWWWWW WWWW WWWW              W  WW    WWWWW
   375  116 C A     <  -     0   0    0  266   30                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AASAA
   376  117 C D  S    S+     0   0    8  266   44                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   377  118 C I  E     +vw 609 666E   0  266    8                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   378  119 C T  E     - w   0 667E   0  266   42                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   379  120 C N  E     -vw 613 668E   1  266    2                     NNNNNNNNNNNNN NNNN NNNN              N  NN    NNNNN
   380  121 C A  E     -vw 614 669E   0  266   41                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   381  122 C H    >   -     0   0   37  266   50                     HHHHHHHHHHHHH HHHH HHHH              H  HH    HHHHH
   382  123 C G  G >  S+     0   0    5  265   79                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   383  124 C V  G 3  S+     0   0   99  266   30                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   384  125 C V  G <  S-     0   0   53  266   52                     VVVVVVVVVVVVV VVVV VVVV              T  TT    TTTTT
   385  126 C G    X   -     0   0   15  266    1                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   386  127 C P  T >> S+     0   0   74  266   64                     PPPPPPPPPPPPP PPPP PPPP              P  PP    PAAAP
   387  128 C G  H 3> S+     0   0   26  266   25                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   388  129 C I  H <> S+     0   0    0  266   24                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   389  130 C V  H <> S+     0   0    2  266   13                     VVVVVVVVVVVVV VVVV VVVV              I  VV    VVVVV
   390  131 C S  H  X S+     0   0   72  266   72                     SSSSSSSSSSSSS SSSS SSSS              A  QQ    QTATQ
   391  132 C G  H  X S+     0   0    6  266   30                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   392  133 C L  H  X S+     0   0    0  266    0                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   393  134 C K  H  X S+     0   0   54  266   67                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   394  135 C Q  H  X S+     0   0   97  266   56                     QQQQQQQQQQQQQ QQQQ QQQE              E  QQ    QQQQQ
   395  136 C A  H  X S+     0   0    1  266   60                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAGAA
   396  137 C A  H  X S+     0   0    4  266   31                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   397  138 C E  H  < S+     0   0  134  266   84                     EEEEEEEEEEEEE EEEE EEEE              S  QQ    QQQQE
   398  139 C E  H  < S+     0   0  125  202   30                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   399  140 C V  H  < S+     0   0   51  266   88                     VVVVVVVVVVVVV VVVV VVVA              V  TT    TTVTT
   400  141 C T     <  -     0   0   35  193   67                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   401  142 C K  S    S+     0   0  179  212   85                     KKKKKKKKKKKKK KKKK KKKK              K  QQ    QNKNQ
   402  143 C E  S    S-     0   0   91  218   33                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   403  144 C P        -     0   0   33  183   56                     PPPPPPPPPPPPP PPPP PPPP              P  PP    PPPPP
   404  145 C R        -     0   0   20  264   15                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   405  146 C G  E     -w  638   0E   0  266   17                     GGGGGGGGGGGGG GGGG GGAA              G  GG    GGGGG
   406  147 C L  E     -wx 639 699E   0  266    6                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   407  148 C L  E     -wx 640 701E   0  266   11                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   408  149 C M  E     -wx 641 702E   0  266   38                     MMMMMMMMMMMMM MMMM MMMM              M  MM    MMMMM
   409  150 C L  E     + x   0 703E   3  266    2                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   410  151 C A        +     0   0    0  266    8                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   411  152 C E  S    S-     0   0   24  266   18                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   412  153 C L        -     0   0   44  266    7                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   413  154 C S        +     0   0   78  266   31                     SSSSSSSSSSSSS SSSS SSSS              S  SS    SSSSS
   414  155 C C  S >  S-     0   0   79  266   22                     CCCCCCCCCCCCC CCCC CCCC              S  SS    SSSSS
   415  156 C K  T 3  S+     0   0  214  266   44                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   416  157 C G  T 3  S+     0   0   68  265    2                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   417  158 C S    <   -     0   0   38  266   49                     SSSSSSSSSSSSS SSSS SSSS              S  SS    SSSSS
   418  159 C L        +     0   0  148  266    8                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   419  160 C A        +     0   0    6  266   41                     AAAAAAAAAAAAA SSSA AAAA              A  AA    AAAAA
   420  161 C T    >   -     0   0   55  266   75                     TTTTTTTTTTTTT TTTT TTTT              H  HH    HHHHH
   421  162 C G  T 3> S+     0   0   20  266   28                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   422  163 C E  H 3> S+     0   0   81  266   50                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   423  164 C Y  H <> S+     0   0   59  265    0                     YYYYYYYYXYYYY YYYY YYYY              Y  YY    YYYYY
   424  165 C T  H  > S+     0   0    3  266   18                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   425  166 C K  H  X S+     0   0   78  266   69                     KKKKKKKKKKKKK KKKK KKKK              R  TT    TQKQK
   426  167 C G  H  X S+     0   0   26  266   76                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   427  168 C T  H  X S+     0   0    2  266   58                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   428  169 C V  H  X S+     0   0   16  266   12                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   429  170 C D  H  < S+     0   0   78  266   45                     DDDDDDDDDDDDD DDDD DDEN              E  DD    DEDEE
   430  171 C I  H >< S+     0   0   21  266   63                     IIIIIIIIIIIII IIII IIII              M  II    IIIII
   431  172 C A  H >< S+     0   0    0  265    1                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   432  173 C K  T 3< S+     0   0   53  266   33                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   433  174 C S  T <  S+     0   0   73  265   75                     SSSSSSSSSSSSS SSSS GRGS              I  SS    STSTT
   434  175 C D    <>  +     0   0   19  266   71                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   435  176 C K  T  4 S+     0   0   81  266   48                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   436  177 C D  T  4 S+     0   0   84  266   43                     DDDDDDDDDDDDD DDDD DDDD              E  EE    EDDDD
   437  178 C F  T  4 S+     0   0   10  266    7                     FFFFFFFFFFFFF FFFF FFFF              F  FF    FFFFF
   438  179 C V  E  <  +x  667   0E   1  266    5                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   439  180 C I  E     -     0   0E   0  265   40                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   440  181 C G  E     -xy 668 718E   0  266    0                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   441  182 C F  E     -xy 669 719E   0  266    0                     FFFFFFFFFFFFF FFFF FFFF              F  FF    FFFFF
   442  183 C I  E     +xy 670 720E  10  265   12                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   443  184 C A        -     0   0    0  265   31                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   444  185 C Q  S    S+     0   0   34  266   53                     QQQQQQQQQQQQQ QQQQ QQQQ              Q  QQ    QQQQQ
   445  186 C R  S    S-     0   0  111  266   66                     RRRRRRRRRRRRR RRRR RRKK              R  RR    RRNRR
   446  187 C D        -     0   0   41  192   77                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   447  188 C M        -     0   0   20  204   82                     MMMMMMMMMMMMM MMMM MMMM              M  MM    MMMMM
   448  189 C G        +     0   0   25  210   61                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   449  190 C G    > > +     0   0    6  236   63                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   450  191 C R  G > 5S+     0   0  123  254   81                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   451  192 C D  G 3 5S+     0   0  160  266   42                     DDDDDDDDDDDDD DDDD DDED              D  DD    DEEED
   452  193 C E  G < 5S-     0   0  108  266   30                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   453  194 C G  T < 5S+     0   0   55  266   45                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   454  195 C Y      < -     0   0   50  266   25                     YYYYYYYYYYYYY YYYY YYYY              F  YY    YFFYY
   455  196 C D        -     0   0   39  116    5                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   456  197 C W        -     0   0   10  123    9                     WWWWWWWWWWWWW WWWW WWWW              W  WW    WWWWW
   457  198 C L  E     -y  701   0E   0  266   29                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   458  199 C I  E     -y  702   0E   2  266   51                     IIIIIIIIIIIII IIII IIII              I  II    VIIII
   459  200 C M  E     -yz 703 739E   0  266   26                     MMMMMMMMMMMMM MMMM MMMM              M  MM    MMMMM
   460  201 C T  E     - z   0 740E   0  266   13                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   461  202 C P        +     0   0   28  266   31                     PPPPPPPPPPPPP PPPP PPPP              P  PP    PPPPP
   462  203 C G  S    S+     0   0   54  266    0                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   463  204 C V              0   0   12  266   14                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   464  205 C G              0   0   61  266   52                     ggggggggggggg gggg gggg              g  gg    ggggg
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54                     rrrrrrrrrrrrr rrrr rrrr              r  rr    rrrrr
   467  219 C T     >  -     0   0   79  264    8                     TTTTTTTTTTTTT TTTT TTTT              T  TT    TTTTT
   468  220 C V  H  > S+     0   0   11  264   49                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   469  221 C D  H  > S+     0   0   79  265   63                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDE
   470  222 C D  H  > S+     0   0   59  265   63                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DEEED
   471  223 C V  H  X>S+     0   0    0  265   45                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   472  224 C V  H ><5S+     0   0    0  265   19                     VVVVVVVVVVVVV VVVV IIIV              V  VV    VVVVI
   473  225 C S  H 3<5S+     0   0   52  266   85                     SSSSSSSSSSSSS SSSS SSSS              S  SS    SSSSS
   474  226 C T  H 3<5S-     0   0   59  266   80                     TTTTTTTTTTTTT TTTT AATT              T  TT    TTGTT
   475  227 C G  T <<5S+     0   0    8  266    4                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   476  228 C S      < -     0   0    0  266   60                     SSSSSSSSSSSSS SSSS SSSS              S  SS    SSSSS
   477  229 C D  S    S+     0   0    0  266    0                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   478  230 C I  E     - z   0 720E   0  266   33                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   479  231 C I  E     -sz 552 721E   0  266   11                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   480  232 C I  E     -s  553   0E   7  266    0                     IIIIIIIIIIIII IIII IIII              I  II    IIIII
   481  233 C V  E     +s  554   0E   2  266   36                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVV
   482  234 C G    >   +     0   0   22  266    0                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   483  235 C R  T 3> S+     0   0  121  266    0                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   484  236 C G  T 34 S+     0   0   21  266    0                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   485  237 C L  T <4 S+     0   0    0  266   26                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LLLLL
   486  238 C F  T  4 S+     0   0   27  266   29                     FFFFFFFFFFFFF FFFF FFFF              F  FF    FFFFF
   487  239 C A  S >< S+     0   0   10  266   52                     AAAAAAAAAAAAA AAAA AAAA              G  AA    AAAAG
   488  240 C K  T 3  S-     0   0  178  164   62                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKKKK
   489  241 C G  T 3  S+     0   0   83  266   55                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   490  242 C R    <   -     0   0  111  266   76                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   491  243 C D     >  -     0   0   96  266   30                     DDDDDDDDDDDDD DDDD DDDD              D  DD    DDDDD
   492  244 C A  H  > S+     0   0    8  266   56                     AAAAAAAAAAAAA AAAA AAAV              P  PP    PPPPP
   493  245 C K  H  > S+     0   0   83  265   82                     KKKKKKKKKKKKK KKKK NNNN              R  SS    SRKRK
   494  246 C V  H  > S+     0   0   81  265   81                     VVVVVVVVVVVVV VVVV VVVV              V  VV    VVVVI
   495  247 C E  H  X S+     0   0   22  265   50                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEEE
   496  248 C G  H  X S+     0   0    0  265   42                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   497  249 C E  H  X S+     0   0   67  265   58                     EEEEEEEEEEEEE EEEE EEEE              E  EE    EEEED
   498  250 C R  H  X S+     0   0  141  265   28                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   499  251 C Y  H  X S+     0   0   20  265    0                     YYYYYYYYYYYYY YYYY YYYY              Y  YY    YYYYY
   500  252 C R  H  X S+     0   0   41  265   36                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   501  253 C K  H  X S+     0   0  101  265   61                     KKKKKKKKKKKKK KKKK KKKK              K  KK    KKNKK
   502  254 C A  H  X S+     0   0   28  265   48                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   503  255 C G  H  X S+     0   0    0  265   15                     GGGGGGGGGGGGG GGGG GGGG              G  GG    GGGGG
   504  256 C W  H  X S+     0   0   22  265    0                     WWWWWWWWWWWWW WWWW WWWW              W  WW    WWWWW
   505  257 C E  H  X S+     0   0   86  265   62                     EEEEEEEEEEEEE EEEE EEDE              E  QQ    QEEEE
   506  258 C A  H  X S+     0   0    2  265    2                     AAAAAAAAAAAAA AAAA AAAA              A  AA    AAAAA
   507  259 C Y  H  < S+     0   0   25  262    0                     YYYYYYYYYYYYY YYYY YYYY              Y  YY    YYYYY
   508  260 C L  H  < S+     0   0  108  258   55                     LLLLLLLLLLLLL LLLL LLLL              L  LL    LEQEL
   509  261 C R  H  < S+     0   0  136  258   68                     RRRRRRRRRRRRR RRRR RRRK              K  KK    KKKKK
   510  262 C R  S  < S-     0   0   31  254    5                     RRRRRRRRRRRRR RRRR RRRR              R  RR    RRRRR
   511  263 C C        -     0   0   48  210   53                     CCCCCCCCCCCCC CCCC CCCC              C  CC    CC CC
   512  264 C G        -     0   0   35  164   41                     GGGGGGGGGGGGG GGGG CCGG              G  NN    S    
   513  265 C Q              0   0  142  129   68                     QQQQQQQQQQQQQ QQQQ QQQS              K  KK    K    
   514  266 C Q              0   0  185   69   46                     QQQQQQQQQQQQQ QQQQ   QQ                            
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    3 A K              0   0   88  128   55                                         D  STTT TT   NKK        T KK   
     2    4 A A        -     0   0   48  149   71                                      P  V  ENEE EE  AKAA A    A EQAA   
     3    5 A T     >  -     0   0   57  246   38    S  T SS   T   T ST   ST  T P TT STSTSS  SSTTTTT  STST S T TSTTTTS TT
     4    6 A Y  H  > S+     0   0    0  278    1    Y  Y YY  YY  YY YY Y YY YYYYYYY YYYYYY  YYYYYYY  YYYY Y Y YYYYYYY YY
     5    7 A K  H  > S+     0   0  120  278   72    E  T AA  ST  SP GK T GA ATASATE TTSTTG  TSTTSTT  KTSS K T SKTTTSS TS
     6    8 A E  H  > S+     0   0  109  278   63    E  Q EE  QQ  QQ EE Q EQ EQEKEQE QTTEAE  SQEEEEE  EEEE E T EETEQEE EA
     7    9 A R  H >X S+     0   0    6  278    0    R  R RR  RR  RR RR R RR RRRRRRR RRRRRR  RRRRRRR  RRRR R R RRRRRRR RR
     8   10 A A  H 3< S+     0   0    7  278   23    A  A AA  AA  AA AA A AA AAAAAAA AAAAAA  AAAAAAA  SAAA S A ASAAAAA AA
     9   11 A A  H 3< S+     0   0   88  279   72    D  S KK  ES  EE KV E KA NENENEE ESASAK  DESSESS  ENQQ E S EESSEQQ SE
    10   12 A T  H << S+     0   0  114  278   80    A  T AA  AT  AA SA A SA TKTVTKV ITAAKV  KLKKTKK  SVHH S T TSTKSHH AT
    11   13 A H     <  -     0   0   22  279   56    H  H HH  HH  HH HH HHHH HHHHHHH HHHHHH  HSHHHHH  HHHH H H HHHHHHH HH
    12   14 A P  S    S+     0   0   62  280   63    N  P NN  PP  PP PA PPPP QAQPQAP PPPPPA  GSPPAPP  TPKK T P ATPPQKK PA
    13   15 A S     >  -     0   0    1  281   63    S  S SS  SS  SS SS SSSS SSSSSSS SSSSSS  SSSSSSS  SSSS S S SSSSSSS SS
    14   16 A P  H  > S+     0   0   79  281   27    P  P PP  PP  PP KP PPKP PPPPPPP PPPPPP  PPKKPKK  PPEE P P PPPKPEE KP
    15   17 A V  H  > S+     0   0    0  283   52    V  L VV  LL  LL VV LLVV VVVVVVV VVVVVV  VVVVVVV  VVVV V V VVVVVVV VV
    16   18 A A  H  > S+     0   0    0  283   37    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  ATAAAAA  AAAA A A AAAAAAA AA
    17   19 A A  H  X S+     0   0   18  283   69    R  R RR  KR  KK SA KKSR RSRRRSQ QQRQQR  QRQQQQQ  RQKK R Q QRQQQKK QQ
    18   20 A K  H  X S+     0   0   72  283   81    K  K KK  RK  RR RK RRRR RRRRRRK RRKRRR  KRRRRRR  RRKK R R RRRRRKK RR
    19   21 A L  H  X S+     0   0    0  283    2    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
    20   22 A F  H  X S+     0   0    0  283   14    L  F LL  FF  FF LL FFLL FLFFFLL LFLFLF  LFFFFFF  FFLL F F FFFFFLL FF
    21   23 A N  H  X S+     0   0   58  283   71    A  Q AA  NR  NG NT TSNN ARANARR RHAKRE  RNQQRQQ  SNTT S H RSHQKTT RR
    22   24 A I  H  X S+     0   0    3  283   39    L  I LL  VI  VV LL VLLL LLLLLLL LLLLLL  LLLLLLL  ILLL I L LILLLLL LL
    23   25 A M  H  X>S+     0   0    0  284   48    M  I MM  MI  MM MM MMMM MMMMMMM MMMMMM  MMMMMMM  MMMM M M MMMMMMM MM
    24   26 A H  H ><5S+     0   0   74  284   50    H  E HH  EQ  EE EH EEEE EEEEEEE DDDDDE  DEEEEEE  EDEE E D EEDEDEE EE
    25   27 A E  H 3<5S+     0   0  127  284   87    E  E EE  SE  SS SE QSSS QAQTQAQ STENTK  QESSSSS  ESEE E T SETSSEE SS
    26   28 A K  H 3<5S-     0   0   39  284    0    K  K KK  KK  KK KK KKKK KKKKKKK KKKKKK  KKKKKKK  KKKK K K KKKKKKK KK
    27   29 A Q  T <<5 +     0   0  110  284   53    K  K KK  KK  KK QS KKQK QKQKQKK KKKKKQ  KKKKKKK  KKKK K K KKKKKKK KK
    28   30 A T      < +     0   0    0  284   41    T  S TT  SS  SS TT STTT SSSTSST TTSTTS  TSTTTTT  STSS S T TSATTSS TT
    29   31 A N        +     0   0    0  284    0    N  N NN  NN  NN NN NNNN NNNNNNN NNNNNN  NNNNNNN  NNNN N N NNNNNNN NN
    30   32 A L  E     -a  229   0A   0  284   14    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
    31   33 A C  E     -ab 230  55A   0  284   42    C  C CC  CC  CC CC CCCC CCCCCCC CCCCCC  CCCCCCC  CCCC C C CCCCCCC CC
    32   34 A A  E     -ab 231  56A   0  283   58    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
    33   35 A S  E     - b   0  57A  15  284    9    S  S SS  SS  SS SS SSSS SSSSSSS SSSSSS  SSSSSSS  SSSS S S SSSSSSS SS
    34   36 A L        +     0   0    3  284   60    L  I LL  IV  II VV IVVV VVVVVVV VVVVVI  VIIIIII  LVII L V ILVIVII II
    35   37 A D        +     0   0   42  284    0    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
    36   38 A V        -     0   0    8  284    9    V  V VV  VV  VV VV VVVL VVVLVVL VVVVVV  VVVVVVV  IVVV I V VIVVVVV VV
    37   39 A R  S    S+     0   0  162  284   66    R  K RR  RK  RR TR KRTT RSRTRST RQTKKS  QRPPDPP  TRRR T Q DTQPKRR TD
    38   40 A T     >  -     0   0   42  284   42    T  T TT  TT  TT KT TTKS TTTTTTK TTTSTS  TTTTTTT  ETSS E T TETTTSS TT
    39   41 A T  H  > S+     0   0    4  284   55    S  T SS  TT  TT TT TTTT TTTTTTT TTTTTT  STTTTTT  TTTT T T TTTTTTT TT
    40   42 A K  H  > S+     0   0  115  284   69    R  A RR  KA  KK QK DEQK KAKKKAA SSAEAD  SAKKKKK  EASS E S KESKSSS AK
    41   43 A E  H  > S+     0   0   74  284   28    K  E KK  EE  EE EK EEED EEEEEED EEEEEE  EEEEEEE  KEEE K E EKEEEEE EE
    42   44 A L  H  X S+     0   0    4  284   11    L  F LL  FF  FF LL FLLL LFLILFI LFLFFL  FFFFFFF  LFFF L F FLFFFFF FF
    43   45 A L  H  X S+     0   0   40  284    4    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
    44   46 A E  H  X S+     0   0  112  284   81    E  A EE  QA  QE EE SKEE EAEDEAS SSATSK  SLSSESS  SATT S S ESSSSTT SE
    45   47 A L  H  X S+     0   0   19  284   26    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  ILLL I L LILLLLL LL
    46   48 A V  H  X S+     0   0    0  283   55    A  I AA  VI  VV LA VVLL LILLLIV IIVIIV  IVIIIII  LIVV L I ILIIIVV II
    47   49 A E  H  < S+     0   0   79  284   22    D  D DD  DD  DD DD DDDD DDDEDDE DDEEDE  DDDDDDD  DDDD D D DDDDDDD DD
    48   50 A A  H  < S+     0   0   24  284   75    T  K TT  TK  TT KT TTKK KKKKKKK KKKKKK  KKKKKKK  TKKK T K KTKKKKK KK
    49   51 A L  H >X S+     0   0    0  282   33    L  L LL  LL  LL LL LLLL LLLVLLV LLLLLL  LLLLLLL  ILLL I L LILLLLL LL
    50   52 A G  G >< S+     0   0    0  282    3    G  G GG  GG  GG GG GGGG GGGGGGG GGAGGG  GGGGGGG  GGGG G G GGGGGGG GG
    51   53 A P  G 34 S+     0   0   50  284   18    P  P PP  PP  PP PP PPPP PPPPPPP PPPPPP  PPPPPPP  PPPP P P PPPPPPP PP
    52   54 A K  G <4 S+     0   0   45  284   77    H  Y HH  YY  YY YH YYYF FFFYFFN YYYYYV  YFFFYFF  YFFF Y Y YYYFYFF HY
    53   55 A I    <<  -     0   0    0  284   14    I  I II  II  II II IIII IIIIIII IIIIII  IIIIVII  IVII I I VIIIIII IV
    54   56 A C  S    S+     0   0    1  283   49    C  C CC  CC  CC CC CCCC CCCCCCC CCCCCC  CCCCCCC  CCCC C C CCCCCCC CC
    55   57 A L  E     -bc  31  85A   0  283   32    L  L LL  LL  LL LL LLLL LLLLLLL LLMLLL  LLLLLLL  LLMM L L LLLLLMM LL
    56   58 A L  E     -bc  32  86A   1  283   30    L  V LL  VV  VV VL VLVV AVAVAVV VVVVVV  VVVVIVV  VVVV V V IVVVVVV VI
    57   59 A K  E     -bc  33  87A  20  283    2    K  K KK  KK  KK KK KKKK KKKKKKK KKKKKK  KKKKKKK  KKKK K K KKKKKKK KK
    58   60 A T  E     - c   0  88A   2  281    3    T  T TT  TT  TT TT TTTT TTTTTTT TTTTTT  TTTTTTT  TTTT T T TTTTTTT TT
    59   61 A H    >>  +     0   0   18  281    2    H  H HH  HH  HH HH HHHH HHHHHHH HHHHHH  HHHHHHH  HHHH H H HHHHHHH HH
    60   62 A V  G >4  +     0   0    2  283   49    V  I VV  II  II IV IIII IIIIIIM IIIIII  IIIIIII  IIII I I IIIIIII II
    61   63 A D  G 34 S+     0   0   18  283    2    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
    62   64 A I  G <4 S+     0   0   15  283   18    I  I II  II  II II IIII IIIIIII IIIIIT  IIIIIII  IIII I I IIIIIII II
    63   65 A L    <<  -     0   0   15  284   28    L  I LL  II  II VL IIVV IIIVIIV VIVIII  IIIIIII  VIII V I IVIIIII II
    64   66 A T  S    S+     0   0   99  284   65    T  D TT  DD  DD ET DDEE DDDSDDD DDSDDD  DDSSNSS  SDDD S D NSDSDDD SN
    65   67 A D  S    S+     0   0   33  284    1    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
    66   68 A F        +     0   0   29  284    6    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  FFFFFFF  FFFF F F FFFFFFF FF
    67   69 A S     >> -     0   0   39  279   61    D  T DD  ST  SS SD SSSS TSTSTSS SSSSSS  SSSSSSS  TSTT T T STSSSTT SS
    68   70 A M  I  4>S+     0   0   38  283   97    I  L II  FL  FI YM FMYY YYYYYYY YYYYFY  YYYYYYY  YYYY Y Y YYYYYYY YY
    69   71 A E  I  45S+     0   0  109  157   60    E  E EE  EE  EE EE EEEE DEDEDEE EEEEDD  EEEEEEE  EEEE E E EEEEEEE EE
    70   72 A G  I  45S+     0   0   16  283   60    T  G TT  GG  GG HK GSHN GGGGGGT GGGGGG  GKGGSGG  GGGG G G SGGGGGG GS
    71   73 A T  I  X5S+     0   0    2  283   43    T  T TT  TT  TT TT TTTT TTTTTTT TTTTTT  TTTTTTT  TTTT T T TTTTTTT TT
    72   74 A V  I  > S+     0   0   37  284   73    P  P PP  PP  PP PP PPPP PPPPPPP PPPPPP  PPPPPPP  PPPP P P PPPPPPP PP
    75   77 A L  H  X S+     0   0    2  284    1    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
    76   78 A K  H  X S+     0   0   64  283   80    Q  Q QQ  KQ  KK QK KLQL LLLLLLL LLVLLV  LLIILII  KLVV K L LKLILVV LL
    77   79 A A  H  X S+     0   0   60  284   64    Q  E QQ  EE  EK GE KEGK EEEAEEK EEAAEE  EEEEEEE  EEEE E E EEEEEEE VE
    78   80 A L  H  X S+     0   0   14  284   11    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
    79   81 A S  H  X>S+     0   0   14  284   35    A  A AA  AA  AA AA ASAA SASASAA SAAAAS  SSSSSSS  ASSS A A SAASSSS AS
    80   82 A A  H  <5S+     0   0   81  284   70    A  K AA  QK  QS KA EKKK KKKKKKK KRKKKK  KKKKRKK  KKKK K R RKRKKKK ER
    81   83 A K  H  <5S+     0   0  142  284   20    K  K KK  KK  KK KK KEKK KKKKKKK KKKKKK  KKKKKKK  KKKK K K KKKKKKK RK
    82   84 A Y  H  <5S-     0   0   52  284   36    H  H HH  HH  HH HH HHHH HHHYHHY HHHHHY  HHHHHHH  HHHH H H HHHHHHH HH
    83   85 A N  T  <5 +     0   0   64  284   57    N  N NN  NN  NN NK NNNN KQKNKQN NNRNNN  NKNNQNN  NNKK N N QNNNNKK GQ
    84   86 A F      < -     0   0    3  284    0    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  FFFFFFF  FFFF F F FFFFFFF FF
    85   87 A L  E     -c   55   0A   8  284   10    M  L MM  LL  LL MM LLMM LMLMLMM MMLMMM  MMMMMMM  MMLL M M MMMMMLL LM
    86   88 A L  E     -c   56   0A   0  284   12    I  I II  II  II II IIII IIIIIII VILIII  IIIIIII  IIII I I IIIIIII II
    87   89 A F  E     -cd  57 116A   0  284    0    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  FFFFFFF  FFFF F F FFFFFFF FF
    88   90 A E  E     -c   58   0A   0  284    0    E  E EE  EE  EE EE EEEE EEEEEEE EEEEEE  EEEEEEE  EEEE E E EEEEEEE EE
    89   91 A N  E     +     0   0A   4  284    0    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
    90   92 A R  E     -     0   0A  40  284    0    R  R RR  RR  RR RR RRRR RRRRRRR RRRRRR  RRRRRRR  RRRR R R RRRRRRR RR
    91   93 A K  E     - d   0 118A  36  284    0    K  K KK  KK  KK KK KKKK KKKKKKK KKKKKK  KKKKKKK  KKKK K K KKKKKKK KK
    92   94 A F  E     + d   0 119A   4  284    0    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  FFFFFFF  FFFF F F FFFFFFF FF
    93   95 A A        +     0   0    6  283   47    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
    94   96 A D        -     0   0   13  283    0    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
    95   97 A I    >>  +     0   0   57  283    1    I  I II  II  II II IIII IIIIIII IIIIII  IIIIIII  IIII I I IIIIIII II
    96   98 A G  H 3> S-     0   0   37  283    0    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
    97   99 A N  H 3> S+     0   0  113  283   28    N  N NN  NN  NN NN KNNN NNNNNNN NNNNNN  NNNNNNN  NNNN N N NNNNNNN NN
    98  100 A T  H <> S+     0   0   17  283    1    T  T TT  TT  TT TT TTTT TTTTTTT TTTTTT  TTTTTTT  TTTT T T TTTTTTT TT
    99  101 A V  H  X S+     0   0    0  283    3    V  V VV  VV  VV VV VVVV VVVVVVV VVVVVV  VVVVVVV  VVVV V V VVVVVVV VV
   100  102 A K  H  X S+     0   0   21  283   59    K  K KK  KK  KK KK KKKK KKKKKKK RKKKKK  KKKKKKK  KKKK K K KKKKKKK MK
   101  103 A L  H  X S+     0   0   63  283   75    L  S LL  AS  AA LL NALL HKHSHKL SHHSSN  SALLKLL  NSAA N H KNHLSAA LK
   102  104 A Q  H  < S+     0   0   28  283    0    Q  Q QQ  QQ  QQ QQ QQQQ QQQQQQQ QQQQQQ  QQQQQQQ  QQQQ Q Q QQQQQQQ QQ
   103  105 A Y  H  < S+     0   0    0  284    0    Y  Y YY  YY  YY YY YYYY YYYYYYY YYYYYY  YYYYYYY  YYYY Y Y YYYYYYY YY
   104  106 A S  H  < S+     0   0   26  284   77    A  A SS  AA  AS KS AAKK QSQKQSK VTASSK  KTTTITT  KTSS K T IKTTSSS TI
   105  107 A A     X  +     0   0   38  284   52    S  G SS  GG  GG GS SGGG GGGGGGG GSGGGN  GGSSGSS  SGGG S S GSSSGGG SG
   106  108 A G  T  4 S-     0   0   47  284    0    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   107  109 A V  T  4 S+     0   0   67  284   67    V  V VV  AV  AA IV VAIV VVVVVVL AVVVVI  VVVVVVV  VVAA V V VVVVVAA VV
   108  110 A Y  T  4 S-     0   0   37  284   72    Y  Y YY  FY  FF YY FFYY YYYYYYY YYYYYF  YYYYYYY  FYFF F Y YFYYYFF YY
   109  111 A R    ><  -     0   0   93  284   34    R  K RR  KK  KK RR KKRQ KQKQKQK KKQKKK  KRKKKKK  RKKK R K KRKKKKK RK
   110  112 A I  G >> S+     0   0    1  284    2    I  I II  II  II TI IITI IIIIIIV IIIIII  IIIIIII  IIII I I IIIIIII II
   111  113 A A  G 34 S+     0   0    0  284   58    A  A AA  AA  AA SS AASA AAAAAAA ASAAAA  AASSSSS  AAAA A S SASSAAA AS
   112  114 A E  G <4 S+     0   0   71  284   59    E  S EE  TS  TT KE QQKK QKQKQKK QSRQQQ  QESSSSS  EHKK E S SESSQKK AS
   113  115 A W  T <4 S+     0   0    2  284    0    W  W WW  WW  WW WW WWWW WWWWWWW WWWWWW  WWWWWWW  WWWW W W WWWWWWW WW
   114  116 A A     <  -     0   0    0  284   29    A  A AA  SA  SS AS SAAA AAASAAA SSASSA  ASSSASS  ASAA A S AASSSAA SA
   115  117 A D  S    S+     0   0   10  284   44    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
   116  118 A I  E     +de  87 144A   0  284    8    I  I II  II  II II IIII IIIIIII IIIIII  IIIIIII  IIII I I IIIIIII II
   117  119 A T  E     - e   0 145A   0  284   42    T  T TT  TT  TT TT TTTT TTTTTTT TTTTTT  TTTTTTT  TTTT T T TTTTTTT TT
   118  120 A N  E     -de  91 146A   0  284    3    N  N NN  NN  NN NN NNNN NNNNNNN NNNNNN  NNNNNNN  NNNN N N NNNNNNN NN
   119  121 A A  E     -de  92 147A   0  284   46    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
   120  122 A H        -     0   0    0  284   53    H  H HH  HH  HH HH HHHH HHHHHHH HHHHHH  HHHHHHH  HHHH H H HHHHHHH HH
   121  123 A G  S >  S+     0   0    0  283   80    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   122  124 A V  T 3  S+     0   0    0  284   33    V  V VV  VV  VV VI VVVV VVVVVVV VVVIIV  IVVVVVV  VVVV V V VVVVVVV VV
   123  125 A V  T 3  S-     0   0    4  284   51    T  T TT  TT  TT TT TTTT ITITITT TTTTTT  TTTTTTT  TTTT T T TTTTTTT TT
   124  126 A G    X   -     0   0    0  284    1    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGV  GGGG G G GGGGGGG GG
   125  127 A P  T >> S+     0   0   44  284   67    P  A PP  AA  AE AP ARAS SASSSAP AAASAE  AEKKNKK  AASS A A NAAKSSS KN
   126  128 A G  H 3> S+     0   0   25  284   30    G  G GG  GG  GG GS GGGR GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   127  129 A I  H <> S+     0   0    0  284   36    V  I VV  II  II IV IIII IIIIIII VVIIII  VVVVVVG  IVII I V VIVGIII VV
   128  130 A V  H <> S+     0   0    2  284   13    I  V II  VV  VV VI VVVV VVVVVVV VVVVVV  VVVVVVV  VVVV V V VVVVVVV VV
   129  131 A S  H  X S+     0   0   71  284   73    A  Q AA  SQ  SR EA KKES KRKTKRA QDAKNK  QKEEEEE  SQHH S D ESDEQHH EE
   130  132 A G  H  X S+     0   0    7  284   35    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   131  133 A L  H  X S+     0   0    0  284    1    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
   132  134 A K  H  X S+     0   0   50  284   66    K  K KK  KK  KK KK KKKR KKKKKKK KKKKKK  KKKKKKK  KKKK K K KKKKKKK KK
   133  135 A Q  H  X S+     0   0   93  284   56    D  E EE  EE  EE QQ EEQQ EEEQEEQ QQQEEE  EEKKQKK  EEQQ E Q QEQKEQQ RQ
   134  136 A A  H  X S+     0   0    0  284   57    A  A AA  AA  AA AA AAAA AAAAAAA GGAAAA  GGGGGGG  AGAA A G GAGGAAA GG
   135  137 A A  H  X S+     0   0    6  284   28    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
   136  138 A E  H  < S+     0   0  132  284   84    K  Q KK  KQ  KS EE QQEQ TQTETQE QLEQQL  KSDDKDD  QKSS Q L KQLDRSS EK
   137  139 A E  H  < S+     0   0  129  222   34    I  E LL  EE  EE ET EEEE EEEEEEE EEEEEE  EEEEEEE  EEEE E E EEEEEEE GE
   138  140 A V  H  < S+     0   0   49  284   90    A  V AA  AV  AV SA TTST TTTVTTT TTTSTT  VVTTtTT  TTTT T T tTTTTTT Vt
   139  141 A T     <  -     0   0   33  208   67    S  T SS  ST  SS TT TTTT TTTTTTT TTTSTT  TTTTnTT  TTTT T T nTTTTTT .d
   140  142 A K  S    S+     0   0  181  232   87    Q  S QQ  DS  DQ DT DDDD DSDDDSS QKSKSL  EDNNQNN  SDNK S K QSKNDKN EQ
   141  143 A E  S    S-     0   0   78  236   37    E  E EE  EE  EE EE EEEE QEQEQEE EEEEEE  EQEEEEE  EEEE E E EEEEEEE KE
   142  144 A P        -     0   0   37  195   61    P  P PP  PP  PP PP PPPP PPPPPPP PPPPPP  PPPPPPP  PPPP P P PPPPPPP EP
   143  145 A R        -     0   0   15  282   12    R  R RR  RR  RR RR RRRR RRRRRRR RRRRRR  RRRRRRR  RRRR R R RRRRRRR RR
   144  146 A G  E     -e  116   0A   0  284   15    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   145  147 A L  E     -ef 117 177A   0  284    4    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL VL
   146  148 A L  E     -ef 118 179A   0  284    8    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
   147  149 A M  E     -ef 119 180A   0  284   38    M  M MM  MM  MM MM MMMM MMMMMMM MMMMMM  MMMMMMM  MMMM M M MMMMMMM MM
   148  150 A L  E     + f   0 181A   3  284    1    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
   149  151 A A        +     0   0    0  284    7    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
   150  152 A E  S    S-     0   0   27  283   23    E  E EE  EE  EE EE EEEE EEEEEEE EEEEEE  EEEEEEE  EEEE E E EEEEEEE EE
   151  153 A L        -     0   0   23  283    7    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
   152  154 A S        +     0   0   75  283   27    S  S SS  SS  SS SS SSSS SSSSSSS SSSSSS  SSSSSSS  SSSS S S SSSSSSS SS
   153  155 A C  S >  S-     0   0   28  284   20    S  S SS  SS  SS SS SSSS SSSSSSS SSSSSS  SSSSSSS  SSSS S S SSSSSSS SS
   154  156 A K  T 3  S+     0   0  188  284   47    K  K QQ  KK  KK KA KKKE KKKKKKK KKKKKK  KKKKVKK  KKKK K K VKKKKKK KV
   155  157 A G  T 3  S+     0   0   44  283    1    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   156  158 A S    <   -     0   0   36  284   53    S  S SS  SS  SS SS SSSS SSSASSA SSASSS  SSSSSSS  SSSS S S SSSSSSS SS
   157  159 A L        +     0   0   20  284   10    L  I LL  LI  LL LL LFLL ILIIILI LLILLL  LLLLLLL  LLLL L L LLLLILL LL
   158  160 A A        +     0   0   18  284   49    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
   159  161 A T     >  -     0   0   66  284   73    H  T RR  KT  KK YH THTY HYHHHYH FYHYYY  YYYYYYY  YYQQ Y Y YYYYHQQ HY
   160  162 A G  H  > S+     0   0   48  284   37    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   161  163 A E  H  > S+     0   0  123  284   48    E  E DD  EE  EE ED ETEE KEKKKEQ EEKEEE  EEEEEEE  EEEE E E EEEEKEE EE
   162  164 A Y  H  > S+     0   0    9  283    0    Y  Y YY  YY  YY YY YYYY YYYYYYY YYYYYY  YYYYYYY  YYYY Y Y YYYYYYY YY
   163  165 A T  H  X S+     0   0    3  284   16    T  T TT  TT  TT TT TTTT TTTTTTT TTTTTT  TSTTSTT  TSTT T T STTTTTT TS
   164  166 A K  H  X S+     0   0  112  284   70    Q  E AA  KE  KK QK KEQK EKEEEKK DEEEEN  EANNQNN  EEQQ E E QEENEQQ RQ
   165  167 A G  H  X S+     0   0   13  284   74    G  K GG  QK  QQ KG QEKK EQEEEQE KKEKKK  KKKKKKK  KKKK K K KKKKEKK EK
   166  168 A T  H  X S+     0   0    0  284   59    V  T VV  TT  TT TV TTTT TTTTTTT TTTTTT  TTTTTTT  TTTT T T TTTTTTT TT
   167  169 A V  H  X S+     0   0   15  284   12    V  V VV  VV  VV VV VVVV VVVVVVV VVVIVV  VVIIVII  VIVV V V VVVIVVV IV
   168  170 A D  H  X S+     0   0   84  284   43    E  D EE  DD  DD EE DEEE EEEEEED EEEEEE  EEEEEEE  EDEE E E EEEEEEE EE
   169  171 A I  H >< S+     0   0    9  284   69    M  I MM  II  II IM IIII IIIIIII IIIIII  IIIIIII  IIII I I IIIIIII II
   170  172 A A  H >< S+     0   0    0  283    1    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
   171  173 A K  H 3< S+     0   0   51  284   31    K  K KK  KK  KK KK KKKK KKKKKKK KKKKKK  KKKKKKK  KKKK K K KKKKKKK KK
   172  174 A S  T << S+     0   0   75  283   74    L  T LL  TT  TT ST TTSS SSSTSST TSTSSS  SSSSSSS  STEE S S SSLSTEE SS
   173  175 A D    <>  +     0   0   26  284   68    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
   174  176 A K  T  4 S+     0   0   75  284   44    K  K KK  KK  KK KK KKKR KKKKKKK KKKKKK  KKKEKKK  KKKK K K KKKKKKK RK
   175  177 A D  T  4 S+     0   0   90  284   44    D  D DD  DD  DD ED DDED EDEDEDD EEEEED  EEEEEEE  EEEE E E EEEEEEE EE
   176  178 A F  T  4 S+     0   0    8  284    5    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  FFFFFFF  FFFF F F FFFFFFF FF
   177  179 A V  E  <  +f  145   0A   1  284    4    V  V VV  VV  VV VV VCVV VVVVVVV VVVVVV  VVVVVVV  VVII V V VVVVVII VV
   178  180 A I  E     -     0   0A   0  283   40    I  I II  II  II IM IIII IIIIIII IIFIVI  IMIIIII  IIII I I IIIIIII II
   179  181 A G  E     -fg 146 196A   0  284    0    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   180  182 A F  E     -fg 147 197A   0  284    0    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  FFFFFFF  FFFF F F FFFFFFF FF
   181  183 A I  E     +fg 148 198A  10  283   12    I  I II  II  II II IIII IIIIIII IIIIII  IIIIIII  IIII I I IIIIIII II
   182  184 A A        -     0   0    0  283   33    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AASS A A AAAAASS AA
   183  185 A Q  S    S+     0   0   34  284   49    Q  Q QQ  QQ  QQ QQ QQQQ QQQQQQQ QQQQQQ  QQQQQQQ  QQQQ Q Q QQQQQQQ QQ
   184  186 A R  S    S-     0   0  108  284   68    R  R RR  NR  NN RG RRRN NRNNNRH RRGRRH  RRRRRRR  HRRR H H RHRRRRR RR
   185  187 A D        -     0   0   38  204   79    D  D DD  DD  DD DD DDDD SDSQSDS DDDDDD  EDDDDDD  DDDD D D DDDDDDD DD
   186  188 A M        -     0   0   22  215   84    M  M MM  MM  MM MM MMMM MMMMMMM MMMMMM  MMMMMMM  MMFF M M MMMMMFF MM
   187  189 A G        +     0   0   24  220   62    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   188  190 A G    > > +     0   0   12  245   65    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   189  191 A R  G > 5S+     0   0  123  260   82    R  Q RR  RH  RR RR HRRR QKQSQKE RHRTRR  AAHHQHH  RRYY R H QRHHQYY RQ
   190  192 A D  G 3 5S+     0   0  175  284   41    E  D AA  DD  DD ED DEED DDDDDDA EDEDDE  DDDDEDD  EEDH E D EEDDDHD EE
   191  193 A E  G < 5S-     0   0  111  284   28    E  E DD  GE  GE EQ EDEE EEEEEEE EEEEEE  EEEEEEE  EEEE E E EEEQEEE EE
   192  194 A G  T < 5S+     0   0   49  284   45    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   193  195 A Y      < -     0   0   42  284   24    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  YFFFFFF  FFYY F F FFFFFYY FF
   194  196 A D        -     0   0   38  116    1    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
   195  197 A W        -     0   0   12  124    7    W  W WW  WW  WW WW WWWW WWWWWWW WWWWWW  WWWWWWW  WWWW W W WWWWWWW WW
   196  198 A L  E     -g  179   0A   0  284   28    L  I LL  LI  LL LI LILL ILIIILL LIVILI  LVIILII  IILL I I LIIIILL II
   197  199 A I  E     -g  180   0A   1  284   59    I  I II  II  II II IIII IVIIIVI IVVVII  IIIIIII  IVII I V IIVIVII II
   198  200 A M  E     -gh 181 228A   0  284   23    M  M MM  MM  MM MM MMMM MMMMMML MMMMMM  MMMMMMM  MMMM M M MMMMMMM MM
   199  201 A T  E     - h   0 229A   0  284   11    T  T TT  TT  TT TT TTTT TTTTTTT TTTTTT  TTTTTTT  TSTT T T TTTTTTT TT
   200  202 A P        +     0   0   31  284   27    P  P PP  PP  PP PP PPPP PPPPPPP PPPPPP  PPPPPPP  PPPP P P PPPPPPP PP
   201  203 A G  S    S+     0   0   33  284    0    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   202  204 A V  E     +i  216   0B   8  284   31    V  V VV  VV  VV VV VVVV VVVVVVV VVVVVV  VVVVVVV  VVVV V V VVVVVVV VV
   203  205 A G  E     -i  217   0B   3  283   56    G  G GG  GG  GG GN GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   204  206 A L        -     0   0   35  283    8    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
   205  207 A D        -     0   0   97  283   62    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
   206  208 A D    >   -     0   0   41  283   76    D  D DD  DD  DD DE DDDD DDDDDDD DDDDDD  DDDDDDD  DDEE D D DDDDDEE DD
   207  209 A K  T 3  S+     0   0  216  283   49    K  K KK  KK  KK KK KKKT TKTKTKK KKTKKK  KKKKKKK  KKKK K K KKKKKKK KK
   208  210 A G  T 3  S+     0   0   77  258   14    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   209  211 A D    <>  +     0   0   42  265    9    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
   210  212 A A  T  4 S+     0   0   76  266   64    G  S GG  AS  AG SS GSSA AAAAAAS GGAGAK  GSAAGAA  AGGG A G GAGASGG AG
   211  213 A L  T >4 S+     0   0   87  267   44    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
   212  214 A G  G >4 S+     0   0    9  281   17    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   213  215 A Q  G 3< S+     0   0   89  282   19    Q  Q QQ  QQ  QQ QQ QQQQ QQQQQQQ QQQQQQ  QQQQQQQ  QQQQ Q Q QQQQQQQ QQ
   214  216 A Q  G <  S+     0   0  148  282    3    Q  Q QQ  QQ  QQ QQ QQQQ QQQQQQQ QQQQQQ  QQQQQQQ  QQQQ Q Q QQQQQQQ QQ
   215  217 A Y  S <  S-     0   0  109  282    0    Y  Y YY  YY  YY YY YYYY YYYYYYY YYYYYY  YYYYYYY  YYYY Y Y YYYYYYY YY
   216  218 A R  E     -i  202   0B  69  282   57    R  R RR  RR  RR RR RRRR RRRRRRR RRRRRR  RRRRRRR  RRRR R R RRRRRRR RR
   217  219 A T  E  >  -i  203   0B  45  282    7    T  T TT  ST  SS TS GTTT TTTTTTT TTTTTT  TTTTTTT  TTTT T T TTTTTTT TT
   218  220 A V  H  > S+     0   0    0  282   47    V  V VV  VV  VV VV VVVV VVVVVVV VVVVVV  VVVVVVV  VVVV V V VVVVVVV VV
   219  221 A D  H  > S+     0   0   71  282   63    D  D DD  DD  DS DE DDDS SQSSSQN DDDDND  DDDDDDD  DDDE D D DDDDDED DN
   220  222 A D  H  > S+     0   0   67  282   64    E  E EE  TE  TE ED EEEA QEQEQED EETQEQ  EEEEEEE  EEDD E E EEEEEDD EE
   221  223 A V  H  X>S+     0   0    0  282   45    V  V VV  VV  VV VV VVVV VVVVVVV VVVVVV  VVVVVVV  VVVV V V VVVVVVV VV
   222  224 A V  H ><5S+     0   0    0  283   19    V  V VV  VM  VV IV VVMM FVFMFVI VVVVII  VVIIVII  VVFF V V VVVIVFF VV
   223  225 A S  H 3<5S+     0   0   78  284   81    A  S SS  SS  SA QA ASQK SSSSSSS SSQTSD  SSSSSSS  KSSS K S SKSSSSS SS
   224  226 A T  H 3<5S-     0   0   58  284   84    D  T DD  TT  TG TG GGTT TTTTTTT TTTTTS  TTTTTTT  TTTT T T TTTTTTT TT
   225  227 A G  T <<5S+     0   0    6  284    3    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   226  228 A S      < -     0   0    0  284   59    T  T TT  ST  SS TS SCTT TTTTTTS TTTTTS  TTTTTTT  TTTT T T TTTTTTT TT
   227  229 A D  S    S+     0   0    0  284    0    D  D DD  DD  DD DD DDDD DDDDDDD DDDDDD  DDDDDDD  DDDD D D DDDDDDD DD
   228  230 A I  E    S- h   0 198A   0  284   31    V  I VV  II  II VV IIVI IIIIIII IVVIII  IIVVIVV  IILL I V IIVVILL VI
   229  231 A I  E     -ah  30 199A   0  284   19    I  I II  II  II II IIII IIIIIII IIIIII  IIIIIII  IIII I I IIIIIII II
   230  232 A I  E     -a   31   0A   6  284    0    I  I II  II  II II IIII IIIIIII IIIIII  IIIIIII  IIII I I IIIIIII II
   231  233 A V  E     +a   32   0A   1  284   33    V  V VV  VV  VV VV VVVV VVVVVVV VVVVVV  VVVVVVV  VVVV V V VVVVVVV VV
   232  234 A G    >   +     0   0   23  284    0    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   233  235 A R  G >> S+     0   0  126  284    0    R  R RR  RR  RR RR RRRR RRRRRRR RRRRRR  RRRRRRR  RRRR R R RRRRRRR RR
   234  236 A G  G 34 S+     0   0   18  284    0    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   235  237 A L  G <4 S+     0   0    0  284   25    L  L LL  LL  LL LL LLLL LLLLLLL LLLLLL  LLLLLLL  LLLL L L LLLLLLL LL
   236  238 A F  T <4 S+     0   0   24  284   34    F  F FF  FF  FF FF FFFF FFFFFFF FFFFFF  FFFFFFF  YFFF Y F FYFFFFF FF
   237  239 A A  S >< S+     0   0   22  284   59    D  G DD  GG  GG GS GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   238  240 A K  T 3  S-     0   0  176  165   62    K  K KK  KK  KK KN KKKK KKKKKKK KKKQKK  KKKKKKK  QKKK Q K KQKKKKK KK
   239  241 A G  T 3  S+     0   0   84  284   53    G  G GG  GG  GG GG GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   240  242 A R    <   -     0   0   78  284   77    R  R RR  RR  RR RR RRRR RRRRRRR RRRRRR  RRRRRRR  RRRR R R RRRRRRR RR
   241  243 A D     >  -     0   0   91  284   27    D  D DD  DD  DD DD DDDD DDDDDDD DDHDDD  DDDDDDD  DDDD D D DDDDDDD DD
   242  244 A A  H  > S+     0   0    8  284   53    P  P PP  PP  PP PP PPPP PPPPPPP PPPPPP  PPPPPPP  PPPP P P PPPPPPP PP
   243  245 A K  H  > S+     0   0   92  283   82    N  T NN  NT  NK EA ATEV LTLSLTV DEATEV  ETEEDEE  IQEE V E DIEEDEE EE
   244  246 A V  H  > S+     0   0   79  283   82    V  V VV  AV  AV VV VVVV KVKVKVV VVVVVL  VVVVIVV  EVAT E V IEVVVTA VV
   245  247 A E  H  X S+     0   0   23  283   47    E  E EE  EE  EE EE EEEE EEEEEEE EEEEEQ  EEEEEEE  QEEE Q E EQEEEEE EE
   246  248 A G  H  X S+     0   0    0  283   40    G  G GG  GG  GG GG GGGG GGGGGGS GGGGGG  GGGGGGG  AGGG A G GAGGGGG GG
   247  249 A E  H  X S+     0   0   55  283   56    A  E AA  ED  EE KA EEKE EAEEEAK KKEKKE  KKKKKKK  KKRR K K KKKKQRR KK
   248  250 A R  H  X S+     0   0   78  283   26    R  R RR  RR  RR RR RRRR RRRRRRR RRRRRR  RRRRRRR  RRRR R R RRRRRRR RR
   249  251 A Y  H  X S+     0   0    9  283    0    Y  Y YY  YY  YY YY YYYY YYYYYYY YYYYYY  YYYYYYY  YYYY Y Y YYYYYYY YY
   250  252 A R  H  X S+     0   0   37  283   33    R  R RR  RR  RR RR RRRR RRRMRRR RRRRRR  RQRRRRR  QRQQ Q R RQRRRQQ RR
   251  253 A K  H  X S+     0   0   95  283   64    K  K KK  AK  AS KK SKNK KDKKKDD DDKDDK  DKEENEE  QDDD Q D DQDEEDD DD
   252  254 A A  H  X S+     0   0   16  283   49    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
   253  255 A G  H  X S+     0   0    0  283   20    G  G GG  GG  GG GC GGGG GGGGGGG GGGGGG  GGGGGGG  GGGG G G GGGGGGG GG
   254  256 A W  H  X S+     0   0   19  283    0    W  W WW  WW  WW WW WWWW WWWWWWW WWWWWW  WWWWWWW  WWWW W W WWWWWWW WW
   255  257 A E  H  X S+     0   0   83  283   62    E  D EE  ND  NN ED NDED EKENEKS ANDNKD  KDNNNNN  NNKK N N NNNNNKK KN
   256  258 A A  H  X S+     0   0    1  283    1    A  A AA  AA  AA AA AAAA AAAAAAA AAAAAA  AAAAAAA  AAAA A A AAAAAAA AA
   257  259 A Y  H  < S+     0   0   21  281    0    Y  Y YY  YY  YY YY YYYY YYYYYYY YYYYYY  YYYYYYY  YYYY Y Y YYYYYYY YY
   258  260 A L  H  < S+     0   0  113  277   62    L  L LL  LL  LL KL LLKL  T L TL QLTLQL  QLLLLLL  LLLL L L LLLLLLL LL
   259  261 A R  H  <        0   0  157  277   66    R  K RR  KK  KK RK KKRS  E A EN KKKKKK  SHKKKKK  NKNN N K KNKKKNN KK
   260  262 A R     <        0   0   89  273    4    R  R RR  RR  RR RR RRRR  R R RR RRRKRR  RRKKKKK  RKRR R R KRRKKRR RK
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58           S                                                            
   263    4 C A        -     0   0   31  121   71           A    A  A       P                                            
   264    5 C T     >  -     0   0   47  219   38   T SS T  SS  TT  T  T    S       T      SS        T      S S       T  
   265    6 C Y  H  > S+     0   0    0  253    0  YY YY Y  YY  YY  Y  Y    Y       Y      YY       YY    Y Y Y       Y  
   266    7 C K  H  > S+     0   0  122  253   72  LE SS E  LS  TE  E  A    E       T      SE       ST    S A A       K  
   267    8 C E  H  > S+     0   0   70  253   62  EE EE Q  QE  EE  E  E    S       Q      EE       QQ    Q E E       E  
   268    9 C R  H  X S+     0   0    2  253    1  RR RR R  RR  RR  R  R    R       R      RR       RR    R R R       R  
   269   10 C A  H  < S+     0   0   21  253   21  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   270   11 C A  H  < S+     0   0   47  253   71  EK AA K  EA  KS  S  A    E       S      AD       ES    E K K       V  
   271   12 C T  H  < S+     0   0   31  253   83  RN AA T  AA  AV  V  V    T       T      AA       AT    A A A       A  
   272   13 C H     <  -     0   0   13  254   44  HH HH H  HH  HH  H  H    H       H      HH       HH    H H H       H  
   273   14 C P  S    S+     0   0   45  257   60  AA RR P  PR  PA  A  G    P       P      RN       PP    P N N       A  
   274   15 C S     >  -     0   0    0  257   59  SS SS N  SS  SS  S  S    N       S      SS       SS    S S S       S  
   275   16 C P  H  > S+     0   0   82  261   28  PP PP K  PP  AP  P  A    A       P      PP       PP    P P P       P  
   276   17 C V  H  > S+     0   0    0  264   54  VV VV V  VV  VV  V  V    V       L      VV       LL    L V V       V  
   277   18 C A  H  > S+     0   0    0  264   29  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   278   19 C A  H  X S+     0   0   22  264   67  AS AA S  SA  SS  S  A    S       R      AR       KR    K R R       A  
   279   20 C K  H  X S+     0   0   73  264   74  KK KK K  KK  KK  K  K    K       K      KK       RK    R K K       K  
   280   21 C L  H  X S+     0   0    0  265    2  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   281   22 C F  H  X S+     0   0    0  265   13  LL LL L  LL  LL  L  L    L       F      LL       FF    F L L       L  
   282   23 C N  H  X S+     0   0   69  265   71  KT NN N  KN  NR  R  R    R       Q      NA       NR    N A A       T  
   283   24 C I  H  X S+     0   0    2  265   41  LI LL L  LL  II  I  L    L       I      LL       VI    V L L       L  
   284   25 C M  H  X>S+     0   0    0  266   52  MM MM M  MM  MM  M  M    M       I      MM       MI    M M M       M  
   285   26 C H  H  <5S+     0   0   75  266   50  HF EE A  HE  EA  A  E    A       E      EH       EQ    E H H       H  
   286   27 C E  H  <5S+     0   0  112  266   83  EE EE E  EE  SS  S  E    E       E      EE       SE    S E E       E  
   287   28 C K  H  <5S-     0   0   40  266    0  KK KK K  KK  KK  K  K    K       K      KK       KK    K K K       K  
   288   29 C Q  T  <5 +     0   0  109  266   48  KQ KK K  KK  KK  K  Q    K       K      KK       KK    K K K       S  
   289   30 C T      < +     0   0    0  266   40  TT SS T  TS  TT  T  T    T       S      ST       SS    S T T       T  
   290   31 C N        +     0   0    0  266    0  NN NN N  NN  NN  N  N    N       N      NN       NN    N N N       N  
   291   32 C L  E     -s  740   0E   0  266   15  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   292   33 C C  E     -st 741 577E   0  266   47  CC CC S  CC  CC  C  C    C       C      CC       CC    C C C       C  
   293   34 C A  E     -st 742 578E   0  265   57  AA AA G  AA  AA  A  A    A       A      AA       AA    A A A       A  
   294   35 C S  E     - t   0 579E  14  266   11  SS SS S  SS  SS  S  S    S       S      SS       SS    S S S       S  
   295   36 C L        +     0   0    2  266   60  LL LL L  LL  IL  L  L    L       I      LL       IV    I L L       V  
   296   37 C D        +     0   0   54  266    0  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   297   38 C V        -     0   0    6  266   11  VV VV V  VV  VV  V  V    V       V      VV       VV    V V V       V  
   298   39 C R  S    S+     0   0  150  266   65  HR RR R  TR  RR  R  R    H       K      RR       RK    R R R       R  
   299   40 C T     >  -     0   0   17  266   45  TT KK T  TK  TT  T  T    S       T      KT       TT    T T T       T  
   300   41 C T  H  > S+     0   0   13  266   53  TT TT T  TT  TT  T  T    T       T      TS       TT    T S S       T  
   301   42 C K  H  > S+     0   0  139  266   68  KE AA K  SA  QA  A  A    K       A      AR       KA    K R R       K  
   302   43 C E  H  > S+     0   0   77  266   31  EE EE E  EE  EE  E  E    E       E      EK       EE    E K K       K  
   303   44 C L  H  X S+     0   0    5  266   12  LL LL L  LL  LL  L  L    L       F      LL       FF    F L L       L  
   304   45 C L  H  X S+     0   0   40  266    4  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   305   46 C E  H  X S+     0   0  108  266   75  DR RR R  KR  DS  S  A    E       A      RE       QA    Q E E       E  
   306   47 C L  H  X S+     0   0   29  266   27  LL LL L  LL  IL  L  I    L       L      LL       LL    L L L       L  
   307   48 C V  H  X S+     0   0    0  265   56  VV VV A  VV  VV  V  A    A       I      VA       VI    V A A       A  
   308   49 C E  H  < S+     0   0   77  266   24  QD EE D  DE  SD  D  E    D       D      ED       DD    D D D       D  
   309   50 C A  H  < S+     0   0   26  266   77  VI VV I  TV  KQ  Q  Q    K       K      VT       TK    T T T       T  
   310   51 C L  H >X S+     0   0    0  263   31  LL LL L  LL  IV  V  V    L       L      LL       LL    L L L       L  
   311   52 C G  G >< S+     0   0    0  263    2  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   312   53 C P  G 34 S+     0   0   48  266   17  PP PP P  PP  PP  P  P    P       P      PP       PP    P P P       P  
   313   54 C K  G <4 S+     0   0   30  266   73  HY YY Y  YY  NY  Y  H    Y       Y      YH       YY    Y H H       H  
   314   55 C I    <<  -     0   0    0  266   15  II II I  II  II  I  I    I       I      II       II    I I I       I  
   315   56 C C  S    S+     0   0    0  265   43  CC CC C  CC  CC  C  C    C       C      CC       CC    C C C       C  
   316   57 C L  E     -tu 553 607E   0  265   31  LL LL V  LL  LL  L  L    L       L      LL       LL    L L L       L  
   317   58 C L  E     -tu 554 608E   0  265   31  LL LL L  LL  LL  L  L    V       V      LL       VV    V L L       L  
   318   59 C K  E     -tu 555 609E  22  265    1  KK KK K  KK  KK  K  K    K       K      KK       KK    K K K       K  
   319   60 C T  E     - u   0 610E   2  264    2  TT TT T  TT  TT  T  T    T       T      TT       TT    T T T       T  
   320   61 C H    >   +     0   0   26  264    1  HH HH H  HH  HH  H  H    H       H      HH       HH    H H H       H  
   321   62 C V  G >   +     0   0    3  265   39  VV VV V  VV  VV  V  V    V       I      VV       II    I V V       V  
   322   63 C D  G 3  S+     0   0   74  265    1  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   323   64 C I  G <  S+     0   0   82  265   11  II II I  II  II  I  I    I       I      II       II    I I I       I  
   324   65 C L    <   -     0   0   15  266   28  LL LL L  LL  LL  L  L    L       I      LL       II    I L L       L  
   325   66 C T  S    S+     0   0   88  266   64  DS EE D  SE  ED  D  E    D       D      ET       DD    D T T       T  
   326   67 C D  S    S+     0   0   71  266   10  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   327   68 C F        +     0   0   35  266    7  FF FF F  FF  FF  F  F    F       F      FF       FF    F F F       F  
   328   69 C S     >> -     0   0   45  202   62  SS SS S  SS  SS  S  S    T       T      SD       ST    S D D       D  
   329   70 C M  I  4>S+     0   0   44  203   88  MM FF Y  FF  MM  M  M    I       L      FI       FL    F I I       M  
   330   71 C E  I  45S+     0   0  135  194   54  EE EE E  EE  EE  E  E    E       E      EE       EE    E E E       E  
   331   72 C G  I  45S+     0   0   33  250   62  GG NN G  NN  GG  G  G    G       G      NT       GG    G T T       K  
   332   73 C T  I  X5S+     0   0    2  252   41  TT TT T  TT  TT  T  T    T       T      TT       TT    T T T       T  
   333   74 C V  I  > S+     0   0   37  266   72  PP PP P  PP  PP  P  P    P       P      PP       PP    P P P       P  
   336   77 C L  H  X S+     0   0    3  266    0  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   337   78 C K  H  X S+     0   0   68  265   79  KK KK K  KK  KK  K  K    K       Q      KQ       KQ    K Q Q       K  
   338   79 C A  H  X S+     0   0   60  266   62  EQ QQ E  EQ  EE  E  K    A       E      QQ       EE    E Q Q       E  
   339   80 C L  H  X S+     0   0   13  266   12  LM LL L  ML  ML  L  L    L       L      LL       LL    L L L       L  
   340   81 C S  H  X>S+     0   0   15  266   37  AA AA A  AA  SA  A  A    A       A      AA       AA    A A A       A  
   341   82 C A  H  <5S+     0   0   80  266   70  KL EE A  AE  KA  A  A    E       K      EA       QK    Q A A       A  
   342   83 C K  H  <5S+     0   0  134  266   19  KK KK K  KK  KK  K  R    K       K      KK       KK    K K K       K  
   343   84 C Y  H  <5S-     0   0   51  266   36  FY HH H  HH  FY  Y  H    H       H      HH       HH    H H H       H  
   344   85 C N  T  <5 +     0   0   60  266   55  NN KK K  NK  NN  N  G    K       N      KN       NN    N N N       K  
   345   86 C F      < -     0   0    0  266    0  FF FF F  FF  FF  F  F    F       F      FF       FF    F F F       F  
   346   87 C L  E     -u  577   0E   6  266   11  ML LL L  LL  LL  L  L    L       L      LM       LL    L M M       M  
   347   88 C L  E     -u  578   0E   0  266   12  II II I  II  II  I  I    I       I      II       II    I I I       I  
   348   89 C F  E     -uv 579 638E   0  266    0  FF FF F  FF  FF  F  F    F       F      FF       FF    F F F       F  
   349   90 C E  E     -u  580   0E   0  266    0  EE EE E  EE  EE  E  E    E       E      EE       EE    E E E       E  
   350   91 C N  E     +     0   0E  30  266    0  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   351   92 C R  E     -     0   0E  47  266    0  RR RR R  RR  RR  R  R    R       R      RR       RR    R R R       R  
   352   93 C K  E     - v   0 640E  85  266    0  KK KK K  KK  KK  K  K    K       K      KK       KK    K K K       K  
   353   94 C F  E     + v   0 641E   3  266    0  FF FF F  FF  FF  F  F    F       F      FF       FF    F F F       F  
   354   95 C A        +     0   0   46  265   45  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   355   96 C D        -     0   0   67  265    0  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   356   97 C I    >>  +     0   0   79  265    1  II II I  II  II  I  I    I       I      II       II    I I I       I  
   357   98 C G  H 3> S-     0   0   39  265    0  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   358   99 C N  H 3> S+     0   0  113  265   28  NN NN N  NN  NN  N  N    N       N      NN       NN    N N N       N  
   359  100 C T  H <> S+     0   0   75  265    2  TT TT T  TT  TT  T  T    T       T      TT       TT    T T T       T  
   360  101 C V  H  X S+     0   0    0  265    5  VV VV V  VV  VV  V  V    V       V      VV       VV    V V V       V  
   361  102 C K  H  X S+     0   0   23  265   59  KK KK K  KK  KK  K  K    K       K      KK       KK    K K K       K  
   362  103 C L  H  X S+     0   0   92  265   78  LL LL L  LL  LL  L  L    L       S      LL       AS    A L L       L  
   363  104 C Q  H  < S+     0   0   76  265    0  QQ QQ Q  QQ  QQ  Q  Q    Q       Q      QQ       QQ    Q Q Q       Q  
   364  105 C Y  H  < S+     0   0    0  266    0  YY YY Y  YY  YY  Y  Y    Y       Y      YY       YY    Y Y Y       Y  
   365  106 C S  H  < S+     0   0   23  266   78  SA TT S  TT  TS  S  S    S       A      TA       AA    A S S       S  
   366  107 C A  S  X S+     0   0   34  266   52  SS SS S  SS  SS  S  S    S       G      SS       GG    G S S       S  
   367  108 C G  T  4 S-     0   0   60  266    0  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   368  109 C V  T  4 S+     0   0  105  266   63  VV VV V  VV  VV  V  V    V       V      VV       AV    A V V       V  
   369  110 C Y  T  4 S-     0   0   49  266   65  YY YY Y  YY  YY  Y  Y    Y       Y      YY       FY    F Y Y       Y  
   370  111 C R    ><  +     0   0   95  266   34  KK RR K  KR  KK  K  R    K       K      RR       KK    K R R       R  
   371  112 C I  G >>  +     0   0    0  266    2  II II I  II  II  I  I    I       I      II       II    I I I       I  
   372  113 C A  G 34 S+     0   0    0  266   52  AA AA V  AA  VV  V  V    V       A      AA       AA    A A A       S  
   373  114 C E  G <4 S+     0   0   81  266   60  QE EE E  EE  EQ  Q  E    E       S      EE       TS    T E E       E  
   374  115 C W  T <4 S+     0   0    3  266    0  WW WW W  WW  WW  W  W    W       W      WW       WW    W W W       W  
   375  116 C A     <  -     0   0    0  266   30  AA SS A  AS  AA  A  A    A       A      SA       SA    S A A       S  
   376  117 C D  S    S+     0   0    8  266   44  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   377  118 C I  E     +vw 609 666E   0  266    8  II II I  II  II  I  I    I       I      II       II    I I I       I  
   378  119 C T  E     - w   0 667E   0  266   42  TT TT T  TT  TT  T  T    T       T      TT       TT    T T T       T  
   379  120 C N  E     -vw 613 668E   1  266    2  NN NN N  NN  NN  N  N    N       N      NN       NN    N N N       N  
   380  121 C A  E     -vw 614 669E   0  266   41  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   381  122 C H    >   -     0   0   37  266   50  HH HH H  HH  HH  H  H    H       H      HH       HH    H H H       H  
   382  123 C G  G >  S+     0   0    5  265   79  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   383  124 C V  G 3  S+     0   0   99  266   30  VI VV V  VV  VV  V  V    V       V      VV       VV    V V V       I  
   384  125 C V  G <  S-     0   0   53  266   52  TT TT T  TT  TT  T  T    T       T      TT       TT    T T T       T  
   385  126 C G    X   -     0   0   15  266    1  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   386  127 C P  T >> S+     0   0   74  266   64  PP AA S  QA  ES  S  P    A       A      AP       AA    A P P       P  
   387  128 C G  H 3> S+     0   0   26  266   25  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       S  
   388  129 C I  H <> S+     0   0    0  266   24  II II I  II  II  I  I    I       I      IV       II    I V V       V  
   389  130 C V  H <> S+     0   0    2  266   13  VV VV V  VV  VV  V  V    V       V      VI       VV    V I I       I  
   390  131 C S  H  X S+     0   0   72  266   72  QA AA A  TA  KK  K  R    A       Q      AA       SQ    S A A       A  
   391  132 C G  H  X S+     0   0    6  266   30  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   392  133 C L  H  X S+     0   0    0  266    0  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   393  134 C K  H  X S+     0   0   54  266   67  KK KK K  KK  KK  K  K    K       K      KK       KK    K K K       K  
   394  135 C Q  H  X S+     0   0   97  266   56  QE QQ A  QQ  EE  E  Q    Q       E      QD       EE    E E E       Q  
   395  136 C A  H  X S+     0   0    1  266   60  AA GG A  GG  GA  A  A    A       A      GA       AA    A A A       A  
   396  137 C A  H  X S+     0   0    4  266   31  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   397  138 C E  H  < S+     0   0  134  266   84  QM EE E  EE  KQ  Q  E    E       Q      EK       KQ    K K K       E  
   398  139 C E  H  < S+     0   0  125  202   30  EE EE E  EE  EE  E  E    E       E      EI       EE    E L L       T  
   399  140 C V  H  < S+     0   0   51  266   88  TV VV C  TV  NN  N  n    S       V      VA       AV    A A A       A  
   400  141 C T     <  -     0   0   35  193   67  TS TT T  TT  TS  S  g    T       T      TS       ST    S S S       T  
   401  142 C K  S    S+     0   0  179  212   85  QN KK K  NK  ED  D  D    K       S      KQ       DS    D Q Q       T  
   402  143 C E  S    S-     0   0   91  218   33  EE EE E  EE  EE  E  A    E       E      EE       EE    E E E       E  
   403  144 C P        -     0   0   33  183   56  PP PP P  PP  PP  P  P    P       P      PP       PP    P P P       P  
   404  145 C R        -     0   0   20  264   15  RR RR R  RR  RR  R  R    R       R      RR       RR    R R R       R  
   405  146 C G  E     -w  638   0E   0  266   17  GG GG A  GG  GG  G  G    A       G      GG       GG    G G G       G  
   406  147 C L  E     -wx 639 699E   0  266    6  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   407  148 C L  E     -wx 640 701E   0  266   11  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   408  149 C M  E     -wx 641 702E   0  266   38  MM MM M  MM  MM  M  M    M       M      MM       MM    M M M       M  
   409  150 C L  E     + x   0 703E   3  266    2  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   410  151 C A        +     0   0    0  266    8  AA AA A  AA  AA  A  A    A       A      aA       AA    A A A       A  
   411  152 C E  S    S-     0   0   24  266   18  EE EE E  EE  EE  E  E    E       E      eE       EE    E E E       E  
   412  153 C L        -     0   0   44  266    7  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   413  154 C S        +     0   0   78  266   31  SS SS S  SS  SS  S  S    S       S      SS       SS    S S S       S  
   414  155 C C  S >  S-     0   0   79  266   22  CS SS S  SS  SS  S  S    S       S      SS       SS    S S S       S  
   415  156 C K  T 3  S+     0   0  214  266   44  KK KK K  KK  KK  K  V    K       K      KK       KK    K Q Q       A  
   416  157 C G  T 3  S+     0   0   68  265    2  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   417  158 C S    <   -     0   0   38  266   49  AS SS S  SS  SS  S  S    S       S      SS       SS    S S S       S  
   418  159 C L        +     0   0  148  266    8  LL LL L  LL  LL  L  L    L       I      LL       LI    L L L       L  
   419  160 C A        +     0   0    6  266   41  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   420  161 C T    >   -     0   0   55  266   75  YH HH H  HH  HH  H  H    H       T      HH       KT    K R R       H  
   421  162 C G  T 3> S+     0   0   20  266   28  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   422  163 C E  H 3> S+     0   0   81  266   50  EE EE E  EE  EE  E  E    A       E      EE       EE    E D D       D  
   423  164 C Y  H <> S+     0   0   59  265    0  YY YY Y  YY  YY  Y  Y    Y       Y      YY       YY    Y Y Y       Y  
   424  165 C T  H  > S+     0   0    3  266   18  TT TT T  TT  TT  T  T    T       T      TT       TT    T T T       T  
   425  166 C K  H  X S+     0   0   78  266   69  KR RR R  KR  AT  T  Q    E       E      RQ       KE    K A A       K  
   426  167 C G  H  X S+     0   0   26  266   76  GG GG G  GG  GG  G  G    G       K      GG       QK    Q G G       G  
   427  168 C T  H  X S+     0   0    2  266   58  TT TT T  TT  TT  T  T    T       T      TV       TT    T V V       V  
   428  169 C V  H  X S+     0   0   16  266   12  VV VV V  VV  VV  V  V    V       V      VV       VV    V V V       V  
   429  170 C D  H  < S+     0   0   78  266   45  DE EE D  DE  NE  E  E    G       D      EE       DD    D E E       E  
   430  171 C I  H >< S+     0   0   21  266   63  II II I  II  II  I  I    I       I      IM       II    I M M       M  
   431  172 C A  H >< S+     0   0    0  265    1  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   432  173 C K  T 3< S+     0   0   53  266   33  KQ KK K  KK  KK  K  K    R       K      KK       KK    K K K       K  
   433  174 C S  T <  S+     0   0   73  265   75  ST SS S  SS  ST  T  S    T       T      SL       TT    T L L       T  
   434  175 C D    <>  +     0   0   19  266   71  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   435  176 C K  T  4 S+     0   0   81  266   48  KK KK K  KK  KK  K  R    K       K      KK       KK    K K K       K  
   436  177 C D  T  4 S+     0   0   84  266   43  DE DD D  DD  EQ  Q  E    E       D      DD       DD    D D D       D  
   437  178 C F  T  4 S+     0   0   10  266    7  FF FF F  FF  FF  F  F    F       F      FF       FF    F F F       F  
   438  179 C V  E  <  +x  667   0E   1  266    5  VV VV V  VV  VV  V  V    V       V      VV       VV    V V V       V  
   439  180 C I  E     -     0   0E   0  265   40  IF II I  II  IF  F  I    I       I      II       II    I I I       M  
   440  181 C G  E     -xy 668 718E   0  266    0  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   441  182 C F  E     -xy 669 719E   0  266    0  FF FF F  FF  FF  F  F    F       F      FF       FF    F F F       F  
   442  183 C I  E     +xy 670 720E  10  265   12  II II I  II  II  I  I    I       I      II       II    I I I       I  
   443  184 C A        -     0   0    0  265   31  AA AA S  AA  AA  A  A    S       A      AA       AA    A A A       A  
   444  185 C Q  S    S+     0   0   34  266   53  QQ QQ Q  QQ  QQ  Q  Q    Q       Q      QQ       QQ    Q Q Q       Q  
   445  186 C R  S    S-     0   0  111  266   66  NR NN K  KN  RR  R  R    K       R      NR       NR    N R R       G  
   446  187 C D        -     0   0   41  192   77  DD DD D  DD  DG  G  D    D       D      DD       DD    D D D       D  
   447  188 C M        -     0   0   20  204   82  MM MM M  MM  MM  M  M    M       M      MM       MM    M M M       M  
   448  189 C G        +     0   0   25  210   61  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   449  190 C G    > > +     0   0    6  236   63  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   450  191 C R  G > 5S+     0   0  123  254   81  RR RR K  RR  RR  R  R    R       Q      RR       RH    R R R       R  
   451  192 C D  G 3 5S+     0   0  160  266   42  DT EE D  DE  ED  D  E    D       D      EE       DD    D A A       D  
   452  193 C E  G < 5S-     0   0  108  266   30  EE ED E  EE  EE  E  E    E       E      EE       GE    G D D       Q  
   453  194 C G  T < 5S+     0   0   55  266   45  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   454  195 C Y      < -     0   0   50  266   25  FF YY F  FY  YF  F  F    F       F      YF       FF    F F F       F  
   455  196 C D        -     0   0   39  116    5  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   456  197 C W        -     0   0   10  123    9  WW WW W  WW  WW  W  W    W       W      WW       WW    W W W       W  
   457  198 C L  E     -y  701   0E   0  266   29  LL LL L  LL  LL  L  L    L       I      LL       LI    L L L       I  
   458  199 C I  E     -y  702   0E   2  266   51  VI II I  II  II  I  I    I       I      II       II    I I I       I  
   459  200 C M  E     -yz 703 739E   0  266   26  MM MM M  MM  MM  M  M    M       M      MM       MM    M M M       M  
   460  201 C T  E     - z   0 740E   0  266   13  TT TT T  TT  TT  T  T    T       T      TT       TT    T T T       T  
   461  202 C P        +     0   0   28  266   31  PP PP P  PP  PP  P  P    P       P      PP       PP    P P P       P  
   462  203 C G  S    S+     0   0   54  266    0  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   463  204 C V              0   0   12  266   14  VV VV V  VV  VV  V  V    V       V      VV       VV    V V V       V  
   464  205 C G              0   0   61  266   52  gg gg g  gg  gg  g  g    g       g      Gg       gg    g g g       n  
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54  rr rr r  rr  rr  r  r    r       r      .r       rr    r r r       r  
   467  219 C T     >  -     0   0   79  264    8  TT TT T  TT  TT  T  T    S       T      .T       ST    S T T       S  
   468  220 C V  H  > S+     0   0   11  264   49  VV VV V  VV  VV  V  V    V       V      .V       VV    V V V       V  
   469  221 C D  H  > S+     0   0   79  265   63  DE DD D  DD  DD  D  D    N       D      .D       DD    D D D       E  
   470  222 C D  H  > S+     0   0   59  265   63  ED EE D  EE  DD  D  D    D       E      .E       TE    T E E       D  
   471  223 C V  H  X>S+     0   0    0  265   45  VV VV V  VV  VV  V  V    V       V      .V       VV    V V V       V  
   472  224 C V  H ><5S+     0   0    0  265   19  VV VV V  FV  IV  V  V    V       V      .V       VM    V V V       V  
   473  225 C S  H 3<5S+     0   0   52  266   85  TS AA S  SA  SS  S  E    S       S      LA       SS    S S S       A  
   474  226 C T  H 3<5S-     0   0   59  266   80  GT GG T  TG  TT  T  T    T       T      DD       TT    T D D       G  
   475  227 C G  T <<5S+     0   0    8  266    4  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   476  228 C S      < -     0   0    0  266   60  SS SS S  TS  SS  S  S    S       T      ST       ST    S T T       S  
   477  229 C D  S    S+     0   0    0  266    0  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   478  230 C I  E     - z   0 720E   0  266   33  II II I  II  II  I  I    I       I      IV       II    I V V       V  
   479  231 C I  E     -sz 552 721E   0  266   11  II II I  II  II  I  I    I       I      II       II    I I I       I  
   480  232 C I  E     -s  553   0E   7  266    0  II II I  II  II  I  I    I       I      II       II    I I I       I  
   481  233 C V  E     +s  554   0E   2  266   36  VV VV V  VV  VV  V  V    V       V      VV       VV    V V V       V  
   482  234 C G    >   +     0   0   22  266    0  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   483  235 C R  T 3> S+     0   0  121  266    0  RR RR R  RR  RR  R  R    R       R      RR       RR    R R R       R  
   484  236 C G  T 34 S+     0   0   21  266    0  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   485  237 C L  T <4 S+     0   0    0  266   26  LL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   486  238 C F  T  4 S+     0   0   27  266   29  FF FF F  FF  YF  F  F    F       F      FF       FF    F F F       F  
   487  239 C A  S >< S+     0   0   10  266   52  GA AA A  AA  GG  G  G    G       G      AD       GG    G D D       S  
   488  240 C K  T 3  S-     0   0  178  164   62  KK KK N  KK  KK  K  K    K       K      KK       KK    K K K       N  
   489  241 C G  T 3  S+     0   0   83  266   55  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       G  
   490  242 C R    <   -     0   0  111  266   76  RR RR R  RR  RR  R  R    R       R      RR       RR    R R R       R  
   491  243 C D     >  -     0   0   96  266   30  DD DD D  DD  DD  D  D    D       D      DD       DD    D D D       D  
   492  244 C A  H  > S+     0   0    8  266   56  PP PP P  PP  PP  P  P    P       P      PP       PP    P P P       P  
   493  245 C K  H  > S+     0   0   83  265   82  SK VV K  KV  LT  T  A    T       T      VN       NT    N N N       A  
   494  246 C V  H  > S+     0   0   81  265   81  VV VV V  TV  VA  A  R    V       V      VV       AV    A V V       V  
   495  247 C E  H  X S+     0   0   22  265   50  EE EE E  EE  EE  E  E    E       E      EE       EE    E E E       E  
   496  248 C G  H  X S+     0   0    0  265   42  GG GG G  GG  SS  S  A    G       G      GG       GG    G G G       G  
   497  249 C E  H  X S+     0   0   67  265   58  AE EE E  EE  ER  R  L    E       E      EA       ED    E A A       A  
   498  250 C R  H  X S+     0   0  141  265   28  RR RR R  RR  RR  R  R    R       R      RR       RR    R R R       R  
   499  251 C Y  H  X S+     0   0   20  265    0  YY YY Y  YY  YY  Y  Y    Y       Y      YY       YY    Y Y Y       Y  
   500  252 C R  H  X S+     0   0   41  265   36  RR RR R  RR  KR  R  R    R       R      RR       RR    R R R       R  
   501  253 C K  H  X S+     0   0  101  265   61  KK KK K  KK  KD  D  T    K       K      KK       AK    A K K       K  
   502  254 C A  H  X S+     0   0   28  265   48  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   503  255 C G  H  X S+     0   0    0  265   15  GG GG G  GG  GG  G  G    G       G      GG       GG    G G G       C  
   504  256 C W  H  X S+     0   0   22  265    0  WW WW W  WW  WW  W  W    W       W      WW       WW    W W W       W  
   505  257 C E  H  X S+     0   0   86  265   62  DD DD D  DD  ED  D  D    E       D      DE       ND    N E E       D  
   506  258 C A  H  X S+     0   0    2  265    2  AA AA A  AA  AA  A  A    A       A      AA       AA    A A A       A  
   507  259 C Y  H  < S+     0   0   25  262    0  YY YY Y  YY  YY  Y  Y    Y       Y      YY       YY    Y Y Y       Y  
   508  260 C L  H  < S+     0   0  108  258   55  IL LL L  LL  LL  L  L    L       L      LL       LL    L L L       L  
   509  261 C R  H  < S+     0   0  136  258   68  KK KK K  KK  KK  K  R    K       K      KR       KK    K R R       K  
   510  262 C R  S  < S-     0   0   31  254    5  RR RR R  RR  RR  R  R    R       R      RR       RR    R R R       R  
   511  263 C C        -     0   0   48  210   53  CC VV I  IV  CC  C  C    I       T      VI       TT    T I I          
   512  264 C G        -     0   0   35  164   41  G  GG G  GG         G    G       G      GG       GG    G G G          
   513  265 C Q              0   0  142  129   68  N  RR K  NR         R    K       Q      RQ       QQ    Q E E          
   514  266 C Q              0   0  185   69   46                           N       Q                Q                   
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    3 A K              0   0   88  128   55    KT   N N                 T            T                        T    
     2    4 A A        -     0   0   48  149   71    AQ   K K                 Q            A                        K  P 
     3    5 A T     >  -     0   0   57  246   38    ST   SSS    S       T    T            A           T     T      P TS 
     4    6 A Y  H  > S+     0   0    0  278    1    YY   YYY    Y       Y    Y            Y           Y     YY     Y YY 
     5    7 A K  H  > S+     0   0  120  278   72    ST   RRR    S       S    T            E           E     EE     S TE 
     6    8 A E  H  > S+     0   0  109  278   63    EE   EEE    E       E    Q            E           E     EA     T EA 
     7    9 A R  H >X S+     0   0    6  278    0    RR   RRR    R       R    R            R           R     RR     R RR 
     8   10 A A  H 3< S+     0   0    7  278   23    AA   SSS    A       A    A            A           A     AA     A AA 
     9   11 A A  H 3< S+     0   0   88  279   72    QN   DED    A       Q    E            A           K     EK     L NN 
    10   12 A T  H << S+     0   0  114  278   80    HA   TST    A       K    I            A           K     VK     T VV 
    11   13 A H     <  -     0   0   22  279   56    HH   STS    H       T    H            H           H     HH     H HH 
    12   14 A P  S    S+     0   0   62  280   63    KQ   STS    R       K    A            D           P     PS     Q PK 
    13   15 A S     >  -     0   0    1  281   63    SS   SSS    S       S    S            S           S     SS     S NS 
    14   16 A P  H  > S+     0   0   79  281   27    EP   PPP    P       P    P            Q           A     PA     Q AA 
    15   17 A V  H  > S+     0   0    0  283   52    VV   VVV    V       L    V       V    V           V     VT     T VF 
    16   18 A A  H  > S+     0   0    0  283   37    AA   TTT    A       V    A       A    A           A     AA     A AA 
    17   19 A A  H  X S+     0   0   18  283   69    KQ   RSR    A       K    Q       A    A           S     QA     R KA 
    18   20 A K  H  X S+     0   0   72  283   81    KR   RRR    K       K    R       R    K           R     KR     R KR 
    19   21 A L  H  X S+     0   0    0  283    2    LL   LLL    L       L    L       L    L           L     LL     L LV 
    20   22 A F  H  X S+     0   0    0  283   14    LF   FFF    L       F    F       F    L           L     LL     L LL 
    21   23 A N  H  X S+     0   0   58  283   71    TK   HQH    N       T    R       D    R           E     RN     K RK 
    22   24 A I  H  X S+     0   0    3  283   39    LL   LML    L       I    L       I    T           L     LL     L LL 
    23   25 A M  H  X>S+     0   0    0  284   48    MM   MMM    M       I    M       I    I           M     MM     M MV 
    24   26 A H  H ><5S+     0   0   74  284   50    ED   EEE    E       E    D       V    V           A     EA     S DA 
    25   27 A E  H 3<5S+     0   0  127  284   87    ET   QSQ    E       E    E       S    A           R     QA     D EA 
    26   28 A K  H 3<5S-     0   0   39  284    0    KK   KKK    K       K    K       K    K           K     KK     K KK 
    27   29 A Q  T <<5 +     0   0  110  284   53    KK   QEQ    K       K    K       Q    Q           K     KK     R KK 
    28   30 A T      < +     0   0    0  284   41    ST   SSS    S       T    T       T    S           T     TT     T ST 
    29   31 A N        +     0   0    0  284    0    NN   NNN    N       N    N       N    N           N     NN     N NN 
    30   32 A L  E     -a  229   0A   0  284   14    LL   LLL    L       L    L       L    L           L     LL     L LL 
    31   33 A C  E     -ab 230  55A   0  284   42    CC   CCC    C       C    C       C    C           C     CC     C SC 
    32   34 A A  E     -ab 231  56A   0  283   58    AA   AAA    A       A    A       A    A           A     AA     A VA 
    33   35 A S  E     - b   0  57A  15  284    9    SS   SSS    S       S    S       S    S           S     SS     S AS 
    34   36 A L        +     0   0    3  284   60    IV   VVV    L       V    V       L    L           L     VL     L VL 
    35   37 A D        +     0   0   42  284    0    DD   DDD    D       D    D       D    D           D     DD     D DD 
    36   38 A V        -     0   0    8  284    9    VV   VVV    V       V    V       V    V           V     LV     V LV 
    37   39 A R  S    S+     0   0  162  284   66    RR   RRR    R       R    K       R    R           R     TT     T TT 
    38   40 A T     >  -     0   0   42  284   42    ST   TST    K       S    T       T    S           S     KT     T KT 
    39   41 A T  H  > S+     0   0    4  284   55    TS   TTT    T       T    T       T    T           T     TT     S KT 
    40   42 A K  H  > S+     0   0  115  284   69    SQ   KKK    A       S    S       S    A           A     AA     A NK 
    41   43 A E  H  > S+     0   0   74  284   28    EE   EEE    E       Q    E       E    Q           E     DE     E QE 
    42   44 A L  H  X S+     0   0    4  284   11    FL   LLL    L       F    F       L    L           F     IL     L VL 
    43   45 A L  H  X S+     0   0   40  284    4    LL   LLL    L       L    L       L    L           L     LL     L LI 
    44   46 A E  H  X S+     0   0  112  284   81    TS   SSS    R       D    N       S    E           R     SA     S EE 
    45   47 A L  H  X S+     0   0   19  284   26    LL   LLL    L       L    L       I    I           L     LL     L LL 
    46   48 A V  H  X S+     0   0    0  283   55    VV   VVV    V       I    I       L    L           L     XA     A VA 
    47   49 A E  H  < S+     0   0   79  284   22    DE   DDD    E       E    E       D    D           D     ED     D DD 
    48   50 A A  H  < S+     0   0   24  284   75    KK   KKK    V       K    K       R    Q           T     KK     K KK 
    49   51 A L  H >X S+     0   0    0  282   33    LL   LLL    L       L    L       I    I           L     VL     L IV 
    50   52 A G  G >< S+     0   0    0  282    3    GG   GGG    G       G    G       G    G           G     GG     G GG 
    51   53 A P  G 34 S+     0   0   50  284   18    PP   PPP    P       P    P       P    P           P     PP     P PP 
    52   54 A K  G <4 S+     0   0   45  284   77    FY   YFY    Y       Y    Y       Y    Y           Y     NY     Y SY 
    53   55 A I    <<  -     0   0    0  284   14    II   III    I       I    I       I    I           I     II     I IV 
    54   56 A C  S    S+     0   0    1  283   49    CC   CCC    C       C    C       C    C           A     CV     C CC 
    55   57 A L  E     -bc  31  85A   0  283   32    ML   LLL    L       V    V       M    M           V     LM     M LM 
    56   58 A L  E     -bc  32  86A   1  283   30    VV   VVV    L       V    V       V    V           V     VV     V LI 
    57   59 A K  E     -bc  33  87A  20  283    2    KK   KKK    K       K    K       K    K           K     KK     K KK 
    58   60 A T  E     - c   0  88A   2  281    3    TT   TTT    T       T    T       T    T           S     TT     T TT 
    59   61 A H    >>  +     0   0   18  281    2    HH   HHH    H       H    H       H    H           H     HH     H HH 
    60   62 A V  G >4  +     0   0    2  283   49    II   III    V       I    I       I    V           V     MI     V II 
    61   63 A D  G 34 S+     0   0   18  283    2    DD   DDD    D       D    D       D    D           D     DD     D DD 
    62   64 A I  G <4 S+     0   0   15  283   18    II   III    I       I    I       I    I           I     II     I II 
    63   65 A L    <<  -     0   0   15  284   28    II   III    L       L    I       I    I           L     VI     I VI 
    64   66 A T  S    S+     0   0   99  284   65    DD   DDD    E       D    D       D    D           D     DS     S ED 
    65   67 A D  S    S+     0   0   33  284    1    DD   DDD    D       D    D       D    D           D     DD     D DD 
    66   68 A F        +     0   0   29  284    6    FF   FFF    F       F    F       F    F           F     FF     F FF 
    67   69 A S     >> -     0   0   39  279   61    TS   SSS    S       S    S       E    E           T     ST     T DT 
    68   70 A M  I  4>S+     0   0   38  283   97    YY   YYY    F       Y    Y       Y    P           F     YY     Y .Y 
    69   71 A E  I  45S+     0   0  109  157   60    DE   EEE    E       E    E       D    A           E     EA     D AA 
    70   72 A G  I  45S+     0   0   16  283   60    GG   EDE    N       K    G       T    R           G     TG     E DG 
    71   73 A T  I  X5S+     0   0    2  283   43    TT   TTT    T       T    T       T    T           T     TT     T MT 
    72   74 A V  I  > S+     0   0   37  284   73    PP   PPP    P       P    P       G    G           P     PP     K QP 
    75   77 A L  H  X S+     0   0    2  284    1    LL   LLL    L       L    L       L    L           M     LL     L LL 
    76   78 A K  H  X S+     0   0   64  283   80    VL   LLL    K       L    L       K    K           V     LV     V VK 
    77   79 A A  H  X S+     0   0   60  284   64    EE   EEE    Q       E    E       Q    R           E     KA     A AE 
    78   80 A L  H  X S+     0   0   14  284   11    LL   LLL    L       L    L       L    L           L     LL     L LL 
    79   81 A S  H  X>S+     0   0   14  284   35    SS   SSS    A       K    S       S    A           A     AA     A AA 
    80   82 A A  H  <5S+     0   0   81  284   70    KK   KKK    E       K    K       T    E           K     KH     K EL 
    81   83 A K  H  <5S+     0   0  142  284   20    KK   KKK    K       K    K       K    K           K     KK     K KK 
    82   84 A Y  H  <5S-     0   0   52  284   36    HH   HHH    H       F    Y       H    H           H     YH     H HH 
    83   85 A N  T  <5 +     0   0   64  284   57    KN   KNK    K       N    N       N    N           D     NN     G KG 
    84   86 A F      < -     0   0    3  284    0    FF   FFF    F       F    F       F    F           F     FF     F FF 
    85   87 A L  E     -c   55   0A   8  284   10    LM   MMM    L       L    M       L    L           M     MM     M LF 
    86   88 A L  E     -c   56   0A   0  284   12    II   III    I       I    I       I    I           I     IL     I IL 
    87   89 A F  E     -cd  57 116A   0  284    0    FF   FFF    F       F    F       F    F           F     FF     F FF 
    88   90 A E  E     -c   58   0A   0  284    0    EE   EEE    E       E    E       E    E           E     EE     E EE 
    89   91 A N  E     +     0   0A   4  284    0    DD   DDD    D       D    D       D    D           D     DD     D DD 
    90   92 A R  E     -     0   0A  40  284    0    RR   RRR    R       R    R       R    R           R     RR     R RR 
    91   93 A K  E     - d   0 118A  36  284    0    KK   KKK    K       K    K       K    K           K     KK     K KK 
    92   94 A F  E     + d   0 119A   4  284    0    FF   FFF    F       F    F       F    F           F     FF     F FF 
    93   95 A A        +     0   0    6  283   47    AA   AAA    A       A    A       A    A           A     AA     A AA 
    94   96 A D        -     0   0   13  283    0    DD   DDD    D       D    D       D    D           D     DD     D DD 
    95   97 A I    >>  +     0   0   57  283    1    II   III    I       I    M       I    I           I     II     I II 
    96   98 A G  H 3> S-     0   0   37  283    0    GG   GGG    G       G    G       G    G           G     GG     G GG 
    97   99 A N  H 3> S+     0   0  113  283   28    NN   NNN    N       N    N       S    S           S     NS     N NN 
    98  100 A T  H <> S+     0   0   17  283    1    TT   TTT    T       T    T       T    T           T     TT     T TT 
    99  101 A V  H  X S+     0   0    0  283    3    VV   VVV    V       V    V       V    V           V     VV     V VV 
   100  102 A K  H  X S+     0   0   21  283   59    KK   KKK    K       K    K       K    K           K     KK     K KK 
   101  103 A L  H  X S+     0   0   63  283   75    AS   HNH    L       L    S       A    A           A     LN     N LH 
   102  104 A Q  H  < S+     0   0   28  283    0    QQ   QQQ    Q       Q    Q       Q    Q           Q     QQ     Q QQ 
   103  105 A Y  H  < S+     0   0    0  284    0    YY   YYY    Y       Y    Y       Y    Y           Y     YY     Y YY 
   104  106 A S  H  < S+     0   0   26  284   77    SA   TTT    T       S    S       A    A           A     KA     S SK 
   105  107 A A     X  +     0   0   38  284   52    GG   GGG    S       A    G       G    G           G     GS     K AN 
   106  108 A G  T  4 S-     0   0   47  284    0    GG   GGG    G       G    G       G    G           G     GG     G GG 
   107  109 A V  T  4 S+     0   0   67  284   67    AV   VVV    V       I    V       V    V           V     LV     V VV 
   108  110 A Y  T  4 S-     0   0   37  284   72    FY   YYY    Y       Y    Y       F    Y           Y     YY     Y YY 
   109  111 A R    ><  -     0   0   93  284   34    KK   KKK    R       K    K       K    R           K     KR     R KR 
   110  112 A I  G >> S+     0   0    1  284    2    IV   III    I       I    I       I    I           I     VI     I II 
   111  113 A A  G 34 S+     0   0    0  284   58    AA   AAA    A       S    S       A    A           A     AV     V AA 
   112  114 A E  G <4 S+     0   0   71  284   59    KQ   KKK    E       S    K       Q    E           Q     KQ     E SE 
   113  115 A W  T <4 S+     0   0    2  284    0    WW   WWW    W       W    W       W    W           W     WW     W WW 
   114  116 A A     <  -     0   0    0  284   29    AA   AAA    S       A    S       A    A           S     AA     A AS 
   115  117 A D  S    S+     0   0   10  284   44    DD   DDD    D       D    D       D    D           D     DD     D DD 
   116  118 A I  E     +de  87 144A   0  284    8    II   LLL    I       I    I       I    I           F     II     I II 
   117  119 A T  E     - e   0 145A   0  284   42    TT   TTT    T       S    T       T    T           T     TT     T TT 
   118  120 A N  E     -de  91 146A   0  284    3    NN   NNN    N       N    N       N    N           N     NN     N NN 
   119  121 A A  E     -de  92 147A   0  284   46    AA   AAA    A       A    A       A    A           A     AA     A CA 
   120  122 A H        -     0   0    0  284   53    HH   HHH    H       H    H       H    H           H     HH     H HH 
   121  123 A G  S >  S+     0   0    0  283   80    GG   GGG    G       G    G       G    G           S     GG     S TG 
   122  124 A V  T 3  S+     0   0    0  284   33    VI   VVV    V       V    I       V    V           V     VV     V VV 
   123  125 A V  T 3  S-     0   0    4  284   51    TT   TTT    T       P    T       P    P           P     TP     P PP 
   124  126 A G    X   -     0   0    0  284    1    GG   GGG    G       G    G       G    G           G     GG     G GG 
   125  127 A P  T >> S+     0   0   44  284   67    ST   EEE    A       Q    E       P    P           E     PD     E ET 
   126  128 A G  H 3> S+     0   0   25  284   30    GG   GGG    G       G    G       G    G           G     GG     G GG 
   127  129 A I  H <> S+     0   0    0  284   36    II   VIV    I       I    I       I    I           I     II     I II 
   128  130 A V  H <> S+     0   0    2  284   13    VV   VVV    V       V    V       V    V           V     VV     I II 
   129  131 A S  H  X S+     0   0   71  284   73    HQ   KKK    A       A    K       S    S           K     AK     N SA 
   130  132 A G  H  X S+     0   0    7  284   35    GG   GGG    G       G    G       G    G           G     GG     G GG 
   131  133 A L  H  X S+     0   0    0  284    1    LL   LLL    L       L    L       L    L           L     LL     L LL 
   132  134 A K  H  X S+     0   0   50  284   66    KK   KKK    K       K    K       E    E           Q     KE     R KR 
   133  135 A Q  H  X S+     0   0   93  284   56    QE   EEE    Q       Q    E       E    E           E     QA     E EA 
   134  136 A A  H  X S+     0   0    0  284   57    AA   GGG    G       A    A       A    A           A     AA     A VG 
   135  137 A A  H  X S+     0   0    6  284   28    AA   AAA    A       A    A       A    A           A     AA     A GA 
   136  138 A E  H  < S+     0   0  132  284   84    SK   QNQ    E       Q    V       K    R           Q     ET     n Le 
   137  139 A E  H  < S+     0   0  129  222   34    EE   EEE    E       E    E       E    E           E     EE     a .k 
   138  140 A V  H  < S+     0   0   49  284   90    TT   TTT    V       T    T       T    A           T     Ty     k Pe 
   139  141 A T     <  -     0   0   33  208   67    TT   TTT    T       T    T       T    T           T     Th     c .d 
   140  142 A K  S    S+     0   0  181  232   87    NS   DND    K       Q    S       D    S           D     SP     E .Y 
   141  143 A E  S    S-     0   0   78  236   37    EE   EEE    E       E    E       E    E           E     Eg     n Le 
   142  144 A P        -     0   0   37  195   61    PP   APA    P       P    P       P    P           P     Pd     d Gs 
   143  145 A R        -     0   0   15  282   12    RR   RRR    R       R    R       R    R           R     RR     R RQ 
   144  146 A G  E     -e  116   0A   0  284   15    GG   GGG    G       G    G       G    G           G     GG     G GY 
   145  147 A L  E     -ef 117 177A   0  284    4    LL   LLL    L       L    L       L    L           L     LL     L LK 
   146  148 A L  E     -ef 118 179A   0  284    8    LL   LLL    L       L    L       V    L           I     LI     I LE 
   147  149 A M  E     -ef 119 180A   0  284   38    MM   MMM    M       M    M       M    M           M     MM     M LF 
   148  150 A L  E     + f   0 181A   3  284    1    LL   LLL    L       L    L       L    L           L     LL     L LL 
   149  151 A A        +     0   0    0  284    7    AA   AAA    a       A    A       A    A           A     aA     A Av 
   150  152 A E  S    S-     0   0   27  283   23    EE   EEE    e       E    E       E    E           E     lE     E Ee 
   151  153 A L        -     0   0   23  283    7    LL   LLL    L       L    L       L    L           L     FL     L ML 
   152  154 A S        +     0   0   75  283   27    SS   SSS    S       S    S       S    S           S     LS     S SS 
   153  155 A C  S >  S-     0   0   28  284   20    SS   SSS    S       S    S       S    S           S     KS     S SC 
   154  156 A K  T 3  S+     0   0  188  284   47    KK   KKK    K       K    K       K    Q           K     RK     K KK 
   155  157 A G  T 3  S+     0   0   44  283    1    GG   GGG    G       G    G       G    G           G     XG     G GG 
   156  158 A S    <   -     0   0   36  284   53    SS   SSS    S       S    S       T    S           S     NS     S TS 
   157  159 A L        +     0   0   20  284   10    LL   LLL    L       I    L       L    L           L     CL     L LL 
   158  160 A A        +     0   0   18  284   49    AA   AAA    A       A    A       A    A           A     TA     A AA 
   159  161 A T     >  -     0   0   66  284   73    QY   YYY    H       T    Y       H    K           V     WT     T TT 
   160  162 A G  H  > S+     0   0   48  284   37    GG   GGG    G       G    G       G    G           G     SG     G GG 
   161  163 A E  H  > S+     0   0  123  284   48    EE   EEE    E       E    E       E    E           E     VE     S SE 
   162  164 A Y  H  > S+     0   0    9  283    0    YY   YYY    Y       Y    Y       Y    Y           Y     HY     Y YY 
   163  165 A T  H  X S+     0   0    3  284   16    TT   SSS    T       T    S       S    S           T     KT     T TS 
   164  166 A K  H  X S+     0   0  112  284   70    QE   KKK    R       E    E       Q    R           Q     GQ     T QK 
   165  167 A G  H  X S+     0   0   13  284   74    KK   KKK    G       K    K       A    G           K     NK     K AQ 
   166  168 A T  H  X S+     0   0    0  284   59    TT   TTT    T       T    T       T    T           T     CT     T TT 
   167  169 A V  H  X S+     0   0   15  284   12    VI   IVI    V       I    I       V    V           V     RV     V LI 
   168  170 A D  H  X S+     0   0   84  284   43    ED   DED    E       D    E       D    E           E     YE     E EE 
   169  171 A I  H >< S+     0   0    9  284   69    II   III    I       I    I       I    I           I     CI     L LL 
   170  172 A A  H >< S+     0   0    0  283    1    AA   AAA    A       A    A       A    A           A     XA     A AA 
   171  173 A K  H 3< S+     0   0   51  284   31    KK   KKK    K       R    K       R    R           R     KK     H ER 
   172  174 A S  T << S+     0   0   75  283   74    ES   TTT    S       S    C       S    S           N     PN     N KS 
   173  175 A D    <>  +     0   0   26  284   68    DD   DDD    D       D    D       N    N           N     IN     N HD 
   174  176 A K  T  4 S+     0   0   75  284   44    KR   KKK    K       K    K       R    R           K     RK     S NP 
   175  177 A D  T  4 S+     0   0   90  284   44    EE   DED    D       E    E       A    R           G     TQ     D DE 
   176  178 A F  T  4 S+     0   0    8  284    5    FF   FFF    F       F    F       F    F           F     LF     F FF 
   177  179 A V  E  <  +f  145   0A   1  284    4    IV   VVV    V       V    V       V    V           V     LV     V CV 
   178  180 A I  E     -     0   0A   0  283   40    II   MMM    I       V    I       F    F           F     XF     F MV 
   179  181 A G  E     -fg 146 196A   0  284    0    GG   GGG    G       G    G       G    G           G     AG     G GG 
   180  182 A F  E     -fg 147 197A   0  284    0    FF   FFF    F       F    F       F    F           F     FF     F FF 
   181  183 A I  E     +fg 148 198A  10  283   12    II   III    I       I    .       I    I           I     II     I II 
   182  184 A A        -     0   0    0  283   33    SA   AAA    A       A    .       A    A           A     AA     A AA 
   183  185 A Q  S    S+     0   0   34  284   49    QQ   QQQ    Q       Q    I       Q    Q           Q     QQ     Q RQ 
   184  186 A R  S    S-     0   0  108  284   68    RR   NNN    N       R    A       Q    N           N     HN     n RN 
   185  187 A D        -     0   0   38  204   79    EE   YYY    D       K    Q       K    A           R     S.     e R. 
   186  188 A M        -     0   0   22  215   84    FV   MMM    M       I    R       .    M           M     MR     V F. 
   187  189 A G        +     0   0   24  220   62    G.   GGG    G       E    A       .    G           P     GM     Q PR 
   188  190 A G    > > +     0   0   12  245   65    G.   GGG    G       A    V       V    T           E     GD     D GP 
   189  191 A R  G > 5S+     0   0  123  260   82    YV   TTT    R       K    E       G    P           D     EE     S LK 
   190  192 A D  G 3 5S+     0   0  175  284   41    DE   DDD    E       D    A       K    D           A     AA     E KG 
   191  193 A E  G < 5S-     0   0  111  284   28    ED   EEE    E       D    E       P    E           E     EA     G SD 
   192  194 A G  T < 5S+     0   0   49  284   45    GG   GGG    G       D    G       E    D           T     GD     N DS 
   193  195 A Y      < -     0   0   42  284   24    YF   FFF    Y       E    F       E    W           E     FE     y FE 
   194  196 A D        -     0   0   38  116    1    DD   DDD    D       D    D       D    .           D     DD     d .D 
   195  197 A W        -     0   0   12  124    7    WW   WWW    W       W    W       W    .           W     WF     W .W 
   196  198 A L  E     -g  179   0A   0  284   28    LI   VVV    L       V    I       V    L           L     LL     L IL 
   197  199 A I  E     -g  180   0A   1  284   59    II   III    I       V    V       I    I           I     IV     I HI 
   198  200 A M  E     -gh 181 228A   0  284   23    MM   MMM    M       M    M       M    L           L     LL     L ML 
   199  201 A T  E     - h   0 229A   0  284   11    TT   TTT    T       T    T       T    T           T     TT     T TT 
   200  202 A P        +     0   0   31  284   27    PP   PPP    P       P    P       P    P           P     PP     P PP 
   201  203 A G  S    S+     0   0   33  284    0    GG   GGG    G       G    G       G    G           G     GG     G GG 
   202  204 A V  E     +i  216   0B   8  284   31    VV   VVV    V       V    V       V    V           V     VV     V VV 
   203  205 A G  E     -i  217   0B   3  283   56    GG   GGG    .       G    G       G    G           G     GG     G GG 
   204  206 A L        -     0   0   35  283    8    LL   LLL    .       L    L       L    L           L     LL     L LL 
   205  207 A D        -     0   0   97  283   62    DD   DDD    .       D    D       D    D           D     DD     D DD 
   206  208 A D    >   -     0   0   41  283   76    ED   DDD    .       D    D       D    D           D     DD     D VD 
   207  209 A K  T 3  S+     0   0  216  283   49    KK   KKK    .       K    K       K    K           K     KK     K KK 
   208  210 A G  T 3  S+     0   0   77  258   14    GG   GGG    .       G    G       G    G           G     GG     G GG 
   209  211 A D    <>  +     0   0   42  265    9    DD   DDD    .       D    D       D    D           D     DD     D DD 
   210  212 A A  T  4 S+     0   0   76  266   64    GS   NNN    .       A    G       G    G           G     SG     G GA 
   211  213 A L  T >4 S+     0   0   87  267   44    LL   LLL    .       L    L       L    L           L     LL     L LL 
   212  214 A G  G >4 S+     0   0    9  281   17    GG   GGG    .       G    G       G    G           G     GG     G GG 
   213  215 A Q  G 3< S+     0   0   89  282   19    QQ   QQQ    .       Q    Q       Q    Q           Q     QQ     Q QQ 
   214  216 A Q  G <  S+     0   0  148  282    3    QQ   QQQ    .       Q    Q       Q    Q           Q     QQ     Q QQ 
   215  217 A Y  S <  S-     0   0  109  282    0    YY   YYY    .       Y    Y       Y    Y           Y     YY     Y YY 
   216  218 A R  E     -i  202   0B  69  282   57    RR   RRR    .       R    R       R    R           R     RR     R RR 
   217  219 A T  E  >  -i  203   0B  45  282    7    TT   TST    .       T    T       T    T           T     TP     T TT 
   218  220 A V  H  > S+     0   0    0  282   47    VV   VVV    .       V    V       V    V           V     VV     V PV 
   219  221 A D  H  > S+     0   0   71  282   63    DD   DDD    .       S    D       D    N           D     ND     D EE 
   220  222 A D  H  > S+     0   0   67  282   64    DE   EEE    .       E    E       D    E           T     DT     T ED 
   221  223 A V  H  X>S+     0   0    0  282   45    VV   VVV    .       V    V       V    V           V     VV     V VV 
   222  224 A V  H ><5S+     0   0    0  283   19    FI   IVI    G       V    V       I    I           I     IV     I IM 
   223  225 A S  H 3<5S+     0   0   78  284   81    SS   SSS    L       T    S       E    A           E     SK     K CS 
   224  226 A T  H 3<5S-     0   0   58  284   84    TT   KNK    D       g    T       T    N           G     TG     N eT 
   225  227 A G  T <<5S+     0   0    6  284    3    GG   GGG    G       g    G       G    G           G     GG     G qG 
   226  228 A S      < -     0   0    0  284   59    TT   TTT    S       S    T       T    S           S     SS     S ST 
   227  229 A D  S    S+     0   0    0  284    0    DD   DDD    D       D    D       D    D           D     DD     D DD 
   228  230 A I  E    S- h   0 198A   0  284   31    LI   VVV    I       I    I       V    V           V     IV     V II 
   229  231 A I  E     -ah  30 199A   0  284   19    II   III    I       I    I       I    I           I     II     I II 
   230  232 A I  E     -a   31   0A   6  284    0    II   III    I       I    I       I    I           I     II     I II 
   231  233 A V  E     +a   32   0A   1  284   33    VV   VVV    V       V    V       V    V           V     VV     V VV 
   232  234 A G    >   +     0   0   23  284    0    GG   GGG    G       G    G       G    G           G     GG     G GG 
   233  235 A R  G >> S+     0   0  126  284    0    RR   RRR    R       R    R       R    R           R     RR     R RR 
   234  236 A G  G 34 S+     0   0   18  284    0    GG   GGG    G       G    G       G    G           G     GG     G GG 
   235  237 A L  G <4 S+     0   0    0  284   25    LL   LLL    L       L    L       L    L           L     LL     L VL 
   236  238 A F  T <4 S+     0   0   24  284   34    FF   FFF    F       I    F       Y    Y           F     FF     F YY 
   237  239 A A  S >< S+     0   0   22  284   59    GG   GGG    A       G    G       S    G           A     GG     G GG 
   238  240 A K  T 3  S-     0   0  176  165   62    KK   KKK    K       A    K       K    K           K     KK     K SQ 
   239  241 A G  T 3  S+     0   0   84  284   53    GG   GGG    G       G    G       G    G           G     GG     G GN 
   240  242 A R    <   -     0   0   78  284   77    RR   RRR    R       R    R       R    R           R     RR     R RR 
   241  243 A D     >  -     0   0   91  284   27    DD   DDD    D       D    N       D    D           D     DD     D DD 
   242  244 A A  H  > S+     0   0    8  284   53    PS   PPP    P       P    P       P    P           P     PP     P AP 
   243  245 A K  H  > S+     0   0   92  283   82    EE   VVV    V       V    K       V    V                 VV     V AI 
   244  246 A V  H  > S+     0   0   79  283   82    AV   VVV    V       A    E       H    H                 VA     V QE 
   245  247 A E  H  X S+     0   0   23  283   47    EE   EEE    E       E    E       E    E                 EE     E EE 
   246  248 A G  H  X S+     0   0    0  283   40    GG   GGG    G       G    G       A    A                 SG     G AA 
   247  249 A E  H  X S+     0   0   55  283   56    RR   KKK    E       L    K       Q    Q                 KK     K EK 
   248  250 A R  H  X S+     0   0   78  283   26    RR   RRR    R       R    R       R    R                 RR     R RR 
   249  251 A Y  H  X S+     0   0    9  283    0    YY   YYY    Y       Y    Y       Y    Y                 YY     Y YY 
   250  252 A R  H  X S+     0   0   37  283   33    QR   KKK    R       R    R       Q    Q                 RR     R RQ 
   251  253 A K  H  X S+     0   0   95  283   64    DD   EEE    K       K    D       K    K                 DD     D KK 
   252  254 A A  H  X S+     0   0   16  283   49    AA   AAA    A       A    A       A    A                 AA     A AA 
   253  255 A G  H  X S+     0   0    0  283   20    GG   GGG    G       G    G       G    G                 GG     G GG 
   254  256 A W  H  X S+     0   0   19  283    0    WW   WWW    W       W    W       W    W                 WW     W WW 
   255  257 A E  H  X S+     0   0   83  283   62    KN   NNN    D       D    N       N    E                 SN     K EE 
   256  258 A A  H  X S+     0   0    1  283    1    AA   AAA    A       A    A       A    A                 AA     A AA 
   257  259 A Y  H  < S+     0   0   21  281    0    YY   YYY    Y       Y    Y       Y    Y                 YY     Y YY 
   258  260 A L  H  < S+     0   0  113  277   62    LL   LLL    L       L    L       L    L                 LL     E QQ 
   259  261 A R  H  <        0   0  157  277   66    NK   KKK    K       A    K       R    K                 NE     E RK 
   260  262 A R     <        0   0   89  273    4    RK   RRR    R       R    K       K    R                 RR     R R  
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58                          STT TN   D  T T  KK     TKKT KN N   TT       T
   263    4 C A        -     0   0   31  121   71                          ENE EK  PVQ E EA AAA   AEAAQ AK K   QA       K
   264    5 C T     >  -     0   0   47  219   38   T   S     S T TTSTPTS TSST TTTTSST TTTS STSTTTSTTST SSSST  TAT T    P
   265    6 C Y  H  > S+     0   0    0  253    0  YY  YYY    YYY YYYYYYY YYYY YYYYYYY YYYY YYYYYYYYYYY YYYYY  YYY Y Y  Y
   266    7 C K  H  > S+     0   0  122  253   72  TP  AGA    GAA ETTTSTT TTST TTTTSGT TSTK SSKTSSKTSST SRRRS  TEE E E  S
   267    8 C E  H  > S+     0   0   70  253   62  QQ  EEE    EEQ EQQTKEA QSQE EETTTEQ EEEE EEEEEAEEEEE EEEEE  QEE E A  T
   268    9 C R  H  X S+     0   0    2  253    1  RR  RRR    RRR RRRRRRR RRRR RRRRRRR RRRR RRRRRRRRRRR RRRRR  RRR R R  R
   269   10 C A  H  < S+     0   0   21  253   21  AA  AAA    AAA AAAAAAA AAAA AAAAAAA AAAS AASAAASAAAA ASSSA  AAA A A  A
   270   11 C A  H  < S+     0   0   47  253   71  EE  NKN    KNA EEESESA EDES SNSSAKE SESE QQESEEESQQN QDEDQ  EAK E K  L
   271   12 C T  H  < S+     0   0   31  253   83  AA  TST    STA VKITVAK KKLK KVTTAVS KTKS HHSATTSKHHA HTSTK  IAK V K  T
   272   13 C H     <  -     0   0   13  254   44  HH  HHH   HHHH HHHHHHH HHSH HHHHHHH HHHH HHHHHHHHHHH HSTST  HHH H H  H
   273   14 C P  S    S+     0   0   45  257   60  PP  QPQ   PPQP PAPPPPP AGSP PPPPPAQ PAPT KKTPAATPKKQ KSTSK  ADP P S  Q
   274   15 C S     >  -     0   0    0  257   59  SS  SSS   SSSS SSSSSSS SSSS SSSSSSS SSSS SSSSSSSSSSS SSSSS  SSS S S  S
   275   16 C P  H  > S+     0   0   82  261   28  PP  PKP   PKPP PPPPPPP PPPK KPPPPPP KPKP EEPKPPPKEEP EPPPP  PQA P A  Q
   276   17 C V  H  > S+     0   0    0  264   54  LL  VVV   LVVV VVVVVVV VVVV VVVVVVV VVVV VVVVVVVVVVV VVVVL  VVVVV T  T
   277   18 C A  H  > S+     0   0    0  264   29  AA  AAA   AAAA AAAAAAA AATA AAAAAAA AAAA AAAAAAAAAAA ATTTV  AAAAA A  A
   278   19 C A  H  X S+     0   0   22  264   67  KK  RSR   KSRR QSQQRQQ SQRQ QQQQRRQ QQQR KKRQQQRQKKQ KRSRK  QASAQ A  R
   279   20 C K  H  X S+     0   0   73  264   74  RR  RRR   RRRR KRRRRRR RKRR RRRRKRR RRRR KKRRRRRRKKR KRRRK  RKRRK R  R
   280   21 C L  H  X S+     0   0    0  265    2  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLL L  L
   281   22 C F  H  X S+     0   0    0  265   13  FF  FLF   FLFL LLLFFFL LLFF FFFFLFF FFFF LLFFFFFFLLF LFFFF  FLLFL L  L
   282   23 C N  H  X S+     0   0   69  265   71  TG  ANA   SNAN RRRHNKR RRNQ QNHHAEK QRQS TTSRRRSQTTK THQHT  RREDR N  K
   283   24 C I  H  X S+     0   0    2  265   41  VV  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLI LLILLLILLLL LLMLI  LTLIL L  L
   284   25 C M  H  X>S+     0   0    0  266   52  MM  MMM   MMMM MMMMMMM MMMM MMMMMMM MMMM MMMMMMMMMMM MMMMI  MIMIM M  M
   285   26 C H  H  <5S+     0   0   75  266   50  EE  EEE   EEEE EEDDEDD EDEE EDDDDED EEEE EEEEEEEEEED EEEEE  DVAVE A  S
   286   27 C E  H  <5S+     0   0  112  266   83  QS  QSQ   SSQS QASTTNT AQES SSTTEKS SSSE EEESSSESEET EQSQE  EARSQ A  D
   287   28 C K  H  <5S-     0   0   40  266    0  KK  KKK   KKKK KKKKKKK KKKK KKKKKKK KKKK KKKKKKKKKKK KKKKK  KKKKK K  K
   288   29 C Q  T  <5 +     0   0  109  266   48  KK  QQQ   KQQK KKKKKKK KKKK KKKKKQK KKKK KKKKKKKKKKK KQEQK  KQKQK K  R
   289   30 C T      < +     0   0    0  266   40  SS  STS   TTST TSTTTTT STST TTTASST TTTS SSSTTTSTSST SSSST  TSTTT T  T
   290   31 C N        +     0   0    0  266    0  NN  NNN   NNNN NNNNNNN NNNN NNNNNNN NNNN NNNNNNNNNNN NNNNN  NNNNN N  N
   291   32 C L  E     -s  740   0E   0  266   15  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLL L  L
   292   33 C C  E     -st 741 577E   0  266   47  CC  CCC   CCCC CCCCCCC CCCC CCCCCCC CCCC CCCCCCCCCCC CCCCC  CCCCC C  C
   293   34 C A  E     -st 742 578E   0  265   57  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AAAAA A  A
   294   35 C S  E     - t   0 579E  14  266   11  SS  SSS   SSSS SSSSSSS SSSS SSSSSSS SSSS SSSSSSSSSSS SSSSS  SSSSS S  S
   295   36 C L        +     0   0    2  266   60  II  VVV   VVVV VVVVVVV VVII IVVVVIV IIIL IILIIILIIIV IVVVV  VLLLV L  L
   296   37 C D        +     0   0   54  266    0  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DDDDD D  D
   297   38 C V        -     0   0    6  266   11  VV  VVV   VVVL LVVVLVV VVVV VVVVVVV VVVI VVIVVVIVVVV VVVVV  VVVVL V  V
   298   39 C R  S    S+     0   0  150  266   65  KR  RTR   RTRT TSRQTKK SQRP PRQQTSK PDPT RRTTDDTPRRR RRRRR  KRRRT T  T
   299   40 C T     >  -     0   0   17  266   45  TT  TKT   TKTS KTTTTST TTTT TTTTTST TTTE SSETTTETSST STSTS  TSSTK T  T
   300   41 C T  H  > S+     0   0   13  266   53  TT  TTT   TTTT TTTTTTT TSTT TTTTTTT TTTT TTTTTTTTTTS TTTTT  TTTTT T  S
   301   42 C K  H  > S+     0   0  139  266   68  DK  KQK   EQKK AASSKEA ASAK KASSADS KKKE SSEAKKEKSSQ SKKKS  SAASA A  A
   302   43 C E  H  > S+     0   0   77  266   31  EE  EEE   EEED DEEEEEE EEEE EEEEEEE EEEK EEKEEEKEEEE EEEEQ  EQEED E  E
   303   44 C L  H  X S+     0   0    5  266   12  FF  LLL   LLLL IFLFIFF FFFF FFFFLLF FFFL FFLFFFLFFFL FLLLF  FLFLI L  L
   304   45 C L  H  X S+     0   0   40  266    4  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLL L  L
   305   46 C E  H  X S+     0   0  108  266   75  SE  EEE   KEEE SASSDTS ASLS SASSAKS SESS TTSSEESSTTS TSSSD  NERSS A  S
   306   47 C L  H  X S+     0   0   29  266   27  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLI LLILLLILLLL LLLLL  LILIL L  L
   307   48 C V  H  X S+     0   0    0  265   56  VV  LLL   VLLL VIIILII IIVI IIIIVVI IIIL VVLIIILIVVV VVVVI  ILLLX A  A
   308   49 C E  H  < S+     0   0   77  266   24  DD  DDD   DDDD EDDDEED DDDD DDDDEED DDDD DDDDDDDDDDE DDDDE  EDDDE D  D
   309   50 C A  H  < S+     0   0   26  266   77  TT  KKK   TKKK KKKKKKK KKKK KKKKKKK KKKT KKTKKKTKKKK KKKKK  KQTRK K  K
   310   51 C L  H >X S+     0   0    0  263   31  LL  LLL   LLLL VLLLVLL LLLL LLLLLLL LLLI LLILLLILLLL LLLLL  LILIV L  L
   311   52 C G  G >< S+     0   0    0  263    2  GG  GGG   GGGG GGGGGGG GGGG GGGGAGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   312   53 C P  G 34 S+     0   0   48  266   17  PP  PPP   PPPP PPPPPPP PPPP PPPPPPP PPPP PPPPPPPPPPP PPPPP  PPPPP P  P
   313   54 C K  G <4 S+     0   0   30  266   73  YY  FYF   YYFF NFYYYYY FYFF FFYYYVY FYFY FFYHYYYFFFY FYFYY  YYYYN Y  Y
   314   55 C I    <<  -     0   0    0  266   15  II  III   IIII IIIIIII IIII IVIIIII IVII IIIIVVIIIII IIIII  IIIII I  I
   315   56 C C  S    S+     0   0    0  265   43  CC  CCC   CCCC CCCCCCC CCCC CCCCCCC CCCC CCCCCCCCCCC CCCCC  CCACC V  C
   316   57 C L  E     -tu 553 607E   0  265   31  LL  LLL   LLLL LLLLLLL LLLL LLLLMLL LLLL MMLLLLLLMML MLLLV  VMVML M  M
   317   58 C L  E     -tu 554 608E   0  265   31  VV  AVA   LVAV VVVVVVV VVVV VVVVVVV VIVV VVVVIIVVVVV VVVVV  VVVVV V  V
   318   59 C K  E     -tu 555 609E  22  265    1  KK  KKK   KKKK KKKKKKK KKKK KKKKKKK KKKK KKKKKKKKKKK KKKKK  KKKKK K  K
   319   60 C T  E     - u   0 610E   2  264    2  TT  TTT   TTTT TTTTTTT TTTT TTTTTTT TTTT TTTTTTTTTTT TTTTT  TTSTT T  T
   320   61 C H    >   +     0   0   26  264    1  HH  HHH   HHHH HHHHHHH HHHH HHHHHHH HHHH HHHHHHHHHHH HHHHH  HHHHH H  H
   321   62 C V  G >   +     0   0    3  265   39  II  III   IIII MIIIIII IIII IIIIIII IIII IIIIIIIIIII IIIII  IVVIM I  V
   322   63 C D  G 3  S+     0   0   74  265    1  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DDDDD D  D
   323   64 C I  G <  S+     0   0   82  265   11  II  III   IIII IIIIIII IIII IIIIITI IIII IIIIIIIIIII IIIII  IIIII I  I
   324   65 C L    <   -     0   0   15  266   28  II  IVI   IVIV VIVIVII IIII IIIIVII IIIV IIVIIIVIIII IIIIL  IILIV I  I
   325   66 C T  S    S+     0   0   88  266   64  DD  DED   DEDE DDDDSDD DDDS SDDDSDD SNSS DDSSNNSSDDD DDDDD  DDDDD S  S
   326   67 C D  S    S+     0   0   71  266   10  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DDDDD D  D
   327   68 C F        +     0   0   35  266    7  FF  FFF   FFFF FFFFFFF FFFF FFFFFFF FFFF FFFFFFFFFFF FFFFF  FFFFF F  F
   328   69 C S     >> -     0   0   45  202   62  SS  TST   SSTS SSSSSSS SSSS SSTSSSS SSST TTTSSSTSTTS TSSSS  SETES T  T
   329   70 C M  I  4>S+     0   0   44  203   88  FI  YYY   MYYY YYYYYYF YYYY YYYYYYY YYYY YYYYYYYYYYY YYYYY  YPFYY Y  Y
   330   71 C E  I  45S+     0   0  135  194   54  EE  DED   EEDE EEEEEED EEEE EEEEEDE EEEE EEEEEEEEEEE DEEEE  EAEDE A  D
   331   72 C G  I  45S+     0   0   33  250   62  GG  GHG   SHGN TGGGGGG GGKG GGGGGGG GSGG GGGGSSGGGGG GEDEK  GRGTT G  E
   332   73 C T  I  X5S+     0   0    2  252   41  TT  TTT   TTTT TTTTTTT TTTT TTTTTTT TTTT TTTTTTTTTTT TTTTT  TTTTT T  T
   333   74 C V  I  > S+     0   0   37  266   72  PP  PPP   PPPP PPPPPPP PPPP PPPPPPP PPPP PPPPPPPPPPP PPPPP  PGPGP P  K
   336   77 C L  H  X S+     0   0    3  266    0  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLMLL L  L
   337   78 C K  H  X S+     0   0   68  265   79  KK  LQL   LQLL LLLLLLL LLLI ILLLVVL ILIK VVKLLLKIVVL VLLLL  LKVKL V  V
   338   79 C A  H  X S+     0   0   60  266   62  KK  EGE   EGEK KEEEAAE EEEE EEEEAEE EEEE EEEVEEEEEEE EEEEE  EREQK A  A
   339   80 C L  H  X S+     0   0   13  266   12  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLL L  L
   340   81 C S  H  X>S+     0   0   15  266   37  AA  SAS   SASA AASAAAA ASSS SSAAASS SSSA SSAASSASSSS SSSSK  SAASA A  A
   341   82 C A  H  <5S+     0   0   80  266   70  ES  KKK   KKKK KKKRKKK KKKK KKRRKKK KRKK KKKERRKKKKK KKKKK  KEKTK H  K
   342   83 C K  H  <5S+     0   0  134  266   19  KK  KKK   EKKK KKKKKKK KKKK KKKKKKK KKKK KKKRKKKKKKK KKKKK  KKKKK K  K
   343   84 C Y  H  <5S-     0   0   51  266   36  HH  HHH   HHHH YHHHYHH HHHH HHHHHYH HHHH HHHHHHHHHHH HHHHF  YHHHY H  H
   344   85 C N  T  <5 +     0   0   60  266   55  NN  KNK   NNKN NQNNNNN QNKN NNNNRNN NQNN KKNGQQNNKKN KKNKN  NNDNN N  G
   345   86 C F      < -     0   0    0  266    0  FF  FFF   FFFF FFFFFFF FFFF FFFFFFF FFFF FFFFFFFFFFF FFFFF  FFFFF F  F
   346   87 C L  E     -u  577   0E   6  266   11  LL  LML   LMLM MMMMMMM MMMM MMMMLMM MMMM LLMLMMMMLLM LMMML  MLMLM M  M
   347   88 C L  E     -u  578   0E   0  266   12  II  III   IIII IIVIIII IIII IIIILII IIII IIIIIIIIIII IIIII  IIIII L  I
   348   89 C F  E     -uv 579 638E   0  266    0  FF  FFF   FFFF FFFFFFF FFFF FFFFFFF FFFF FFFFFFFFFFF FFFFF  FFFFF F  F
   349   90 C E  E     -u  580   0E   0  266    0  EE  EEE   EEEE EEEEEEE EEEE EEEEEEE EEEE EEEEEEEEEEE EEEEE  EEEEE E  E
   350   91 C N  E     +     0   0E  30  266    0  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DDDDD D  D
   351   92 C R  E     -     0   0E  47  266    0  RR  RRR   RRRR RRRRRRR RRRR RRRRRRR RRRR RRRRRRRRRRR RRRRR  RRRRR R  R
   352   93 C K  E     - v   0 640E  85  266    0  KK  KKK   KKKK KKKKKKK KKKK KKKKKKK KKKK KKKKKKKKKKK KKKKK  KKKKK K  K
   353   94 C F  E     + v   0 641E   3  266    0  FF  FFF   FFFF FFFFFFF FFFF FFFFFFF FFFF FFFFFFFFFFF FFFFF  FFFFF F  F
   354   95 C A        +     0   0   46  265   45  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AAAAA A  A
   355   96 C D        -     0   0   67  265    0  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DDDDD D  D
   356   97 C I    >>  +     0   0   79  265    1  II  III   IIII IIIIIII IIII IIIIIII IIII IIIIIIIIIII IIIII  MIIII I  I
   357   98 C G  H 3> S-     0   0   39  265    0  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   358   99 C N  H 3> S+     0   0  113  265   28  KN  NNN   NNNN NNNNNNN NNNN NNNNNNN NNNN NNNNNNNNNNN NNNNN  NSSSN S  N
   359  100 C T  H <> S+     0   0   75  265    2  TT  TTT   TTTT TTTTTTT TTTT TTTTTTT TTTT TTTTTTTTTTT TTTTT  TTTTT T  T
   360  101 C V  H  X S+     0   0    0  265    5  VV  VVV   VVVV VVVVVVV VVVV VVVVVVV VVVV VVVVVVVVVVV VVVVV  VVVVV V  V
   361  102 C K  H  X S+     0   0   23  265   59  KK  KKK   KKKK KKRKKKK KKKK KKKKKKK KKKK KKKMKKKKKKK KKKKK  KKKKK K  K
   362  103 C L  H  X S+     0   0   92  265   78  NA  HLH   ALHL LKSHSSS KSAL LSHHHNS LKLN AANLKKNLAAS AHNHL  SAAAL N  N
   363  104 C Q  H  < S+     0   0   76  265    0  QQ  QQQ   QQQQ QQQQQQQ QQQQ QQQQQQQ QQQQ QQQQQQQQQQQ QQQQQ  QQQQQ Q  Q
   364  105 C Y  H  < S+     0   0    0  266    0  YY  YYY   YYYY YYYYYYY YYYY YYYYYYY YYYY YYYYYYYYYYY YYYYY  YYYYY Y  Y
   365  106 C S  H  < S+     0   0   23  266   78  AS  QKQ   AKQK KSVTKSS SKTT TTTTAKS TITK SSKTIIKTSSA STTTS  SAAAK A  S
   366  107 C A  S  X S+     0   0   34  266   52  SG  GGG   GGGG GGGSGGG GGGS SGSSGNG SGSS GGSSGGSSGGG GGGGA  GGGGG S  K
   367  108 C G  T  4 S-     0   0   60  266    0  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   368  109 C V  T  4 S+     0   0  105  266   63  VA  VIV   AIVV LVAVVVV VVVV VVVVVIV VVVV AAVVVVVVAAV AVVVI  VVVVL V  V
   369  110 C Y  T  4 S-     0   0   49  266   65  FF  YYY   FYYY YYYYYYY YYYY YYYYYFY YYYF FFFYYYFYFFY FYYYY  YYYFY Y  Y
   370  111 C R    ><  +     0   0   95  266   34  KK  KRK   KRKQ KQKKQKK QKRK KKKKQKK KKKR KKRRKKRKKKK KKKKK  KRKKK R  R
   371  112 C I  G >>  +     0   0    0  266    2  II  ITI   ITII VIIIIII IIII IIIIIII IIII IIIIIIIIIIV IIIII  IIIIV I  I
   372  113 C A  G 34 S+     0   0    0  266   52  AA  ASA   ASAA AAASAAA AAAS SASSAAA SSSA AAAASSASAAA AAAAS  SAAAA V  V
   373  114 C E  G <4 S+     0   0   81  266   60  QT  QKQ   QKQK KKQSKQQ KQES SHSSRQQ SSSE KKEASSESKKQ KKKKS  KEQQK Q  E
   374  115 C W  T <4 S+     0   0    3  266    0  WW  WWW   WWWW WWWWWWW WWWW WWWWWWW WWWW WWWWWWWWWWW WWWWW  WWWWW W  W
   375  116 C A     <  -     0   0    0  266   30  SS  AAA   AAAA AASSSSS AASS SSSSAAS SASA AAASAAASAAA AAAAA  SASAA A  A
   376  117 C D  S    S+     0   0    8  266   44  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DDDDD D  D
   377  118 C I  E     +vw 609 666E   0  266    8  II  III   IIII IIIIIII IIII IIIIIII IIII IIIIIIIIIII ILLLI  IIFII I  I
   378  119 C T  E     - w   0 667E   0  266   42  TT  TTT   TTTT TTTTTTT TTTT TTTTTTT TTTT TTTTTTTTTTT TTTTS  TTTTT T  T
   379  120 C N  E     -vw 613 668E   1  266    2  NN  NNN   NNNN NNNNNNN NNNN NNNNNNN NNNN NNNNNNNNNNN NNNNN  NNNNN N  N
   380  121 C A  E     -vw 614 669E   0  266   41  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AAAAA A  A
   381  122 C H    >   -     0   0   37  266   50  HH  HHH   HHHH HHHHHHH HHHH HHHHHHH HHHH HHHHHHHHHHH HHHHH  HHHHH H  H
   382  123 C G  G >  S+     0   0    5  265   79  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGSGG G  S
   383  124 C V  G 3  S+     0   0   99  266   30  VV  VVV   VVVV VVVVVII VIVV VVVVVVV VVVV VVVVVVVVVVI VVVVV  IVVVV V  V
   384  125 C V  G <  S-     0   0   53  266   52  TT  ITI   TTIT TTTTTTT TTTT TTTTTTT TTTT TTTTTTTTTTT TTTTP  TPPPT P  P
   385  126 C G    X   -     0   0   15  266    1  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGVG GGGGGGGGGGG GGGGG  GGGGG G  G
   386  127 C P  T >> S+     0   0   74  266   64  AE  SAS   RASS PAAASSA AAEK KAAAAES KNKA SSAKNNAKSST SEEEQ  EPEPP D  E
   387  128 C G  H 3> S+     0   0   26  266   25  GG  GGG   GGGR GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   388  129 C I  H <> S+     0   0    0  266   24  II  III   IIII IIVVIII IVVV VVVVIII VVGI IIIVVVIGIII IVIVI  IIIII I  I
   389  130 C V  H <> S+     0   0    2  266   13  VV  VVV   VVVV VVVVVVV VVVV VVVVVVV VVVV VVVVVVVVVVV VVVVV  VVVVV V  I
   390  131 C S  H  X S+     0   0   72  266   72  KR  KEK   KEKS ARQDTKN RQKE EQDDAKQ EEES HHSEEESEHHQ HKKKA  KSKSA K  N
   391  132 C G  H  X S+     0   0    6  266   30  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   392  133 C L  H  X S+     0   0    0  266    0  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLL L  L
   393  134 C K  H  X S+     0   0   54  266   67  KK  KKK   KKKR KKKKKKK KKKK KKKKKKK KKKK KKKKKKKKKKK KKKKK  KEQEK E  R
   394  135 C Q  H  X S+     0   0   97  266   56  EE  EQE   EQEQ QEQQQEE EEEK KEQQQEE KQKE QQERQQEKQQE QEEEQ  EEEEQ A  E
   395  136 C A  H  X S+     0   0    1  266   60  AA  AAA   AAAA AAGGAAA AGGG GGGGAAA GGGA AAAGGGAGAAA AGGGA  AAAAA A  A
   396  137 C A  H  X S+     0   0    4  266   31  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AAAAA A  A
   397  138 C E  H  < S+     0   0  134  266   84  QS  TET   QETQ EQQLEQQ QKSD DKLLELR DKDQ SSQEKKQDSSK SQNQQ  VRQKE T  n
   398  139 C E  H  < S+     0   0  125  202   30  EE  EEE   EEEE EEEEEEE EEEE EEEEEEE EEEE EEEGEEEEEEE EEEEE  EEEEE E  a
   399  140 C V  H  < S+     0   0   51  266   88  TV  TST   TSTT TTTTVST TVVT TTTTTTT TtTT TTTVttTTTTT TTTTT  TATTT y  k
   400  141 C T     <  -     0   0   35  193   67  TS  TTT   TTTT TTTTTST TTTT TTTTTTT TnTT TTT.ndTTTTT TTTTT  TTTTT h  c
   401  142 C K  S    S+     0   0  179  212   85  DQ  DDD   DDDD SSQKDKS SEDN NDKKSLD NQNS NKSEQQSNKNS NDNDQ  SSDDS P  E
   402  143 C E  S    S-     0   0   91  218   33  EE  QEQ   EEQE EEEEEEE EEQE EEEEEEE EEEE EEEKEEEEEEE EEEEE  EEEEE g  n
   403  144 C P        -     0   0   33  183   56  PP  PPP   PPPP PPPPPPP PPPP PPPPPPP PPPP PPPEPPPPPPP PAPAP  PPPPP d  d
   404  145 C R        -     0   0   20  264   15  RR  RRR   RRRR RRRRRRR RRRR RRRRRRR RRRR RRRRRRRRRRR RRRRR  RRRRR R  R
   405  146 C G  E     -w  638   0E   0  266   17  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   406  147 C L  E     -wx 639 699E   0  266    6  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLVLLLLLLL LLLLL  LLLLL L  L
   407  148 C L  E     -wx 640 701E   0  266   11  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLIVL I  I
   408  149 C M  E     -wx 641 702E   0  266   38  MM  MMM   MMMM MMMMMMM MMMM MMMMMMM MMMM MMMMMMMMMMM MMMMM  MMMMM M  M
   409  150 C L  E     + x   0 703E   3  266    2  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLL L  L
   410  151 C A        +     0   0    0  266    8  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AAAAa A  A
   411  152 C E  S    S-     0   0   24  266   18  EE  EEE   EEEE EEEEEEE EEEE EEEEEEE EEEE EEEEEEEEEEE EEEEE  EEEEl E  E
   412  153 C L        -     0   0   44  266    7  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLF L  L
   413  154 C S        +     0   0   78  266   31  SS  SSS   SSSS SSSSSSS SSSS SSSSSSS SSSS SSSSSSSSSSS SSSSS  SSSSL S  S
   414  155 C C  S >  S-     0   0   79  266   22  SS  SSS   SSSS SSSSSSS SSSS SSSSSSS SSSS SSSSSSSSSSS SSSSS  SSSSK S  S
   415  156 C K  T 3  S+     0   0  214  266   44  KK  KKK   KKKE KKKKKKK KKKK KKKKKKK KVKK KKKKVVKKKKK KKKKK  KQKKR K  K
   416  157 C G  T 3  S+     0   0   68  265    2  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGX G  G
   417  158 C S    <   -     0   0   38  266   49  SS  SSS   SSSS ASSSASS SSSS SSSSASS SSSS SSSSSSSSSSS SSSSS  SSSTN S  S
   418  159 C L        +     0   0  148  266    8  LL  ILI   FLIL ILLLILL LLLL LLLLILI LLLL LLLLLLLLLLL LLLLI  LLLLC L  L
   419  160 C A        +     0   0    6  266   41  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AAAAT A  A
   420  161 C T    >   -     0   0   55  266   75  TK  HYH   HTHY HYFYHYY YYYY YYYYHYH YYYY QQYHYYYYQQY QYYYT  YKVHW T  T
   421  162 C G  T 3> S+     0   0   20  266   28  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGS G  G
   422  163 C E  H 3> S+     0   0   81  266   50  EE  KEK   TEKE QEEEKEE EEEE EEEEKEK EEEE EEEEEEEEEEE EEEEE  EEEEV E  S
   423  164 C Y  H <> S+     0   0   59  265    0  YY  YYY   YYYY YYYYYYY YYYY YYYYYYY YYYY YYYYYYYYYYY YYYYY  YYYYH Y  Y
   424  165 C T  H  > S+     0   0    3  266   18  TT  TTT   TTTT TTTTTTT TTST TSTTTTT TSTT TTTTSSTTTTT TSSST  SSTSK T  T
   425  166 C K  H  X S+     0   0   78  266   69  KK  EQE   EQEK KKDEEEE KEAN NEEEENE NQNE QQERQQENQQE QKKKE  ERQQG Q  T
   426  167 C G  H  X S+     0   0   26  266   76  QQ  EKE   EKEK EQKKEKK QKKK KKKKEKE KKKK KKKEKKKKKKK KKKKK  KGKAN K  K
   427  168 C T  H  X S+     0   0    2  266   58  TT  TTT   TTTT TTTTTTT TTTT TTTTTTT TTTT TTTTTTTTTTT TTTTT  TTTTC T  T
   428  169 C V  H  X S+     0   0   16  266   12  VV  VVV   VVVV VVVVVIV VVVI IIVVVVV IVIV VVVIVVVIVVI VIVII  IVVVR V  V
   429  170 C D  H  < S+     0   0   78  266   45  DD  EEE   EEEE DEEEEEE EEEE EDEEEEE EEEE EEEEEEEEEED EDEDD  EEEDY E  E
   430  171 C I  H >< S+     0   0   21  266   63  II  III   IIII IIIIIII IIII IIIIIII IIII IIIIIIIIIII IIIII  IIIIC I  L
   431  172 C A  H >< S+     0   0    0  265    1  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AAAAX A  A
   432  173 C K  T 3< S+     0   0   53  266   33  KK  KKK   KKKK KKKKKKK KKKK KKKKKKK KKKK KKKKKKKKKKK KKKKR  KRRRK K  H
   433  174 C S  T <  S+     0   0   73  265   75  TT  SSS   TSSS TSTSTSS SSSS STSLTST SSSS EESSSSSSEES ETTTS  CSNSP N  N
   434  175 C D    <>  +     0   0   19  266   71  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DNNNI N  N
   435  176 C K  T  4 S+     0   0   81  266   48  KK  KKK   KKKR KKKKKKK KKKK KKKKKKK EKKK KKKRKKKKKKR KKKKK  KRKRR K  S
   436  177 C D  T  4 S+     0   0   84  266   43  DD  EEE   DEED DDEEDEE DEEE EEEEEDE EEEE EEEEEEEEEEE EDEDE  ERGAT Q  D
   437  178 C F  T  4 S+     0   0   10  266    7  FF  FFF   FFFF FFFFFFF FFFF FFFFFFF FFFF FFFFFFFFFFF FFFFF  FFFFL F  F
   438  179 C V  E  <  +x  667   0E   1  266    5  VV  VVV   CVVV VVVVVVV VVVV VVVVVVV VVVV IIVVVVVVIIV IVVVV  VVVVL V  V
   439  180 C I  E     -     0   0E   0  265   40  II  III   IIII IIIIIIV IIMI IIIIFII IIII IIIIIIIIIII IMMMV  IFFFX F  F
   440  181 C G  E     -xy 668 718E   0  266    0  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGA G  G
   441  182 C F  E     -xy 669 719E   0  266    0  FF  FFF   FFFF FFFFFFF FFFF FFFFFFF FFFF FFFFFFFFFFF FFFFF  FFFFF F  F
   442  183 C I  E     +xy 670 720E  10  265   12  II  III   IIII IIIIIII IIII IIIIIII IIII IIIIIIIIIII IIIII  .IIII I  I
   443  184 C A        -     0   0    0  265   31  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA SSAAAAAASSA SAAAA  .AAAA A  A
   444  185 C Q  S    S+     0   0   34  266   53  QQ  QQQ   QQQQ QQQQQQQ QQQQ QQQQQQQ QQQQ QQQQQQQQQQQ QQQQQ  IQQQQ Q  Q
   445  186 C R  S    S-     0   0  111  266   66  RN  NRN   RRNN HRRRNRR RRRR RRHRGHR RRRH RRHRRRHRRRR RNNNR  ANNQH N  n
   446  187 C D        -     0   0   41  192   77  DD  SDS   DDSD SDDDQDD DEDD DDDDDDD DDDD DDDDDDDDDDE EYYYK  QARKS R  e
   447  188 C M        -     0   0   20  204   82  MM  MMM   MMMM MMMMMMM MMMM MMMMMMM MMMM FFMMMMMMFFV FMMMI  RMMVM M  V
   448  189 C G        +     0   0   25  210   61  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGG. GGGGE  AGPGG .  Q
   449  190 C G    > > +     0   0    6  236   63  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGG. GGGGA  VTEKG D  D
   450  191 C R  G > 5S+     0   0  123  254   81  HR  QRQ   RRQR EKRHSTR KAAH HRHHRRQ HQHR YYRRQQRHYYV YTTTK  EPDPE E  S
   451  192 C D  G 3 5S+     0   0  160  266   42  DD  DED   EEDD ADEDDDD DDDD DEDDEED DEDE DHEEEEEDHDE DDDDD  ADAEA A  E
   452  193 C E  G < 5S-     0   0  108  266   30  EE  EEE   DEEE EEEEEEE EEEE EEEEEEE EEEE EEEEEEEQEED EEEED  EEEEE A  G
   453  194 C G  T < 5S+     0   0   55  266   45  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGD  GDTDG D  N
   454  195 C Y      < -     0   0   50  266   25  FF  FFF   FFFF FFFFFFF FYFF FFFFFFF FFFF YYFFFFFFYYF YFFFE  FWEWF E  y
   455  196 C D        -     0   0   39  116    5  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  D.DVD D  d
   456  197 C W        -     0   0   10  123    9  WW  WWW   WWWW WWWWWWW WWWW WWWWWWW WWWW WWWWWWWWWWW WWWWW  W.WIW F  W
   457  198 C L  E     -y  701   0E   0  266   29  LL  ILI   ILIL LLLIIIL LLVI IIIIVII ILII LLIILIIILLI LVVVV  ILLML L  L
   458  199 C I  E     -y  702   0E   2  266   51  II  III   IIII IVIVIVI VIII IVVVVIV IIII IIIIIIIIIII IIIIV  VIITI V  I
   459  200 C M  E     -yz 703 739E   0  266   26  MM  MMM   MMMM LMMMMMM MMMM MMMMMMM MMMM MMMMMMMMMMM MMMMM  MLLPL L  L
   460  201 C T  E     - z   0 740E   0  266   13  TT  TTT   TTTT TTTTTTT TTTT TSTTTTT TTTT TTTTTTTTTTT TTTTT  TTTGT T  T
   461  202 C P        +     0   0   28  266   31  PP  PPP   PPPP PPPPPPP PPPP PPPPPPP PPPP PPPPPPPPPPP PPPPP  PPPVP P  P
   462  203 C G  S    S+     0   0   54  266    0  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   463  204 C V              0   0   12  266   14  VV  VVV   VVVV VVVVVVV VVVV VVVVVVV VVVV VVVVVVVVVVV VVVVV  VVVLV V  V
   464  205 C G              0   0   61  266   52  gg  ggg   gggg ggggggg gggg ggggggg gggg ggggggggggg ggggg  gggdg g  g
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54  rr  rrr   rrrr rrrrrrr rrrr rrrrrrr rrrr rrrrrrrrrrr rrrrr  rrrrr r  r
   467  219 C T     >  -     0   0   79  264    8  GS  TTT   TTTT TTTTTTT TTTT TTTTTTT TTTT TTTTTTTTTTT TTSTT  TTTTT P  T
   468  220 C V  H  > S+     0   0   11  264   49  VV  VVV   VVVV VVVVVVV VVVV VVVVVVV VVVV VVVVVVVVVVV VVVVV  VVVVV V  V
   469  221 C D  H  > S+     0   0   79  265   63  DS  SDS   DDSS NQDDSDN QDDD DDDDDDD DDDD DEDDDNDDEDD DDDDS  DNDDN D  D
   470  222 C D  H  > S+     0   0   59  265   63  EE  QEQ   EEQA DEEEEQE EEEE EEEETQE EEEE DDEEEEEEDDE DEEEE  EETDD T  T
   471  223 C V  H  X>S+     0   0    0  265   45  VV  VVV   VVVV VVVVVVV VVVV VVVVVVV VVVV VVVVVVVVVVV VVVVV  VVVVV V  V
   472  224 C V  H ><5S+     0   0    0  265   19  VV  FIF   VMFM IVVVMVI VVVI IVVVVIV IVIV FFVVVVVIFFI FIVIV  VIIII V  I
   473  225 C S  H 3<5S+     0   0   52  266   85  AA  SQS   SQSK SSSSSTS SSSS SSSSQDS SSSK SSKSSSKSSSS SSSST  SAEES K  K
   474  226 C T  H 3<5S-     0   0   59  266   80  GG  TTT   GTTT TTTTTTT TTTT TTTTTST TTTT TTTTTTTTTTT TKNKg  TNGTT G  N
   475  227 C G  T <<5S+     0   0    8  266    4  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGg  GGGGG G  G
   476  228 C S      < -     0   0    0  266   60  SS  TTT   CTTT STTTTTT TTTT TTTTTST TTTT TTTTTTTTTTT TTTTS  TSSTS S  S
   477  229 C D  S    S+     0   0    0  266    0  DD  DDD   DDDD DDDDDDD DDDD DDDDDDD DDDD DDDDDDDDDDD DDDDD  DDDDD D  D
   478  230 C I  E     - z   0 720E   0  266   33  II  IVI   IVII IIIVIII IIIV VIVVVII VIVI LLIVIIIVLLI LVVVI  IVVVI V  V
   479  231 C I  E     -sz 552 721E   0  266   11  II  III   IIII IIIIIII IIII IIIIIII IIII IIIIIIIIIII IIIII  IIIII I  I
   480  232 C I  E     -s  553   0E   7  266    0  II  III   IIII IIIIIII IIII IIIIIII IIII IIIIIIIIIII IIIII  IIIII I  I
   481  233 C V  E     +s  554   0E   2  266   36  VV  VVV   VVVV VVVVVVV VVVV VVVVVVV VVVV VVVVVVVVVVV VVVVV  VVVVV V  V
   482  234 C G    >   +     0   0   22  266    0  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   483  235 C R  T 3> S+     0   0  121  266    0  RR  RRR   RRRR RRRRRRR RRRR RRRRRRR RRRR RRRRRRRRRRR RRRRR  RRRRR R  R
   484  236 C G  T 34 S+     0   0   21  266    0  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   485  237 C L  T <4 S+     0   0    0  266   26  LL  LLL   LLLL LLLLLLL LLLL LLLLLLL LLLL LLLLLLLLLLL LLLLL  LLLLL L  L
   486  238 C F  T  4 S+     0   0   27  266   29  FF  FFF   FFFF FFFFFFF FFFF FFFFFFF FFFY FFYFFFYFFFF FFFFI  FYFYF F  F
   487  239 C A  S >< S+     0   0   10  266   52  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGASG G  G
   488  240 C K  T 3  S-     0   0  178  164   62  KK  KKK   KKKK KKKKKQK KKKK KKKKKKK KKKQ KKQKKKQKKKK KKKKA  KKKKK K  K
   489  241 C G  T 3  S+     0   0   83  266   55  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GGGGG G  G
   490  242 C R    <   -     0   0  111  266   76  RR  RRR   RRRR RRRRRRR RRRR RRRRRRR RRRR RRRRRRRRRRR RRRRR  RRRRR R  R
   491  243 C D     >  -     0   0   96  266   30  DD  DDD   DDDD DDDDDDD DDDD DDDDHDD DDDD DDDDDDDDDDD DDDDD  NDDDD D  D
   492  244 C A  H  > S+     0   0    8  266   56  PP  PPP   PPPP PPPPPPP PPPP PPPPPPP PPPP PPPPPPPPPPS PPPPP  PPPPP P  P
   493  245 C K  H  > S+     0   0   83  265   82  AK  LEL   TELV VTDESTE TETE EQEEAVD EDEI EEVEDEIEEEE EVVVV  KV VV V  V
   494  246 C V  H  > S+     0   0   81  265   81  VV  KVK   VVKV VVVVVVV VVVV VVVVVLV VIVE ATEVIVEVTAV AVVVA  EH HV A  V
   495  247 C E  H  X S+     0   0   22  265   50  EE  EEE   EEEE EEEEEEE EEEE EEEEEQE EEEQ EEQEEEQEEEE EEEEE  EE EE E  E
   496  248 C G  H  X S+     0   0    0  265   42  GG  GGG   GGGG SGGGGGG GGGG GGGGGGG GGGA GGAGGGAGGGG GGGGG  GA AS G  G
   497  249 C E  H  X S+     0   0   67  265   58  EE  EKE   EKEE KAKKEKK AKKK KKKKEEQ KKKK RRKKKKKKRRR RKKKL  KQ QK K  K
   498  250 C R  H  X S+     0   0  141  265   28  RR  RRR   RRRR RRRRRRR RRRR RRRRRRR RRRR RRRRRRRRRRR RRRRR  RR RR R  R
   499  251 C Y  H  X S+     0   0   20  265    0  YY  YYY   YYYY YYYYYYY YYYY YYYYYYY YYYY YYYYYYYYYYY YYYYY  YY YY Y  Y
   500  252 C R  H  X S+     0   0   41  265   36  RR  RRR   RRRR RRRRMRR RRQR RRRRRRR RRRQ QQQRRRQRQQR QKKKR  RQ QR R  R
   501  253 C K  H  X S+     0   0  101  265   61  SS  KKK   KNKK DDDDKDD DDKE EDDDKKE ENEQ DDQDDDQEDDD DEEEK  DK KD D  D
   502  254 C A  H  X S+     0   0   28  265   48  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AA AA A  A
   503  255 C G  H  X S+     0   0    0  265   15  GG  GGG   GGGG GGGGGGG GGGG GGGGGGG GGGG GGGGGGGGGGG GGGGG  GG GG G  G
   504  256 C W  H  X S+     0   0   22  265    0  WW  WWW   WWWW WWWWWWW WWWW WWWWWWW WWWW WWWWWWWWWWW WWWWW  WW WW W  W
   505  257 C E  H  X S+     0   0   86  265   62  NN  EEE   DEED SKANNNK KKDN NNNNDDN NNNN KKNKNNNNKKN KNNND  NE NS N  K
   506  258 C A  H  X S+     0   0    2  265    2  AA  AAA   AAAA AAAAAAA AAAA AAAAAAA AAAA AAAAAAAAAAA AAAAA  AA AA A  A
   507  259 C Y  H  < S+     0   0   25  262    0  YY  YYY   YYYY YYYYYYY YYYY YYYYYYY YYYY YYYYYYYYYYY YYYYY  YY YY Y  Y
   508  260 C L  H  < S+     0   0  108  258   55  LL   K    LK L LTQLLLQ TQLL LLLLTLL LLLL LLLLLLLLLLL LLLLL  LL LL L  E
   509  261 C R  H  < S+     0   0  136  258   68  KK   R    KR S NEKKAKK ESHK KKKKKKK KKKN NNNKKKNKNNK NKKKA  KK RN E  E
   510  262 C R  S  < S-     0   0   31  254    5  RR   R    RR R RRRRRKR RRRK KKRRRRK KKKR RRRRKKRKRRK RRRRR  KR KR R  R
   511  263 C C        -     0   0   48  210   53  CT   S    YI V  CCTTT  C  T TTTTVIT TTT  VV TTT NVVT VVVV   TL    I  I
   512  264 C G        -     0   0   35  164   41   S   A    SA A  AGGNG  A  G GGGGSGS GGG  NN GGG GNNS NAGA   NA    Q  N
   513  265 C Q              0   0  142  129   68   Q        A     NNQQ   N  Q QQQQ QQ QQQ  NN QQQ QNNQ N S    QQ    N   
   514  266 C Q              0   0  185   69   46            Q                              Q        Q  Q K              
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    3 A K              0   0   88  128   55   T   T    R  R         K   K    K  R     K        SK     T         Q  
     2    4 A A        -     0   0   48  149   71   T   Q    Q  E  Q    Q L   Q    L  Q     K     Q  KL     Q        QV  
     3    5 A T     >  -     0   0   57  246   38   S TTTST  T  TTTSTTTTTTT TPT TPPTTTTST  TS    TSTTSNTTT  T T  TT  TP T
     4    6 A Y  H  > S+     0   0    0  278    1   FFYYYYY  YYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY    YYYYYFYYYYYY Y  YYYYYYYY
     5    7 A K  H  > S+     0   0  120  278   72   EDLLDTA  ASGEASSSSGTAAGAASAVASSGAAAGAV AA    GAGALSASSEAE S  AQAAAEES
     6    8 A E  H  > S+     0   0  109  278   63   QKEEVED  ATEASEAEEEEQQQQSEQQEEEQSAQQEQ EA    ASTSEEEAADDS A  QKDDSDDA
     7    9 A R  H >X S+     0   0    6  278    0   RRRRRRR  RRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR    RRRRRRRRRRRR R  RRRRRRRR
     8   10 A A  H 3< S+     0   0    7  278   23   AIAALAA  AAAAIGAAAAGAAAAIAAAAAAAIAAAAA AA    AAAISTAAAAAS A  AIAAAAAA
     9   11 A A  H 3< S+     0   0   88  279   72   AGAASEA  ASKASQEKKSQEDADGKTDAKKAPSALAD AA    SARPKAASQRTQ S  EDTTARRQ
    10   12 A T  H << S+     0   0  114  278   80   ANSSNQR  KNAKLQGQQAQKHRNLQRNKQQRLKKKKN KT    KKTLLFKKSDRT N  NFRRKDDS
    11   13 A H     <  -     0   0   22  279   56   AQHHHHH  QHHNHHMHHCHHHFYHHHYHHHFHHHQHY HQ    HQHHHCHHHHHH H  HCHHQHHH
    12   14 A P  S    S+     0   0   62  280   63   TSPPTPP  PSPSTPKPPRPATTTTSPTPSSTTPPTPT PS    PPPTSLPPPPKP P  HKKKPPPP
    13   15 A S     >  -     0   0    1  281   63   NSNNNNN  NNHNNNNNNNNNNNNNNNNVNNNNNNNVN IN  N NNNNNNVNNNNT N  NNNNNNNN
    14   16 A P  H  > S+     0   0   79  281   27   PKAAPAG  PPKPPAPAAPAPPPPPAPPPAAPPPPPPP PP  P PPPPPVPAPPPA A  PPPPAPPP
    15   17 A V  H  > S+     0   0    0  283   52   TLAAACC LAILLTCICCLCAAAATCAAVCCATLAAVA VA  T LALTTTVLLLAA L  ALAAALLL
    16   18 A A  H  > S+     0   0    0  283   37   TSAAAAA AASAVAAAAATAAAAAAAAAAAAAAAAAAA AA  R AAVAAAAVAAAG A  AAAAAAAA
    17   19 A A  H  X S+     0   0   18  283   69   KKRRRRK NKKKSQRKRRRRKKKKRRKKKRRKRKKIKK KR  V KKKRKQKKRRKR K  KKKKKRRR
    18   20 A K  H  X S+     0   0   72  283   81   HDKKASA QAQRDRSESSSSASAERSAEQSSARRALQE QS  A RARRARQKKRLK R  AKLLARRK
    19   21 A L  H  X S+     0   0    0  283    2   LLLLLLL LLLLIILLLLLLLLLLILLLLLLLILLLLL LL  L LLLIFLLLLLLL L  LLLLLLLL
    20   22 A F  H  X S+     0   0    0  283   14   FLLLLFF LLLLFLFLFFLFLLLLLLLLLLLLLFLLLL LL  A FLFLLCLFFFLL F  LLLLLFFF
    21   23 A N  H  X S+     0   0   58  283   71   EQEEEEE EENTRTEAEEHEEQELTEELDEEESEEEDL DE  K EEESEQDEQQEQ Q  EHEEEQQQ
    22   24 A I  H  X S+     0   0    3  283   39   LLIICLL ICLLIILLLLILTTTTILTTILLTIITTIT IC  I ICVILLIVVITI I  TLTTCIIV
    23   25 A M  H  X>S+     0   0    0  284   48   MVMMIMM IIMMIMMMMMMMIMMMMMIMCMMMMAIMCM CI  I AMAMMICAAAIM A  IIIIIAAA
    24   26 A H  H ><5S+     0   0   74  284   50   VEDDLEE NEEEADEEEEMEEEEEDEEEDEEEDEEEDE DS  Q EEEDEADEETHA E  GSHHETTE
    25   27 A E  H 3<5S+     0   0  127  284   87   RRRRRRR RRESERRERRERRRRRRRRRRRRRRARRRR RR  D ARARRKRAEERQ T  RERRREEE
    26   28 A K  H 3<5S-     0   0   39  284    0   KKKKKKK KKKKKKNKKKKKKKKKKKKKKKKKKKKKKK KK  K KKKKKKKKKKKK K  KKKKKKKK
    27   29 A Q  T <<5 +     0   0  110  284   53   QQKKRKQ QQQQKREQQQEQSQKKRQRKKQQKRKKKKK KQ  Q KQKRKKKKKQRR K  KKRRQQQK
    28   30 A T      < +     0   0    0  284   41   TSTTSTT STSTTTSSSSTSSSSSTTTSTTTSTTTTTS TT  S TTTTSTTTSSST T  STSSSSSS
    29   31 A N        +     0   0    0  284    0   NNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NN  N NNNNNNNNNNNN N  NNNNNNNN
    30   32 A L  E     -a  229   0A   0  284   14   LLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLVLLLL LL  L VLVLLLLVVVLL V  LLLLLVVV
    31   33 A C  E     -ab 230  55A   0  284   42   ACCCCSS CCCCCCSSSSCSCASSCSSSCSSSCTCACS CC  A TCTCSCCTTVAC T  CAAACAVT
    32   34 A A  E     -ab 231  56A   0  283   58   VVVVVVI VVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VV  V VVVVVLVVVVVL V  VLVVVVVV
    33   35 A S  E     - b   0  57A  15  284    9   ASSSSAA SSSSSSAAAAAASSSSSASSSAASSSSSSS SS  A SSSSASSSSSSS S  SSSSSSSS
    34   36 A L        +     0   0    3  284   60   AVVVVVA VVLVLVVVVVVVVVVVVVVVVVVVVAVVVV VV  A AIAVAAVAAAVV A  VLVVVAAA
    35   37 A D        +     0   0   42  284    0   DDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD  D DDDDDDDDDDDD D  DDDDDDDD
    36   38 A V        -     0   0    8  284    9   VFVVLVV FVVVVVVLVVVVVVVVVVVVVVVVVVVVVV VV  V VVVVLVVVVVVH V  VVVVVVVV
    37   39 A R  S    S+     0   0  162  284   66   TNTTSTT TTTTTTTTTTTTTTVTTTTTTTTVTTTTTT TT  T TTSTTTTTTTTT T  TTTTTTTT
    38   40 A T     >  -     0   0   42  284   42   TTTTTTT HNSTTKTKTTSTKKKKRTKKSTTKKTKTSK SN  T TNTKSRSTTTQD T  KTQQNTTT
    39   41 A T  H  > S+     0   0    4  284   55   VKSSSKK SKKKTAKKKKSKKSSSAKRSKKKSATSSKS KK  A TKTAKAKTTTSP T  QSSSKTTT
    40   42 A K  H  > S+     0   0  115  284   69   ADAAAKK DQSTTAKSKKSKAQARDKERAKKAARDAAR AQ  N RQKAASAKKKSE K  AESSRKKK
    41   43 A E  H  > S+     0   0   74  284   28   ESEEEEE TDASKEEEEEAEDDDDEEDDGEEDEEDDGD GD  E EDEEADGEEEDK E  DKDDDEEE
    42   44 A L  H  X S+     0   0    4  284   11   LLVVLLL LLFFLVLILLLLFFLFVLFFLLLLVLFFLF LL  L LLLVLLLLLLFI L  FIFFLLLL
    43   45 A L  H  X S+     0   0   40  284    4   LLLLLLL LLLLLLLLLLLLLLLLLIFLLIILLLLLLL LV  V LLLLILLLLLLL L  LILLLLLL
    44   46 A E  H  X S+     0   0  112  284   81   HKEEESH QDRRKESESSDSRSAAESRARSSAEDKTRA RD  K DDDEEHRDDDAA D  RAAADDDD
    45   47 A L  H  X S+     0   0   19  284   26   IMVVVII LVIILVILIILIIIIIIIIIIIIIVLVIII IV  L LVLVLLILLLIL L  ILIIVLLL
    46   48 A V  H  X S+     0   0    0  283   55   AVVVVAA VCAVAVAVAAIAIIVIVAVIAAAVVAIVAI AC  V ACAVAAAAAAIV A  IAIICAAA
    47   49 A E  H  < S+     0   0   79  284   22   DERRDDD DDNDDRDDDDPDDDDDKDDDEDDDRDDDED EN  Q DEDRDDEDDDDR D  DDDDDDDD
    48   50 A A  H  < S+     0   0   24  284   75   VANNASA AALADRAKSSEAIATAMAIAAAATRHLAAA AA  Q RARRKTARRRAQ R  VQAAARRR
    49   51 A L  H >X S+     0   0    0  282   33   LVVVVVC VVIVLVVIVVIVVVVVVIVVAIIVVLVVAV AV  V LVLVVVALLLVL L  VLVVVLLL
    50   52 A G  G >< S+     0   0    0  282    3   GGAAGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
    51   53 A P  G 34 S+     0   0   50  284   18   PPPPPPP PPPPPAPPPPPPPPPPAPPPPPPPAPPPPP PP  D PRPAPKPPPPPP P  PPPPPPPP
    52   54 A K  G <4 S+     0   0   45  284   77   HYAASYY HNHYYSFYYYHFYFYYSYYYYYYYSYYFYY YN  S YNHSYEYYYYLK H  YELLDYYY
    53   55 A I    <<  -     0   0    0  284   14   IVVVVVI VVIVVVVVVVIVVVIVVIVACIIIVIVVCA CV  I IVIVIICIIMVI I  IIVVVMMI
    54   56 A C  S    S+     0   0    1  283   49   CCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCACCCC CC  C ACACCCCAAVCC A  CCCCCVVA
    55   57 A L  E     -bc  31  85A   0  283   32   VMMMLVI MLMMIMVVVVVVLLLLMVLLCVVLMVMLCL CL  V VLVMLVCVVVLL V  LVLLLVVV
    56   58 A L  E     -bc  32  86A   1  283   30   LIVVILL IVLIFVLILLLLVVIIVLVIILLIVIVIII IV  L IVIVLLIIILIL I  VLIIVLLI
    57   59 A K  E     -bc  33  87A  20  283    2   KKKKKKK KKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KK  K KKKKKKKKKKKk K  KKKKKKKK
    58   60 A T  E     - c   0  88A   2  281    3   TTTTTTT TTTTTTTTTTLTTTTTTTTTTTTTTTTTTT TT  T TTTTTTTTTTTi T  TTTTTTTT
    59   61 A H    >>  +     0   0   18  281    2   HHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH  H HHHHHHHHHHHD H  HHHHHHHH
    60   62 A V  G >4  +     0   0    2  283   49   VVIIMII IIIIICIIIIIIVIVVCIIVIIIVCIVIIV II  I IIICIVIIIIII I  VVIIIIII
    61   63 A D  G 34 S+     0   0   18  283    2   DDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD  D DDDDDDDDDDDI D  DDDDDDDD
    62   64 A I  G <4 S+     0   0   15  283   18   IIIIIII IIIIIIIVIIIIIIVIIIIIIIIVIIIIII II  V IIIIVIIIIIIA I  VIIIIIII
    63   65 A L    <<  -     0   0   15  284   28   LIIIVVI IVILIIVVVVLVIIVLIVILVVVVILILVL VV  I LVLIVLVLLLLF L  IILLVLLL
    64   66 A T  S    S+     0   0   99  284   65   SSSSEED CETSDEEEEETEEEEEEEEEEEEEETEEEE EQ  S TESEDTESSAEp S  EEEEEAAS
    65   67 A D  S    S+     0   0   33  284    1   DDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD  D DDDDDDDDDDDa D  DDDDDDDD
    66   68 A F        +     0   0   29  284    6   FFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF  F FFFFFFFFFFFS F  FFFFFFFF
    67   69 A S     >> -     0   0   39  279   61   T...DDD .DD.STDDDDTDDDDDTDDDDDDDTSAEDD DD  T SDSTDTDSSSDS S  ETDDDSSS
    68   70 A M  I  4>S+     0   0   38  283   97   tDTTQKE DMQDYLHQAAPRSQSFLAPFRAASLVPYRF QM  P VMDLQAREQASI E  FPSSLAAQ
    69   71 A E  I  45S+     0   0  109  157   60   dIPP..D I..AK......................... ..  . ...........K .  ........
    70   72 A G  I  45S+     0   0   16  283   60   ADAASDL NDDDSEDDDDSDSSSTEDSTDDDSEDTSDT DD  D DDEEDEDEEENS E  SDNNDEEE
    71   73 A T  I  X5S+     0   0    2  283   43   FLLLVLV LLLLTFLMLLVLLLLLFLALLLLLFTLLLL LL  L TLTFLFLTTTLF T  MLLLLTTT
    72   74 A V  I  > S+     0   0   37  284   73   KKEERQL SQKQPEQKQQAQRSKSKQRSQQQKEGRRQS QR  T GQGEQQQGGGKK G  RTKKQGGG
    75   77 A L  H  X S+     0   0    2  284    1   LLLLLLC LLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL  L LLLLLLLLLLLL L  LLLLLLLL
    76   78 A K  H  X S+     0   0   64  283   80   RKAARE. STVQVVEVQQLEKVQQVQKQQQQQVNQEQQ QT  L NTKVTAQKNQVQ K  KKVVTQQN
    77   79 A A  H  X S+     0   0   60  284   64   PEKKVAE SAEREKQAKKAQEDAAEEAAAEEAKVENAA AE  D VQAKACAAASEE T  EKEEASSA
    78   80 A L  H  X S+     0   0   14  284   11   LLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL  L LLLLLLLLLLLL L  LLLLLLLL
    79   81 A S  H  X>S+     0   0   14  284   35   ASAASAA SSSSSSAGAAKASSASSASSAAAASASSAR AS  K ASASAAAAASSS A  SASSSSSA
    80   82 A A  H  <5S+     0   0   81  284   70   DVDDEKK REKKKKKKEEAKAREKHKEKDKKEKQVLDK DK  K QEEKKQDEQQKR E  AQKKQQQQ
    81   83 A K  H  <5S+     0   0  142  284   20   KKEEKKK KKKKKQKKKKRKKKKKQKKKKKKKQKNKKK KK  Q KKKQKKKKKKKE K  KQKKKKKK
    82   84 A Y  H  <5S-     0   0   52  284   36   HYFFHHH HHHHHLHHHHYHHHHHLHHHHHHHLHHHHH HH  Y HHHLHHHHHHHH H  HHHHHHHH
    83   85 A N  T  <5 +     0   0   64  284   57   GDDDDDD DDNDNDDRDDNDDDDDDDDDDDDDDNDDDD DD  Q NDNDDEDNNNDA N  DNDDDNNN
    84   86 A F      < -     0   0    3  284    0   FFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF  F FFFFFFFFFFFF F  FFFFFFFF
    85   87 A L  E     -c   55   0A   8  284   10   VLVVLLL LLLLLVLLLLLLLVLMVLLMLLLLVLVLLM LL  L LLLVMLLLLLVM L  LLVVLLLL
    86   88 A L  E     -c   56   0A   0  284   12   VIIIIIL IIIIIIIIIIIIIIIIIFIIIFFIIIIIII II  I IIIIILIIIIII I  IIIIIIII
    87   89 A F  E     -cd  57 116A   0  284    0   FFFFFFF FFFFFFFFFFFFFFFFFFFFWFFFFFFFWF WF  F FFFFFFWFFFFF F  FFFFFFFF
    88   90 A E  E     -c   58   0A   0  284    0   EEEEEEE EEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EE  E EEEEEEEEEEEE E  EEEEEEEE
    89   91 A N  E     +     0   0A   4  284    0   DDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD  D DDDDDDDDDDDD D  DDDDDDDD
    90   92 A R  E     -     0   0A  40  284    0   RRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR  R RRRRRRRRRRRR R  RRRRRRRR
    91   93 A K  E     - d   0 118A  36  284    0   KKKKKKK KKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KK  K KKKKKKKKKKKK K  KKKKKKKK
    92   94 A F  E     + d   0 119A   4  284    0   FFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF  F FFFFFFFFFFFF F  FFFFFFFF
    93   95 A A        +     0   0    6  283   47   AAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAIAAAA AA  A IAIAAAAIIVAA I  AAAAAVVI
    94   96 A D        -     0   0   13  283    0   DDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD  D DDDDDDDDDDDD D  DDDDdDDD
    95   97 A I    >>  +     0   0   57  283    1   IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II  I IIIIIIIIIIII I  IIIItIII
    96   98 A G  H 3> S-     0   0   37  283    0   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
    97   99 A N  H 3> S+     0   0  113  283   28   NNNNNNN NNNNSNNNNNSNNNNNNNNNNNNNNNNNSN NN  N NNNNNSNNNNNS N  NHNNNNNN
    98  100 A T  H <> S+     0   0   17  283    1   TTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TT  T TTTTTTTTTTTT T  TTTTTTTT
    99  101 A V  H  X S+     0   0    0  283    3   VVVVVVV VAVVVVVVVVVVVAVVVVVVVVVVVVVVVV VA  V VVVVVVVVVVVV V  VVVVAVVV
   100  102 A K  H  X S+     0   0   21  283   59   KSAAVKK SSKKQSKKKKAKAAAASKAARKKASQAARA RS  K QSQSKKRQQQAQ Q  AQAASQQQ
   101  103 A L  H  X S+     0   0   63  283   75   HLLLLHH LLLLHLHLHHSHLLLLLHLLLHHLLKLHLL LL  L KLKLLQLKKKLH K  LLLLLKKK
   102  104 A Q  H  < S+     0   0   28  283    0   QQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ  Q QQQQQQQQQQQQ Q  QQQQQQQQ
   103  105 A Y  H  < S+     0   0    0  284    0   YYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY  Y YYYYYYYYYYYY Y  YYYYYYYY
   104  106 A S  H  < S+     0   0   26  284   77   RSSSSEG SSSEDSAAGGRASSSSAASSSAASSHASSS SS  G HSHSSASHHHSR H  SESSSHHH
   105  107 A A     X  +     0   0   38  284   52   DSSSKKK SASSSSNSKKANSSSSSNASSNNSSGASSS SS  G GAGSSGSGNGSG G  SKSSSGGN
   106  108 A G  T  4 S-     0   0   47  284    0   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
   107  109 A V  T  4 S+     0   0   67  284   67   VVVVVVV AVVIITIVVVIIVIVVTIVVIIIVTAVVIV IV  I AVATVVITTAVV T  VIVVVAAT
   108  110 A Y  T  4 S-     0   0   37  284   72   HHHHHYY HHYYYHYYHYYYHYHHHYHHYYYHHLHYYH YH  Y LHLHYYYLLLHY L  YYHHHLLL
   109  111 A R    ><  -     0   0   93  284   34   RKKKKKK KKKKKKKKKKKKKKKRKKKRKKKKKRKKKR KK  R RKRKKRKRRHKE R  KHKKKHHR
   110  112 A I  G >> S+     0   0    1  284    2   IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II  I IIIIIIIIIIII I  IIIIIIII
   111  113 A A  G 34 S+     0   0    0  284   58   VAAAAAA AAAAVAAAAAVAAAAAAAAAAAAAASAAAA AA  A SASAASASSSAA S  SAAAASSS
   112  114 A E  G <4 S+     0   0   71  284   59   EDDDSSS SSDTNSSSSSESSDSSSSSSSSSSSESRSS SS  D ESESSDSEEESS E  SDSSSEEE
   113  115 A W  T <4 S+     0   0    2  284    0   WWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WW  W WWWWWWWWWWWW W  WWWWWWWW
   114  116 A A     <  -     0   0    0  284   29   ASSSASA SSSAASSASSASSASSSSSSASSSSAASAS AS  A ASASSAAAAASA A  SASSSAAA
   115  117 A D  S    S+     0   0   10  284   44   DHHHQHH HHHHHDHHHHDHHHHQDHHQHHHHDHHHHQ HH  D HHHDDDHHHHHD H  HDHHHHHH
   116  118 A I  E     +de  87 144A   0  284    8   IIIILII LIIILLIIIILIIIIILISIIIIILILLII II  I IIILIIIIIIII I  IIIIIIII
   117  119 A T  E     - e   0 145A   0  284   42   VTTTTTT TTTTVTTTTTVTTTTTTTTTTTTTTITTTT TT  I ITITTITIIVTT I  TVTTTVVI
   118  120 A N  E     -de  91 146A   0  284    3   DNNNNNN NNNNTNNNNNTNNNNNNNNNNNNNNNNNNN NN  N NNNNNNNNNNNN N  NNNNNNNN
   119  121 A A  E     -de  92 147A   0  284   46   AAAAAAA AAAAVAACAAVAAAAAAAAAAAAAACAAAA AA  A CACAAAACCAAA C  AAAAAAAC
   120  122 A H        -     0   0    0  284   53   HHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHSHHHH HH  H SHSHHHHSSTHH S  HHHHHTTS
   121  123 A G  S >  S+     0   0    0  283   80   TAPPVTT ALTSGSTTTTSSPPPSSTPSLTTPSVPPLS LL  V VLVSTP.IIVPA I  PSPPLVVV
   122  124 A V  T 3  S+     0   0    0  284   33   VLLLVVV LVVVVVVVVVVVVVVVVVVVVVVVVLVVVV VL  V LVLVVILLLLVV L  ILVVVLLL
   123  125 A V  T 3  S-     0   0    4  284   51   PPPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP  P PPPPPPSPPPPP P  PPPPPPPP
   124  126 A G    X   -     0   0    0  284    1   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGPGGGGG G  GGGGGGGG
   125  127 A P  T >> S+     0   0   44  284   67   PDPPSEE DPEDSPEEEEPEPPPPPEPPEEEPPEPPEP EP  P EPEPEPAEEPPP E  PPPPPPPE
   126  128 A G  H 3> S+     0   0   25  284   30   GGGGGGG GSGGGGGGGGGGGSSSGGSSGGGSGGGSGS GG  G GSGGGGRGGGSG G  GGSSGGGG
   127  129 A I  H <> S+     0   0    0  284   36   IIIIIII IVVIIIIIIIIIIVIIIIIIIIIIIIIIII IV  I IVIIIIHIIIVI I  IIVVVIII
   128  130 A V  H <> S+     0   0    2  284   13   VVIIIII VIIVLIIIIIIIVVIVIIIVLIIIIVVILV LV  I VIVIIIPVVIII V  IIIIIIIV
   129  131 A S  H  X S+     0   0   71  284   73   QKSSTKT HTTTSTKQKKTKTTSATKSATKKSTESKTA TT  E ESETQRDEEDSR D  TSSSSDDQ
   130  132 A G  H  X S+     0   0    7  284   35   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGAGGGG GG  G AGAGGGGAAAGG A  GGGGGAAA
   131  133 A L  H  X S+     0   0    0  284    1   LLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL  L LLLLLLLLLLLL L  LLLLLLLL
   132  134 A K  H  X S+     0   0   50  284   66   KKGGAGR KAAKNSGKAAKGAAASSAKSAAAAAAAAAS AA  W AAAARQAAAAAK S  SAAAAAAA
   133  135 A Q  H  X S+     0   0   93  284   56   EKTTSEE KKEALSEEEESESSSSSEASSEESSQASSS SK  E QKQSEESQQQAE Q  SEAAKQQQ
   134  136 A A  H  X S+     0   0    0  284   57   VVVVVVV VVVVAIVVVVAVVVVVVVVVVVVVITVVVV VV  V TVTIVIVTTVVV T  IIVVVVVT
   135  137 A A  H  X S+     0   0    6  284   28   GGGGGGG GGGGAGGGGGTGGGGGGGGGGGGGGAGGGG GG  G AGAGGGGAAAGA A  GGGGGAAA
   136  138 A E  H  < S+     0   0  132  284   84   LLKKLLL LLILeLLLLLALTLQLLLLLLLLQLsRLLL QV  K sQaLLLLsqsLD s  TLLLQssq
   137  139 A E  H  < S+     0   0  129  222   34   .E..... ....k.....G..............d.... ..  . d.d....edd.G d  .....ddd
   138  140 A V  H  < S+     0   0   49  284   90   PKPPppp ppPPIpppppVppPpppppppppppfpppp pp  T fpfppVpdffpI f  pPpppfff
   139  141 A T     <  -     0   0   33  208   67   ....... ....G....................g.... ..  . g.g....gga.. g  .....aag
   140  142 A K  S    S+     0   0  181  232   87   R.KK... ..KLQ.....Q..R...........P.... ..  K P.P..K.SSS.G P  .K...SSS
   141  143 A E  S    S-     0   0   78  236   37   G.GG... ..GEH.....S..G...........E.... ..  G E.E..K.EED.Q E  .Q...DDE
   142  144 A P        -     0   0   37  195   61   .G..ggg nn...gggggPgg.ggggggggggg.gggg gg  . .g.gn.g...gP .  g.ggg...
   143  145 A R        -     0   0   15  282   12   RRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR  A RRRRRRRRRRRR R  RRRRRRRR
   144  146 A G  E     -e  116   0A   0  284   15   GGAAGGG GGGGGAGGGGGGGGGGGGGGGGGGAGGGGG GG  G GGGACGGGGGGG G  GAGGGGGG
   145  147 A L  E     -ef 117 177A   0  284    4   LLLLLLL LLLLALLLLLILLLLLLLLLLLLLLLLLLL LL  L LLLLLLLLLLLL L  LLLLLLLL
   146  148 A L  E     -ef 118 179A   0  284    8   LLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL  L LLLLLLLLLLLL L  ILLLLLLL
   147  149 A M  E     -ef 119 180A   0  284   38   LLLLLLL LLLLMLLLLLLLLLLLLLLLLLLLLILLLL LL  L VLILLLLIIILL I  LLLLLIII
   148  150 A L  E     + f   0 181A   3  284    1   LLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL  L LLLLLLLLLLLL L  LLLLLLLL
   149  151 A A        +     0   0    0  284    7   AAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA  A AAAAAAAAAAAA A  AAAAAAAA
   150  152 A E  S    S-     0   0   27  283   23   EQEEEEE QEEEQNEEEEEEEEEENEEEEEEENEEEEE EE  E EEENEEEEETEE E  EEEEETTE
   151  153 A L        -     0   0   23  283    7   MMMMMMM MMMMLMMMMMMMMMMMMMMMMMMMMMMMMM MM  M MMMMMMMMMMMM M  MMMMMMMM
   152  154 A S        +     0   0   75  283   27   SSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSTSSSS SS  S TSTSSSSTTTSS T  SSSSSTTT
   153  155 A C  S >  S-     0   0   28  284   20   SSSSSSS SSSSSSSSSSSSTTTTSSTTASSTSSTTAT AS  S SSSSSSASSSTS S  SSTTSSSS
   154  156 A K  T 3  S+     0   0  188  284   47   AEKKAKK AAKQKKKKQQAKKEKAKKKAKKKKKKKKKA KA  A KEKKAKKKKKKK K  KTKKAKKK
   155  157 A G  T 3  S+     0   0   44  283    1   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
   156  158 A S    <   -     0   0   36  284   53   SSNNTAA SATSSAASAANANSSSAASNNAASASSSNN NA  N SASATANSSSTN S  TNTTASSS
   157  159 A L        +     0   0   20  284   10   LLLLLLL LLLFLLLLLLLLLLLLLLLLLLLLLLLLLL LL  L LLLLLLLLLLLL L  LLLLLLLL
   158  160 A A        +     0   0   18  284   49   AAAAATT ATAAAATATTCTAAAAATAAATTAAAAAAA AT  A ATAAAAAAAAAG A  AFAATAAA
   159  161 A T     >  -     0   0   66  284   73   TVTTQKK DKKTFTKTKKPKTTTVRKTVTKKTTTTTTV TK  T TKTTKTTTTTRG T  STRRKTTT
   160  162 A G  H  > S+     0   0   48  284   37   GGGGGGG SGDGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGEGGGGGG G  GEGGGGGG
   161  163 A E  H  > S+     0   0  123  284   48   EDEEASS SAQSEESSIIESTSARESSQESSAEEATEH ES  D EDQEDGEQAQEE E  ADEESQQS
   162  164 A Y  H  > S+     0   0    9  283    0   YYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY  Y YYYYYYYYYYYY Y  YYYYYYYY
   163  165 A T  H  X S+     0   0    3  284   16   TTTTTTT TTTTTTTTTTATTTTTTTTTTTTTTTTTTT TT  T TTTTTTTTTTTQ T  TKTTTTTT
   164  166 A K  H  X S+     0   0  112  284   70   RKKKDTT QQISQKSEAARSAEEERTEEATTEKKEEAE TE  K KQTKTKATSEDQ K  SQDDQEES
   165  167 A G  H  X S+     0   0   13  284   74   AATTAEE AAEKGQEKEEREDAAEEDEEKDDAQAADKE KA  T AAAQTAKSALDR A  QKDDALLA
   166  168 A T  H  X S+     0   0    0  284   59   SSAAASS TCTTCTSTSSTSAAATTSATNSSATSAANT NC  A SCSTTSNSSSAT S  ATAACSSS
   167  169 A V  H  X S+     0   0   15  284   12   ILVVLVV LVLVVMVLVVVVVVVYVVVYVVVVMVVVVY VV  V VVVMVLVVVVVL V  VRVVVVVV
   168  170 A D  H  X S+     0   0   84  284   43   EAQQAEE DDKDQREENNEERQQQRERQEEEQRDRREQ EQ  A DDDRETEDDERA D  QHRRDEED
   169  171 A I  H >< S+     0   0    9  284   69   MMMMMMM MQMMMMMWMMMMMMMMMMMMAMMMMYMMAM AE  W YEYMLMAYILMM H  MLMMELLI
   170  172 A A  H >< S+     0   0    0  283    1   AAAAAAA AAAAAAAFAAAAAAAAAAAAAAAAAAAAAA AA  A AAAAAAAAAAAA A  AAAAAAAA
   171  173 A K  H 3< S+     0   0   51  284   31   KQrrRRR RkQRNrRERRGRRRRRrRRRRRRRrRRRRR Rk  Q RhRrRARRRRRr R  RERRKRRR
   172  174 A S  T << S+     0   0   75  283   74   QRaaERR RdRR.aRKRRDRADEDaRADRRREaKELRD Rd  K KdKaKRRKKKSr K  AQSSKKKK
   173  175 A D    <>  +     0   0   26  284   68   HHGGHNN HTHHEGNHNNHNHHNHGNNHHNNNGYHNHH HT  Y YTYGYYHYYYNE F  HFNNDYYY
   174  176 A K  T  4 S+     0   0   75  284   44   KKRRRKQ STPKSRKTKKKKSSRRRKRRPKKRRKRRPR PT  S KTKRKPPKPKSW K  RSSSTKKP
   175  177 A D  T  4 S+     0   0   90  284   44   DDDDDDD DGEENDDDDDDDDDGDDDDDEDDGENDDED EG  D NGNEDDEKSGEr G  DDEEtGGS
   176  178 A F  T  4 S+     0   0    8  284    5   FFWWFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF  F FFFFFFFFFFFf F  FFFFfFFF
   177  179 A V  E  <  +f  145   0A   1  284    4   VVVVVVV VVVVVVVCVVVVVVVVVVVVVVVVVVVVVV VV  V VVVVVVVVVVVV V  VVVVVVVV
   178  180 A I  E     -     0   0A   0  283   40   IIVVVFF ICIMAVFFFFVFIIIIIFIIMFFIVMVVMI MC  I MCMVVIMMLLIM L  IIIICLLL
   179  181 A G  E     -fg 146 196A   0  284    0   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
   180  182 A F  E     -fg 147 197A   0  284    0   FFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF  F FFFFFFFFFFFF F  FFFFFFFF
   181  183 A I  E     +fg 148 198A  10  283   12   IIIIIII IIIVIIIIIIIIIIIIIIIIVIIIIVIIVI VI  I VIVIIIVVVVII V  IIIIIVVV
   182  184 A A        -     0   0    0  283   33   AAAAAAA AASAAAAAAASAAAAGAAAGAAAAASAAAG AA  G SASAAAASSAAA S  AAAAAAAS
   183  185 A Q  S    S+     0   0   34  284   49   QqMMQqQ QmQgqqqGqqqqmqqqqqqQmqqqqtqqmQ mm  m tmtqmQmttsqM t  mQqqmsst
   184  186 A R  S    S-     0   0  108  284   68   RkggRkH QrRarrkRkkrkgrprrkrrekkprqspvr vr  r qrrrrHvpekkK p  sRkkrkke
   185  187 A D        -     0   0   38  204   79   A.dd.MK ReRdk.MRMM.Mg.GPeMgpgMMG.seD.p .e  . sEs.Y...e..E s  ....e..e
   186  188 A M        -     0   0   22  215   84   PLAA.NM LTLPLVNFNNPNEKVTENESGNNVVSSEAA AR  . SRAVE.A.A..V V  T...R..A
   187  189 A G        +     0   0   24  220   62   IGEE.EN GGESKDEPQQEEAVNGAQSGVQQNDAVDPG PE  L AAPDDQP.P..G A  D...E..P
   188  190 A G    > > +     0   0   12  245   65   PGGG.YE TGSSSEHNYYTHVDVEQYSEAYYVASDVGK GG  L SNSAKLGSAA.G S  L...GAAA
   189  191 A R  G > 5S+     0   0  123  260   82   DEDDRPK LPGLEGDLDDIDEEEGKDPGPDDEGEPTEG EP  D ETDGESEEQDPG D  AKLPPDDQ
   190  192 A D  G 3 5S+     0   0  175  284   41   DNPPLDD DNPPSEDQDDTDDQDGEDDDGDDDEDEDGD GN  D DHEEGKGEGDDE E  NLDDNDDG
   191  193 A E  G < 5S-     0   0  111  284   28   ADEEGED EMEDVEESEEDEEREEEEEEEEEEDEEEAE AT  P EREDDNAEEEEE E  ETEETEEE
   192  194 A G  T < 5S+     0   0   49  284   45   SDGGDDE GQEDAGDDDDEDDDDDEDDDGDDDGDDDDD DE  N DDDGDPDDDDDG D  DEDDEDDD
   193  195 A Y      < -     0   0   42  284   24   FFkkEFD FRDFsDFYFFYFFFFFeFFFAFFFDFFFYF YR  F FLFDFAYFFFFE F  FhFFRFFF
   194  196 A D        -     0   0   38  116    1   ..ddD.. .D..d...........d...D......... .D  . ...........D .  .g..D...
   195  197 A W        -     0   0   12  124    7   ..FFW.F .LW.WW..........W...Y...W..... .L  . ...W.W.....F .  .W..L...
   196  198 A L  E     -g  179   0A   0  284   28   ILLLLVV LLLLLLVIVVLVLLLLLILLVIILLVLLVL VL  V VLVLILVVVVLI V  LILLLVVV
   197  199 A I  E     -g  180   0A   1  284   59   TIIIIVV IIVCIIVTVVVVIIVVIVIVIVVVIVIVIV II  T VIVIYTIVVLIV V  IYIIILLV
   198  200 A M  E     -gh 181 228A   0  284   23   MLLLLMM LLLFLMMMMMLMLLLLMMLLMMMLMFLLML ML  M FLFMMMMFFFLM F  LLLLLFFF
   199  201 A T  E     - h   0 229A   0  284   11   TTTTTTA TTSSTSSSSSTSTTTTSSTTTSSTSTTTTT TT  T TTTSTTTTTTTT T  TTTTTTTT
   200  202 A P        +     0   0   31  284   27   PPPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPTPPPP PP  P TPTPPPPTTTPP T  PPPPPTTT
   201  203 A G  S    S+     0   0   33  284    0   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
   202  204 A V  E     +i  216   0B   8  284   31   IVVVVVV VVVVVVVIVVVVVVVVVVVVVVVVVVVVVV VV  I VVVVVVVVVVVV V  VVVVVVVV
   203  205 A G  E     -i  217   0B   3  283   56   NGGGQGG GGGGAGGGGGSGGGGGGGGGGGGGGNGGGG GG  N NGNGGKGNNNGG N  GQGGGNNN
   204  206 A L        -     0   0   35  283    8   LLLLLLL LLLLILLLLLLLLLLLLLLLLLLLLLLLLL LL  F LLLLLKLLLLLL L  LFLLLLLL
   205  207 A D        -     0   0   97  283   62   TDVVGDD DDDAGADDDDADDDDDADDDDDDDASDDDD DD  A SDSADEDSSAEQ A  DIEEDAAS
   206  208 A D    >   -     0   0   41  283   76   VVAASIV VVVTIAVVVVAVVQVVAVTVSVVVASTSSV SV  D SVSAQCSSSSVV S  AEVVVSSS
   207  209 A K  T 3  S+     0   0  216  283   49   SKKKGKK KKMKTKKKKKKKKKKKKKRKKKKKKKRKKK KK  K KKKSTsKKKKKG K  KKKKKKKK
   208  210 A G  T 3  S+     0   0   77  258   14   GGGGGGG GGGGGGGGGGGGGGGGGGGAGGGGGGGGGA GG  G GGGGSaGGGGGG G  GKGGGGGG
   209  211 A D    <>  +     0   0   42  265    9   DDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD  D DDDDDEDDDDDD D  DDDDDDDD
   210  212 A A  T  4 S+     0   0   76  266   64   AGKKSGG GGSAGKGGGGAGSGGGKGSGGGGGKKGAGG GA  Q KGKKGGGKKAAG K  SAAAAAAK
   211  213 A L  T >4 S+     0   0   87  267   44   TMLLMLL MLLMLLLLLLMLMMMMLLMMMLLMLLMMMM MM  L LLLLLLMLLLML L  MHMMMLLL
   212  214 A G  G >4 S+     0   0    9  281   17   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  K GGGGGGGGGGGG G  GGGGGGGG
   213  215 A Q  G 3< S+     0   0   89  282   19   QQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ  Q QQQQQQQQQQQQ Q  QQQQQQQQ
   214  216 A Q  G <  S+     0   0  148  282    3   QQQQQQQ QQNQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ  Q QQQQQHQQQQQQ Q  QQQQQQQQ
   215  217 A Y  S <  S-     0   0  109  282    0   YYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY  Y YYYYWYYYYYYY Y  YYYYYYYY
   216  218 A R  E     -i  202   0B  69  282   57   RRRRNRR RRRRKRRRRRARRRRRRRRRRRRRRQRRRR RR  V QRQRKIRQQQRR Q  RIRRRQQQ
   217  219 A T  E  >  -i  203   0B  45  282    7   TTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TT  T TTTTHSTTTTTT T  TTTTTTTT
   218  220 A V  H  > S+     0   0    0  282   47   PPPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP  P PPPPPPPPPPPP P  PPPPPPPP
   219  221 A D  H  > S+     0   0   71  282   63   AERRRHY DDHKEKHEHHQHRRKRRRRRDRRKKAKEDR DD  E ADEKREDEQEDE E  RSDDDEEQ
   220  222 A D  H  > S+     0   0   67  282   64   QEEEEEQ EQQEMEEEQQNEEEQEEEEEEEEQESEEEE EE  Q SQSEEQESSSEE S  EDEEQSSS
   221  223 A V  H  X>S+     0   0    0  282   45   AVVVVVV VVVVAVVVVVAVVVVVVVVVVVVVVAVVVV VV  A AVAVVAVAAAVV A  VAVVVAAA
   222  224 A V  H ><5S+     0   0    0  283   19   VIVVVII VIVIMVIIIIIIVVVIVIVIIIIVVIIIII II  I IIIVVIIVVIIV I  VIIIIIII
   223  225 A S  H 3<5S+     0   0   78  284   81   EKYYRVV DRFGELVVVVEVLYQLLVILRVVQRGTLRL RR  Q GRGRYARGGGRG G  LLRRRGGG
   224  226 A T  H 3<5S-     0   0   58  284   84   TAddRee AeeqReeneeReekeeeeeeeeeedRedee ge  G ReRddeeRRGqr R  eqqqeGGR
   225  227 A G  T <<5S+     0   0    6  284    3   GGggGgg GgggGgggggNgggggggnggggggGgggg gg  G GgGggggGGGgg G  gegggGGG
   226  228 A S      < -     0   0    0  284   59   STCCACC TCSSSAGSGGSGCCCCAACCCAACAACCCC CC  S ACAACACAAACC A  CTCCCAAA
   227  229 A D  S    S+     0   0    0  284    0   DDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD  D DDDDDDDDDDDD D  DDDDDDDD
   228  230 A I  E    S- h   0 198A   0  284   31   VVVVVVV VVVIVVIIIIIIVVVVVVVVVVVVVFVVVV VV  I FVFVVIVFFFVV F  VIVVVFFF
   229  231 A I  E     -ah  30 199A   0  284   19   LIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II  I IIIIIIIIIIIV I  IIIIIIII
   230  232 A I  E     -a   31   0A   6  284    0   IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II  I IIIIIIIIIIII I  IIIIIIII
   231  233 A V  E     +a   32   0A   1  284   33   VVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVAVVVV VV  V AVAVVVVASSVV A  VVVVVSSS
   232  234 A G    >   +     0   0   23  284    0   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
   233  235 A R  G >> S+     0   0  126  284    0   RRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR  R RRRRRRRRRRRR R  RRRRRRRR
   234  236 A G  G 34 S+     0   0   18  284    0   GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGGGGGGGG G  GGGGGGGG
   235  237 A L  G <4 S+     0   0    0  284   25   VVIIVII VIIIIIIVIIIIIIIVIIVIIIIIIIIVIV II  I IIIIIIIIIIVI I  IIVVIIII
   236  238 A F  T <4 S+     0   0   24  284   34   YTYYYYY TYYYIYYYYYYYYYYYYYYYYYYYYYYYYY YY  Y YYYYYYYYYYYV Y  YIYYYYYY
   237  239 A A  S >< S+     0   0   22  284   59   TgggGGG ggkgGgGGGGGGgggggGgggGGggAgggg gg  G AgAgGQgAAAgG A  gKgggAAA
   238  240 A K  T 3  S-     0   0  176  165   62   .dggKKN dadeDgNAQQ.NslklgQnlpQQkg.dapl pa  . .a.gK.p...d. .  n.dda...
   239  241 A G  T 3  S+     0   0   84  284   53   AYRRRPP YFDTDEPGPPAPDTVTEPATNPPVEAVTNT NW  A AFAEGANAAAVA A  DAVVFAAA
   240  242 A R    <   -     0   0   78  284   77   AQEEGDD IEDSKEDRDDADAEEEEDEEEDDEEPQAEE ER  S PAAERDEPAPED P  AKEEDPPA
   241  243 A D     >  -     0   0   91  284   27   DKAAEEQ KREVEAQNQQDQEAEAAKAAEKKEADAAEA ER  D DKDADNEDDDAD D  DDAAKDDD
   242  244 A A  H  > S+     0   0    8  284   53   PAVVAVI SVIIPVVPVVIVVIIIVLVIILLIVPVIII IV  P PVPVPPIPPPIP P  IPIIVPPP
   243  245 A K  H  > S+     0   0   92  283   82   VALLGEE ARFVIKEVEEAERKRAKVRAVVVRKVQVVA VR  S VSVKAVVVVVRV V  QLRRRVVV
   244  246 A V  H  > S+     0   0   79  283   82   AAAAKAF EEKEKAAVAAGAESRQAEAQKEERAEAAKQ KE  L EEEAKIKEEDQA E  AQQQQDDE
   245  247 A E  H  X S+     0   0   23  283   47   SEEEEQQ QQQEEEQEQQTQQQQQEQQQQQQQEAQRQQ QQ  A AQAEESQAAARI A  QERRQAAA
   246  248 A G  H  X S+     0   0    0  283   40   AAAAASA AGAAAAAAAATAAAAAAAAACAAAAAAACA CG  A AGVAAACAAAAA A  AAAAGAAA
   247  249 A E  H  X S+     0   0   55  283   56   IQEEEKK LELKIEKKQQMKEKEEEQEEKQQEEREEKE KE  K QEQEKQKKKREE K  EKEESRRK
   248  250 A R  H  X S+     0   0   78  283   26   ARKKRRR RRRRRRRRRRERRRRRRRRRRRRRRRRRRR RR  Q RRRRRQRRQRRV Q  RHRRRRRQ
   249  251 A Y  H  X S+     0   0    9  283    0   YYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY  Y YYYYYYYYYYYY Y  YYYYYYYY
   250  252 A R  H  X S+     0   0   37  283   33   KKRRRRK KKKKRRRRRRKRRQQRRRRRQRRQRQRMQR QK  R QKQRQRQQQQRR Q  RRRRKQQQ
   251  253 A K  H  X S+     0   0   95  283   64   QKEEKEE KKDEEEQEQQQQRVADEQAEEQQAEKAAEE EK  E KTKEEKEKQKQE R  KNQQKKKQ
   252  254 A A  H  X S+     0   0   16  283   49   AAEEEAA AAAAAEAAAAAAEEAAEAESAAAAEEEEAS AA  A EAEEALAEQAER A  EIEEAAAQ
   253  255 A G  H  X S+     0   0    0  283   20   GGGGGGG GGGGAGGGGGGGGGGGGGGGGGGGGGGGGG GG  G GGGGGAGGGGGS G  GAGGGGGG
   254  256 A W  H  X S+     0   0   19  283    0   WWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WW  W WWWWWWWWWWWW W  WWWWWWWW
   255  257 A E  H  X S+     0   0   83  283   62   AEKKENN DEQTNKDKDDQDVAASKDKSKDDAKEAAKS KE  K EDEKNEKDEDDR E  ADDDEDDE
   256  258 A A  H  X S+     0   0    1  283    1   AAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA  A AAAAATAAAAAA A  AAAAAAAA
   257  259 A Y  H  < S+     0   0   21  281    0   YLYYYYY  YYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY  Y YYYYYYYYYYYY Y  YYYYYYYY
   258  260 A L  H  < S+     0   0  113  277   62   LTEELLL  LLLLELQLLLLELILELQLELLIEMLLEL EL  Q MLLELLELLLLE T  E LLLLLL
   259  261 A R  H  <        0   0  157  277   66   AKEEAEE  AQAKEEQEEDEGDEEEEEEDEEEEAARDE DK  H AKKEESDKAKKG A  E KKAKKA
   260  262 A R     <        0   0   89  273    4   R RRRRR  RRR RRRRRKRRRRRRRRRRRRRRRRRRR RR  R RRRRR RRRRRR R  R RRRRRR
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58                                         T     T              R         
   263    4 C A        -     0   0   31  121   71          P                              T     Q              E         
   264    5 C T     >  -     0   0   47  219   38  T       S                              S  TT T              T         
   265    6 C Y  H  > S+     0   0    0  253    0  Y       Y                              F  YY Y            Y YF        
   266    7 C K  H  > S+     0   0  122  253   72  T       E                              E  LL D            S ED        
   267    8 C E  H  > S+     0   0   70  253   62  E       A                              Q  EE V            T AK        
   268    9 C R  H  X S+     0   0    2  253    1  R       R                              R  RR R            R RR        
   269   10 C A  H  < S+     0   0   21  253   21  A       A                              A  AA L            A AI        
   270   11 C A  H  < S+     0   0   47  253   71  N       N                              A  AA S            S AG        
   271   12 C T  H  < S+     0   0   31  253   83  V       V                              A  SS N            N KN        
   272   13 C H     <  -     0   0   13  254   44  H       H                              A  HH H            H NQ        
   273   14 C P  S    S+     0   0   45  257   60  P       K                              T  PP T            S SS        
   274   15 C S     >  -     0   0    0  257   59  N       S                              N  NN N            N NS        
   275   16 C P  H  > S+     0   0   82  261   28  A       A                              P  AA P            P PK        
   276   17 C V  H  > S+     0   0    0  264   54  V       F                              T  AA A            I LL        
   277   18 C A  H  > S+     0   0    0  264   29  A       A                              T  AA A            S VS        
   278   19 C A  H  X S+     0   0   22  264   67  K       A                              K  RR R            K SK        
   279   20 C K  H  X S+     0   0   73  264   74  K       R                              H  KK A            Q DD        
   280   21 C L  H  X S+     0   0    0  265    2  L       V                              L  LL L            L IL        
   281   22 C F  H  X S+     0   0    0  265   13  L       L                              F  LL L            L FL        
   282   23 C N  H  X S+     0   0   69  265   71  R       K                              E  EE E            N RQ        
   283   24 C I  H  X S+     0   0    2  265   41  L       L                              L  II C            L IL        
   284   25 C M  H  X>S+     0   0    0  266   52  M       V                              M  MM I            M IV        
   285   26 C H  H  <5S+     0   0   75  266   50  D       A                              V  DD L            E AE        
   286   27 C E  H  <5S+     0   0  112  266   83  E       A                              R  RR R            E ER        
   287   28 C K  H  <5S-     0   0   40  266    0  K       K                              K  KK K            K KK        
   288   29 C Q  T  <5 +     0   0  109  266   48  K       K                              Q  KK R            Q KQ        
   289   30 C T      < +     0   0    0  266   40  S       T                              T  TT S            S TS        
   290   31 C N        +     0   0    0  266    0  N       N                              N  NN N            N NN        
   291   32 C L  E     -s  740   0E   0  266   15  L       L                              L  LL L            L LL        
   292   33 C C  E     -st 741 577E   0  266   47  S       C                              A  CC C            C CC        
   293   34 C A  E     -st 742 578E   0  265   57  V       A                              V  VV V            V VV        
   294   35 C S  E     - t   0 579E  14  266   11  A       S                              A  SS S            S SS        
   295   36 C L        +     0   0    2  266   60  V       L                              A  VV V            L LV        
   296   37 C D        +     0   0   54  266    0  D       D                              D  DD D            D DD        
   297   38 C V        -     0   0    6  266   11  L       V                              V  VV L            V VF        
   298   39 C R  S    S+     0   0  150  266   65  T       T                              T  TT S            T TN        
   299   40 C T     >  -     0   0   17  266   45  K       T                              T  TT T            S TT        
   300   41 C T  H  > S+     0   0   13  266   53  K       T                              V  SS S            K TK        
   301   42 C K  H  > S+     0   0  139  266   68  N       K                              A  AA A            S TD        
   302   43 C E  H  > S+     0   0   77  266   31  Q       E                              E  EE E            A KS        
   303   44 C L  H  X S+     0   0    5  266   12  V       L                              L  VV L            F LL        
   304   45 C L  H  X S+     0   0   40  266    4  L       I                              L  LL L            L LL        
   305   46 C E  H  X S+     0   0  108  266   75  E       E                              H  EE E            R KK        
   306   47 C L  H  X S+     0   0   29  266   27  L       L                              I  VV V            I LM        
   307   48 C V  H  X S+     0   0    0  265   56  V       A                              A  VV V            A AV        
   308   49 C E  H  < S+     0   0   77  266   24  D       D                              D  RR D            N DE        
   309   50 C A  H  < S+     0   0   26  266   77  K       K                              V  NN A            L DA        
   310   51 C L  H >X S+     0   0    0  263   31  I       V                              L  VV V            I LV        
   311   52 C G  G >< S+     0   0    0  263    2  G       G                              G  AA G            G GG        
   312   53 C P  G 34 S+     0   0   48  266   17  P       P                              P  PP P            P PP        
   313   54 C K  G <4 S+     0   0   30  266   73  S       Y                              H  AA S            H YY        
   314   55 C I    <<  -     0   0    0  266   15  I       V                              I  VV V            I VV        
   315   56 C C  S    S+     0   0    0  265   43  C       C                              C  CC C            C CC        
   316   57 C L  E     -tu 553 607E   0  265   31  L       M                              V  MM L            M IM        
   317   58 C L  E     -tu 554 608E   0  265   31  L       I                              L  VV I            L FI        
   318   59 C K  E     -tu 555 609E  22  265    1  K       K                              K  KK K            K KK        
   319   60 C T  E     - u   0 610E   2  264    2  T       T                              T  TT T            T TT        
   320   61 C H    >   +     0   0   26  264    1  H       H                              H  HH H            H HH        
   321   62 C V  G >   +     0   0    3  265   39  I       I                              V  II M            I IV        
   322   63 C D  G 3  S+     0   0   74  265    1  D       D                              D  DD D            D DD        
   323   64 C I  G <  S+     0   0   82  265   11  I       I                              I  II I            I II        
   324   65 C L    <   -     0   0   15  266   28  V       I                              L  II V            I II        
   325   66 C T  S    S+     0   0   88  266   64  E       D                              S  SS E            T DS        
   326   67 C D  S    S+     0   0   71  266   10  D       D                              D  DD D            D DD        
   327   68 C F        +     0   0   35  266    7  F       F                              F  FF F            F FF        
   328   69 C S     >> -     0   0   45  202   62  D       T                              T  T. D            D SD        
   329   70 C M  I  4>S+     0   0   44  203   88  .       Y                              t  PT Q            Q YI        
   330   71 C E  I  45S+     0   0  135  194   54  A       A                              d  AP .            . K.        
   331   72 C G  I  45S+     0   0   33  250   62  D       G                              A  LA S            D SD        
   332   73 C T  I  X5S+     0   0    2  252   41  M       T                              F  TL V            L TL        
   333   74 C V  I  > S+     0   0   37  266   72  Q       P                              K  LE R            K PK        
   336   77 C L  H  X S+     0   0    3  266    0  L       L                              L  AL L            L LL        
   337   78 C K  H  X S+     0   0   68  265   79  V       K                              R  .A R            V VK        
   338   79 C A  H  X S+     0   0   60  266   62  A       E                              P  KK V            E EE        
   339   80 C L  H  X S+     0   0   13  266   12  L       L                              L  LL L            L LL        
   340   81 C S  H  X>S+     0   0   15  266   37  A       A                              A  AA S            S SS        
   341   82 C A  H  <5S+     0   0   80  266   70  E       L                              D  DD E            K KV        
   342   83 C K  H  <5S+     0   0  134  266   19  K       K                              K  EE K            K KK        
   343   84 C Y  H  <5S-     0   0   51  266   36  H       H                              H  FF H            H HY        
   344   85 C N  T  <5 +     0   0   60  266   55  K       G                              G  DD D            N ND        
   345   86 C F      < -     0   0    0  266    0  F       F                              F  FF F            F FF        
   346   87 C L  E     -u  577   0E   6  266   11  L       F                              V  VV L            L LL        
   347   88 C L  E     -u  578   0E   0  266   12  I       L                              V  II I            I II        
   348   89 C F  E     -uv 579 638E   0  266    0  F       F                              F  FF F            F FF        
   349   90 C E  E     -u  580   0E   0  266    0  E       E                              E  EE E            E EE        
   350   91 C N  E     +     0   0E  30  266    0  D       D                              D  DD D            D DD        
   351   92 C R  E     -     0   0E  47  266    0  R       R                              R  RR R            R RR        
   352   93 C K  E     - v   0 640E  85  266    0  K       K                              K  KK K            K KK        
   353   94 C F  E     + v   0 641E   3  266    0  F       F                              F  FF F            F FF        
   354   95 C A        +     0   0   46  265   45  A       A                              A  AA A            A AA        
   355   96 C D        -     0   0   67  265    0  D       D                              D  DD D            D DD        
   356   97 C I    >>  +     0   0   79  265    1  I       I                              I  II I            I II        
   357   98 C G  H 3> S-     0   0   39  265    0  G       G                              G  GG G            G GG        
   358   99 C N  H 3> S+     0   0  113  265   28  N       N                              N  NN N            N SN        
   359  100 C T  H <> S+     0   0   75  265    2  T       T                              T  TT T            T TT        
   360  101 C V  H  X S+     0   0    0  265    5  V       V                              V  VV V            V VV        
   361  102 C K  H  X S+     0   0   23  265   59  K       K                              K  AA V            K QS        
   362  103 C L  H  X S+     0   0   92  265   78  L       H                              H  LL L            L HL        
   363  104 C Q  H  < S+     0   0   76  265    0  Q       Q                              Q  QQ Q            Q QQ        
   364  105 C Y  H  < S+     0   0    0  266    0  Y       Y                              Y  YY Y            Y YY        
   365  106 C S  H  < S+     0   0   23  266   78  S       K                              R  SS S            S DS        
   366  107 C A  S  X S+     0   0   34  266   52  A       N                              D  SS K            S SS        
   367  108 C G  T  4 S-     0   0   60  266    0  G       G                              G  GG G            G GG        
   368  109 C V  T  4 S+     0   0  105  266   63  V       V                              V  VV V            V IV        
   369  110 C Y  T  4 S-     0   0   49  266   65  Y       Y                              H  HH H            Y YH        
   370  111 C R    ><  +     0   0   95  266   34  K       R                              R  KK K            K KK        
   371  112 C I  G >>  +     0   0    0  266    2  I       I                              I  II I            I II        
   372  113 C A  G 34 S+     0   0    0  266   52  A       A                              V  AA A            A VA        
   373  114 C E  G <4 S+     0   0   81  266   60  S       E                              E  DD S            D ND        
   374  115 C W  T <4 S+     0   0    3  266    0  W       W                              W  WW W            W WW        
   375  116 C A     <  -     0   0    0  266   30  A       S                              A  SS A            S AS        
   376  117 C D  S    S+     0   0    8  266   44  D       D                              D  HH Q            H HH        
   377  118 C I  E     +vw 609 666E   0  266    8  I       I                              I  II L            I LI        
   378  119 C T  E     - w   0 667E   0  266   42  T       T                              V  TT T            T VT        
   379  120 C N  E     -vw 613 668E   1  266    2  N       N                              D  NN N            N TN        
   380  121 C A  E     -vw 614 669E   0  266   41  C       A                              A  AA A            A VA        
   381  122 C H    >   -     0   0   37  266   50  H       H                              H  HH H            H HH        
   382  123 C G  G >  S+     0   0    5  265   79  T       G                              T  PP V            T GA        
   383  124 C V  G 3  S+     0   0   99  266   30  V       V                              V  LL V            V VL        
   384  125 C V  G <  S-     0   0   53  266   52  P       P                              P  PP P            P PP        
   385  126 C G    X   -     0   0   15  266    1  G       G                              G  GG G            G GG        
   386  127 C P  T >> S+     0   0   74  266   64  E       T                              P  PP S            E SD        
   387  128 C G  H 3> S+     0   0   26  266   25  G       G                              G  GG G            G GG        
   388  129 C I  H <> S+     0   0    0  266   24  I       I                              I  II I            V II        
   389  130 C V  H <> S+     0   0    2  266   13  I       I                              V  II I            I LV        
   390  131 C S  H  X S+     0   0   72  266   72  S       A                              Q  SS T            T SK        
   391  132 C G  H  X S+     0   0    6  266   30  G       G                              G  GG G            G GG        
   392  133 C L  H  X S+     0   0    0  266    0  L       L                              L  LL L            L LL        
   393  134 C K  H  X S+     0   0   54  266   67  K       R                              K  GG A            A NK        
   394  135 C Q  H  X S+     0   0   97  266   56  E       A                              E  TT S            E LK        
   395  136 C A  H  X S+     0   0    1  266   60  V       G                              V  VV V            V AV        
   396  137 C A  H  X S+     0   0    4  266   31  G       A                              G  GG G            G AG        
   397  138 C E  H  < S+     0   0  134  266   84  L       e                              L  KK L            I eL        
   398  139 C E  H  < S+     0   0  125  202   30  .       k                              .  .. .            . kE        
   399  140 C V  H  < S+     0   0   51  266   88  P       e                              P  PP p            P IK        
   400  141 C T     <  -     0   0   35  193   67  .       d                              .  .. .            . G.        
   401  142 C K  S    S+     0   0  179  212   85  .       Y                              R  KK .            K Q.        
   402  143 C E  S    S-     0   0   91  218   33  L       e                              G  GG .            G H.        
   403  144 C P        -     0   0   33  183   56  G       s                              .  .. g            . .G        
   404  145 C R        -     0   0   20  264   15  R       Q                              R  RR R            R RR        
   405  146 C G  E     -w  638   0E   0  266   17  G       Y                              G  AA G            G GG        
   406  147 C L  E     -wx 639 699E   0  266    6  L       K                              L  LL L            L AL        
   407  148 C L  E     -wx 640 701E   0  266   11  L       E                              L  LL L            L LL        
   408  149 C M  E     -wx 641 702E   0  266   38  L       F                              L  LL L            L ML        
   409  150 C L  E     + x   0 703E   3  266    2  L       L                              L  LL L            L LL        
   410  151 C A        +     0   0    0  266    8  A       v                              A  AA A            A AA        
   411  152 C E  S    S-     0   0   24  266   18  E       e                              E  EE E            E QQ        
   412  153 C L        -     0   0   44  266    7  M       L                              M  MM M            M LM        
   413  154 C S        +     0   0   78  266   31  S       S                              S  SS S            S SS        
   414  155 C C  S >  S-     0   0   79  266   22  S       C                              S  SS S            S SS        
   415  156 C K  T 3  S+     0   0  214  266   44  K       K                              A  KK A            K KE        
   416  157 C G  T 3  S+     0   0   68  265    2  G       G                              G  GG G            G GG        
   417  158 C S    <   -     0   0   38  266   49  T       S                              S  NN T            T SS        
   418  159 C L        +     0   0  148  266    8  L       L                              L  LL L            L LL        
   419  160 C A        +     0   0    6  266   41  A       A                              A  AA A            A AA        
   420  161 C T    >   -     0   0   55  266   75  T       T                              T  TT Q            K FV        
   421  162 C G  T 3> S+     0   0   20  266   28  G       G                              G  GG G            D GG        
   422  163 C E  H 3> S+     0   0   81  266   50  S       E                              E  EE A            Q ED        
   423  164 C Y  H <> S+     0   0   59  265    0  Y       Y                              Y  YY Y            Y YY        
   424  165 C T  H  > S+     0   0    3  266   18  T       S                              T  TT T            T TT        
   425  166 C K  H  X S+     0   0   78  266   69  Q       K                              R  KK D            I QK        
   426  167 C G  H  X S+     0   0   26  266   76  A       Q                              A  TT A            E GA        
   427  168 C T  H  X S+     0   0    2  266   58  T       T                              S  AA A            T CS        
   428  169 C V  H  X S+     0   0   16  266   12  L       I                              I  VV L            L VL        
   429  170 C D  H  < S+     0   0   78  266   45  E       E                              E  QQ A            K QA        
   430  171 C I  H >< S+     0   0   21  266   63  L       L                              M  MM M            M MM        
   431  172 C A  H >< S+     0   0    0  265    1  A       A                              A  AA A            A AA        
   432  173 C K  T 3< S+     0   0   53  266   33  E       R                              K  rr R            Q NQ        
   433  174 C S  T <  S+     0   0   73  265   75  K       S                              Q  aa E            R .R        
   434  175 C D    <>  +     0   0   19  266   71  H       D                              H  GG H            H EH        
   435  176 C K  T  4 S+     0   0   81  266   48  N       P                              K  RR R            P SK        
   436  177 C D  T  4 S+     0   0   84  266   43  D       E                              D  DD D            E ND        
   437  178 C F  T  4 S+     0   0   10  266    7  F       F                              F  WW F            F FF        
   438  179 C V  E  <  +x  667   0E   1  266    5  C       V                              V  VV V            V VV        
   439  180 C I  E     -     0   0E   0  265   40  M       V                              I  VV V            I AI        
   440  181 C G  E     -xy 668 718E   0  266    0  G       G                              G  GG G            G GG        
   441  182 C F  E     -xy 669 719E   0  266    0  F       F                              F  FF F            F FF        
   442  183 C I  E     +xy 670 720E  10  265   12  I       I                              I  II I            I II        
   443  184 C A        -     0   0    0  265   31  A       A                              A  AA A            S AA        
   444  185 C Q  S    S+     0   0   34  266   53  R       Q                              Q  MM Q            Q qq        
   445  186 C R  S    S-     0   0  111  266   66  R       N                              R  gg R            R rk        
   446  187 C D        -     0   0   41  192   77  R       .                              A  dd .            R k.        
   447  188 C M        -     0   0   20  204   82  F       .                              P  AA .            L LL        
   448  189 C G        +     0   0   25  210   61  P       R                              I  EE .            E KG        
   449  190 C G    > > +     0   0    6  236   63  G       P                              P  GG .            S SG        
   450  191 C R  G > 5S+     0   0  123  254   81  L       K                              D  DD R            G EE        
   451  192 C D  G 3 5S+     0   0  160  266   42  K       G                              D  PP L            P SN        
   452  193 C E  G < 5S-     0   0  108  266   30  S       D                              A  EE G            E VD        
   453  194 C G  T < 5S+     0   0   55  266   45  D       S                              S  GG D            E AD        
   454  195 C Y      < -     0   0   50  266   25  F       E                              F  kk E            D sF        
   455  196 C D        -     0   0   39  116    5  .       D                              .  dd D            . d.        
   456  197 C W        -     0   0   10  123    9  .       W                              .  FF W            W W.        
   457  198 C L  E     -y  701   0E   0  266   29  I       L                              I  LL L            L LL        
   458  199 C I  E     -y  702   0E   2  266   51  H       I                              T  II I            V II        
   459  200 C M  E     -yz 703 739E   0  266   26  M       L                              M  LL L            L LL        
   460  201 C T  E     - z   0 740E   0  266   13  T       T                              T  TT T            S TT        
   461  202 C P        +     0   0   28  266   31  P       P                              P  PP P            P PP        
   462  203 C G  S    S+     0   0   54  266    0  G       G                              G  GG G            G GG        
   463  204 C V              0   0   12  266   14  V       V                              I  VV V            V VV        
   464  205 C G              0   0   61  266   52  g       g                              n  gg q            g ag        
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54  r       r                              r  rr n            r kr        
   467  219 C T     >  -     0   0   79  264    8  T       T                              T  TT T            T TT        
   468  220 C V  H  > S+     0   0   11  264   49  P       V                              P  PP P            P PP        
   469  221 C D  H  > S+     0   0   79  265   63  E       E                              A  RR R            H EE        
   470  222 C D  H  > S+     0   0   59  265   63  E       D                              Q  EE E            Q ME        
   471  223 C V  H  X>S+     0   0    0  265   45  V       V                              A  VV V            V AV        
   472  224 C V  H ><5S+     0   0    0  265   19  I       M                              V  VV V            V MI        
   473  225 C S  H 3<5S+     0   0   52  266   85  C       S                              E  YY R            F EK        
   474  226 C T  H 3<5S-     0   0   59  266   80  e       T                              T  dd R            e RA        
   475  227 C G  T <<5S+     0   0    8  266    4  q       G                              G  gg G            g GG        
   476  228 C S      < -     0   0    0  266   60  S       T                              S  CC A            S ST        
   477  229 C D  S    S+     0   0    0  266    0  D       D                              D  DD D            D DD        
   478  230 C I  E     - z   0 720E   0  266   33  I       I                              V  VV V            V VV        
   479  231 C I  E     -sz 552 721E   0  266   11  I       I                              L  II I            I II        
   480  232 C I  E     -s  553   0E   7  266    0  I       I                              I  II I            I II        
   481  233 C V  E     +s  554   0E   2  266   36  V       V                              V  VV V            V VV        
   482  234 C G    >   +     0   0   22  266    0  G       G                              G  GG G            G GG        
   483  235 C R  T 3> S+     0   0  121  266    0  R       R                              R  RR R            R RR        
   484  236 C G  T 34 S+     0   0   21  266    0  G       G                              G  GG G            G GG        
   485  237 C L  T <4 S+     0   0    0  266   26  V       L                              V  II V            I IV        
   486  238 C F  T  4 S+     0   0   27  266   29  Y       Y                              Y  YY Y            Y IT        
   487  239 C A  S >< S+     0   0   10  266   52  G       G                              T  gg G            k Gg        
   488  240 C K  T 3  S-     0   0  178  164   62  S       Q                              .  gg K            d Dd        
   489  241 C G  T 3  S+     0   0   83  266   55  G       N                              A  RR R            D DY        
   490  242 C R    <   -     0   0  111  266   76  R       R                              A  EE G            D KQ        
   491  243 C D     >  -     0   0   96  266   30  D       D                              D  AA E            E EK        
   492  244 C A  H  > S+     0   0    8  266   56  A       P                              P  VV A            I PA        
   493  245 C K  H  > S+     0   0   83  265   82  A       I                              V  LL G            F IA        
   494  246 C V  H  > S+     0   0   81  265   81  Q       E                              A  AA K            K KA        
   495  247 C E  H  X S+     0   0   22  265   50  E       E                              S  EE E            Q EE        
   496  248 C G  H  X S+     0   0    0  265   42  A       A                              A  AA A            A AA        
   497  249 C E  H  X S+     0   0   67  265   58  E       K                              I  EE E            L IQ        
   498  250 C R  H  X S+     0   0  141  265   28  R       R                              A  KK R            R RR        
   499  251 C Y  H  X S+     0   0   20  265    0  Y       Y                              Y  YY Y            Y YY        
   500  252 C R  H  X S+     0   0   41  265   36  R       Q                              K  RR R            K RK        
   501  253 C K  H  X S+     0   0  101  265   61  K       K                              Q  EE K            D EK        
   502  254 C A  H  X S+     0   0   28  265   48  A       A                              A  EE E            A AA        
   503  255 C G  H  X S+     0   0    0  265   15  G       G                              G  GG G            G AG        
   504  256 C W  H  X S+     0   0   22  265    0  W       W                              W  WW W            W WW        
   505  257 C E  H  X S+     0   0   86  265   62  E       E                              A  KK E            Q NE        
   506  258 C A  H  X S+     0   0    2  265    2  A       A                              A  AA A            A AA        
   507  259 C Y  H  < S+     0   0   25  262    0  Y       Y                              Y  YY Y            Y YL        
   508  260 C L  H  < S+     0   0  108  258   55  Q       Q                              L  EE L            L LT        
   509  261 C R  H  < S+     0   0  136  258   68  R       K                              A  EE A            Q KK        
   510  262 C R  S  < S-     0   0   31  254    5  R                                      R  RR R            R           
   511  263 C C        -     0   0   48  210   53  I                                      V     V            I           
   512  264 C G        -     0   0   35  164   41  S                                            G                        
   513  265 C Q              0   0  142  129   68  K                                                                     
   514  266 C Q              0   0  185   69   46  Q                                                                     
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    3 A K              0   0   88  128   55          R   KK    T  Q    Q  R               T          Q QQ       K  
     2    4 A A        -     0   0   48  149   71          K   QL    Q  V QQ Q  Q     Q N       K          A VV       M  
     3    5 A T     >  -     0   0   57  246   38  TT   NSTT TTPP T  S  S TTTT TST  TTS TTTTT   T      PT  S SS    S TT  
     4    6 A Y  H  > S+     0   0    0  278    1  YY   YYYY YYYY Y YY  YYYYYY YYY  YYY YYYYY   Y    YYYY  Y YY Y  Y YY Y
     5    7 A K  H  > S+     0   0  120  278   72  TS   LATA TSSG S GS  GGEETG TSS  SSA ETTTS   A    AAES  G GG G  S AK A
     6    8 A E  H  > S+     0   0  109  278   63  AA   EAAE AAVV A ET  DDQQAE AQA  AAA EAAAA   S    VVVA  D DD E  T QE I
     7    9 A R  H >X S+     0   0    6  278    0  RR   RRRR RRRR R RR  RRRRRR RRR  RRR RRRRR   R    GRRR  R RR R  R RR R
     8   10 A A  H 3< S+     0   0    7  278   23  AA   AAAA AAAA A AA  AAAAAS AAA  AAA VAAAA   A    AAGA  A AA A  A AS A
     9   11 A A  H 3< S+     0   0   88  279   72  QQ   ESSK SQKK S KS  KAKKSK SES  QQS QSSSS   A    SSRT  K KK K  K SK T
    10   12 A T  H << S+     0   0  114  278   80  SS   HKKN KSNN K NI  TLKKKN KEK  SSK NKKKK   S    RRDS  A AA Q  F RL N
    11   13 A H     <  -     0   0   22  279   56  HH   THHY HHHH H HH  HCHHHY HHH  HHH FHHHH   H    HHHH  H HH H  C HY H
    12   14 A P  S    S+     0   0   62  280   63  PP   EPPK PPPP P PP  PSGGPT PSP  PPS SPPPP   P    SSPP  A PP P  T TS P
    13   15 A S     >  -     0   0    1  281   63  NN   NNNN NNNN N NS  NNNNNN NSN  NNN NNNNN   N    NNNN  N NN H  N NN N
    14   16 A P  H  > S+     0   0   79  281   27  PP   KPAP APPI A PP  PPPPAP APA  PPA PAAAA   P    PPPP  P PP P  S PK P
    15   17 A V  H  > S+     0   0    0  283   52  LL   VLLA LLLL L LI  LAAALA LLL  LLA TLLLL   T    LLLL  L LL V  T AT L
    16   18 A A  H  > S+     0   0    0  283   37  AA   AAAA AAVV V AA  VSAAAA AMV  AAA AAAAV   A    AAAA  V VV A  G AA T
    17   19 A A  H  X S+     0   0   18  283   69  RR   KKKV KRRR K RR  RKRRKR KKK  RRK RKKKK   R    RRRR  R RR R  K KQ S
    18   20 A K  H  X S+     0   0   72  283   81  KK   KRRR RKKK K KR  RKKKRR RKK  RRQ SRRRK   R    QQRR  R RR R  K AR K
    19   21 A L  H  X S+     0   0    0  283    2  LL   LLLL LLLL L LL  LLLLLL LLL  LLL LLLLL   V    LLLL  L LL L  L LL L
    20   22 A F  H  X S+     0   0    0  283   14  FF   LFFL FFFF F FL  FFLLFL FFF  FFL LFFFF   L    FFFF  F FF F  L LL F
    21   23 A N  H  X S+     0   0   58  283   71  QQ   TEEE EQAA E EK  ETEEEE EGE  HHE EEEEE   E    QQQE  E EE E  E EE S
    22   24 A I  H  X S+     0   0    3  283   39  VV   LIIT IVTI V IL  ILTTII IIV  VVT IIIIV   T    IIIV  I II I  L TL I
    23   25 A M  H  X>S+     0   0    0  284   48  AA   MAAI AAAA A AM  AMMMAM AAA  AAM MAAAA   M    AAAA  A AA A  M IM A
    24   26 A H  H ><5S+     0   0   74  284   50  EE   AEEE EEEE E ED  EEEEED EEE  EEE SEEEE   E    EEAE  E EE Q  D ED E
    25   27 A E  H 3<5S+     0   0  127  284   87  EE   EAAR AEAA A TD  QQRRAR ATA  EER RAAAA   R    EEEA  Q QQ A  R RR E
    26   28 A K  H 3<5S-     0   0   39  284    0  KK   KKKK KKKK K KK  KKKKKK KKK  KKK KKKKK   K    KKKK  K KK K  K KK K
    27   29 A Q  T <<5 +     0   0  110  284   53  KR   QHKK KKKK K KQ  QQKKKK KKK  KKK KKKKK   K    KKQK  Q QQ E  Q KQ K
    28   30 A T      < +     0   0    0  284   41  SS   TSTT TSTT T TS  STTTTS TTT  SSS TTTTT   T    SSSS  S SS T  T ST T
    29   31 A N        +     0   0    0  284    0  NN   NNNN NNNN N NN  NNNNNN NNN  NNN NNNNN   N    NNNN  N NN N  N NN N
    30   32 A L  E     -a  229   0A   0  284   14  VV   LVVL VVVV V VL  VLLLVL VVV  VVL LVVVV   L    VVVV  V VV V  L LL V
    31   33 A C  E     -ab 230  55A   0  284   42  TT   STTC TTTT T TC  VASSTC TVT  TTA CTTTT   C    VVVT  V VV V  A AS T
    32   34 A A  E     -ab 231  56A   0  283   58  VV   LVVV VVVV V VV  VVVVVL VLV  VVV IVVVV   V    VVVV  V VV V  I VV V
    33   35 A S  E     - b   0  57A  15  284    9  SS   SSSS SSSS S SS  SNSSSS SSS  SSS SSSSS   S    SSSS  S SS S  A SA S
    34   36 A L        +     0   0    3  284   60  AA   AAAV AAAA A AV  ACVVAI AAA  AAV VAAAA   V    AAAA  A AA A  A VA A
    35   37 A D        +     0   0   42  284    0  DD   DDDD DDDD D DD  DDDDDD DDD  DDD DDDDD   D    DDDD  D DD D  D DD D
    36   38 A V        -     0   0    8  284    9  VV   VVVT VVVV V VV  VGVVVV VLV  VVV VVVVV   V    VVVV  V VV V  V VF V
    37   39 A R  S    S+     0   0  162  284   66  TT   TTTP TTTT T TT  TATTTT TTT  TTT TTTTT   T    TTTT  T TT T  T TT T
    38   40 A T     >  -     0   0   42  284   42  TT   STTK TTTT T TN  THKKTT TTT  TTK TTTTT   K    TTTT  T TT R  T KK T
    39   41 A T  H  > S+     0   0    4  284   55  TT   ATTT TTTT T SK  TSKKTT TTT  TTA KTTTT   S    SSTT  T TT A  S SK S
    40   42 A K  H  > S+     0   0  115  284   69  KK   AKKE KKKK K KA  SAKKKE KKK  KKA AKKKK   A    KKQK  S SS G  D AQ A
    41   43 A E  H  > S+     0   0   74  284   28  EE   QEED EEQE E ES  AQDDEK EEE  EED SEEEE   E    EEEE  A AA E  E DE E
    42   44 A L  H  X S+     0   0    4  284   11  LL   LLLF LLLL L LF  LLFFLI LLL  LLF LLLLL   I    LLLL  L LL L  L FV L
    43   45 A L  H  X S+     0   0   40  284    4  LL   ILLL LLLL L LL  LLLLLL LLL  LLL LLLLL   L    LLLL  L LL L  L LL L
    44   46 A E  H  X S+     0   0  112  284   81  DD   QDDT DDDD D ER  DDAADN DED  DDA RDDDD   D    DDDD  D DD D  K TD D
    45   47 A L  H  X S+     0   0   19  284   26  LL   LLLI LLLL L LI  LFIILI LIL  LLI ILLLL   I    LLLL  L LL L  I VF L
    46   48 A V  H  X S+     0   0    0  283   55  AA   AAAI AAAA A AV  AIIIAV AAA  AAI VAAAA   V    AAAA  A AA A  A VA A
    47   49 A E  H  < S+     0   0   79  284   22  DD   DDDD DDDD D DE  EEDDDD DDD  DDQ DDDDD   R    DDDD  E EE D  A DD D
    48   50 A A  H  < S+     0   0   24  284   75  pR   SRRV RRQQ R RA  RQVVRA RRR  RRA ARRRR   Q    RRKR  R RR R  S AK R
    49   51 A L  H >X S+     0   0    0  282   33  lL   ILLV LLLL L LV  LVVVLT LLL  LLV ALLLL   V    LLLL  L LL F  L VT L
    50   52 A G  G >< S+     0   0    0  282    3  GG   GGGG GGGG G GG  GGGGGH GGG  GGA GGGGG   A    GGGG  G GG G  G GG G
    51   53 A P  G 34 S+     0   0   50  284   18  PP   PPPP PPPP P PD  PPPPPV PPP  PPP PPPPP   P    PPPP  P PP P  P PP P
    52   54 A K  G <4 S+     0   0   45  284   77  YY   EHYY YYYY Y YH  HHFFYD YYY  YYY SYYYY   Y    YYYY  H HH Y  D YY Y
    53   55 A I    <<  -     0   0    0  284   14  II   IIIV IIII I IV  MIVVII III  IIV VIIII   V    IIMI  M MM I  I II I
    54   56 A C  S    S+     0   0    1  283   49  AA   CAAC AAAA A AC  VCCCA. AAA  AAC CAAAA   C    TTVA  V VV A  C CC A
    55   57 A L  E     -bc  31  85A   0  283   32  VV   LVVL VVVV V VM  VVLLV. VVV  VVM VVVVV   M    VVVV  V VV V  V LI V
    56   58 A L  E     -bc  32  86A   1  283   30  II   LIII IIFL I II  LLIII. ILI  III VIIII   V    LLLI  L LL L  L TL L
    57   59 A K  E     -bc  33  87A  20  283    2  KK   KKKk KKKK K KK  KKKKK. KKK  KKK KKKKK   K    KKKK  K KK K  K HK K
    58   60 A T  E     - c   0  88A   2  281    3  TT   TTTt TTTT T TT  TTTTT. TTT  TTT ATTTT   T    TTTT  T TT T  T .T T
    59   61 A H    >>  +     0   0   18  281    2  HH   HHHH HHHH H HH  HHHHH. HHH  HHH SHHHH   H    HHHH  H HH H  H .H H
    60   62 A V  G >4  +     0   0    2  283   49  II   IIIV IIII I II  IIIII. III  IIV IIIII   I    IIII  I II I  I VV I
    61   63 A D  G 34 S+     0   0   18  283    2  DD   DDDD DDDD D DD  DDDDD. DDD  DDD HDDDD   D    DDDD  D DD D  D DD D
    62   64 A I  G <4 S+     0   0   15  283   18  II   IIII IIII I II  ILIII. III  III IIIII   I    IIII  I II I  I II I
    63   65 A L    <<  -     0   0   15  284   28  LL   ILLL LLLL L LI  ILIILI LIL  LLL VLLLL   V    LLLL  I II L  I II L
    64   66 A T  S    S+     0   0   99  284   65  SS   ESSE SSSS S SD  TEEESE SSS  SSE ESSSS   E    TTSS  T TT D  E EE T
    65   67 A D  S    S+     0   0   33  284    1  DD   DDDD DDDD D DD  DDDDDD DDD  DDD DDDDD   D    DDDD  D DD N  D DD D
    66   68 A F        +     0   0   29  284    6  FF   FFFF FFFF F LF  FFFFFF FFF  FFF FFFFF   F    LLFF  F FF F  F FF L
    67   69 A S     >> -     0   0   39  279   61  SS   TGSD SSSS S TD  STDDSS SGS  SSD DSSSS   T    SSSS  S SS S  S ED T
    68   70 A M  I  4>S+     0   0   38  283   97  QQ   PDNS NQTP E PQ  PPQQNE DPK  QQP QDDDE   I    PPSE  P PP L  P SI P
    69   71 A E  I  45S+     0   0  109  157   60  ..   .... .... . ..  ...... ...  ... .....   .    ....  . .. .  . .. .
    70   72 A G  I  45S+     0   0   16  283   60  EE   EDES EEEE E AD  QSTTEE EAE  AAL DEEEE   D    TTEE  Q QQ T  K SS S
    71   73 A T  I  X5S+     0   0    2  283   43  TT   LTTV TTTT T TL  TIVVTF TTT  TTI LTTTT   L    TTTT  T TT V  L LF T
    72   74 A V  I  > S+     0   0   37  284   73  GG   TGGR GGGG G EK  GKHHGR GGG  GGK RGGGG   E    SSGG  G GG A  K HE S
    75   77 A L  H  X S+     0   0    2  284    1  LL   LLLL LLLL L LL  LLLLLL LLL  LLL LLLLL   L    LLLL  L LL L  L LL L
    76   78 A K  H  X S+     0   0   64  283   80  NN   KTKE KNKK K QV  KTQQKR KTK  NNQ QKKKK   K    KKQK  K KK K  S QK Q
    77   79 A A  H  X S+     0   0   60  284   64  AA   EAAS AAAH A AE  AQEEAQ AQA  AAA QAAAA   R    SSSA  A AA E  A QK S
    78   80 A L  H  X S+     0   0   14  284   11  LL   LLLL LLIL L LL  ALLLLL LLL  LLL LLLLL   L    LLLL  A AA L  L LL L
    79   81 A S  H  X>S+     0   0   14  284   35  AA   AAAS AAAA A AS  AASSAS AAA  AAS SAAAA   A    AASA  A AA A  S SA A
    80   82 A A  H  <5S+     0   0   81  284   70  QQ   KKQR QQEQ E EQ  QEVVQD QHE  QQL KQQQE   D    SSQA  Q QQ V  D KE T
    81   83 A K  H  <5S+     0   0  142  284   20  KK   QKKR KKKK K KR  KRKKKK KRK  KKE KKKKK   E    KKKK  K KK K  Q KK K
    82   84 A Y  H  <5S-     0   0   52  284   36  HH   HHHH HHHH H HH  HHHHHY HHH  HHH HHHHH   L    HHHH  H HH H  Y HH H
    83   85 A N  T  <5 +     0   0   64  284   57  NN   QNND NNNN N NN  NQDDND NNN  NND DNINN   D    RRNN  N NN N  D DD N
    84   86 A F      < -     0   0    3  284    0  FF   FFFF FFFF F FF  FFFFFF FFF  FFF FFFFF   F    FFFF  F FF F  F FF F
    85   87 A L  E     -c   55   0A   8  284   10  LL   LLLL LLLL L LM  LLLLLL LLL  LLT LLLLL   V    LLLL  L LL L  L LL L
    86   88 A L  E     -c   56   0A   0  284   12  II   IIII IIII I II  IIIIII ILI  III IIIII   I    LLII  I II I  L II I
    87   89 A F  E     -cd  57 116A   0  284    0  FF   FFFF FFFF F FF  FFFFFF FFF  FFF FFFFF   F    FFFF  F FF F  F FF F
    88   90 A E  E     -c   58   0A   0  284    0  EE   EEEE EEEE E EE  EEEEEE EEE  EEE EEEEE   E    EEEE  E EE E  E EE E
    89   91 A N  E     +     0   0A   4  284    0  DD   DDDD DDDD D DD  DDDDDD DDD  DDD DDDDD   D    DDDD  D DD D  D DD D
    90   92 A R  E     -     0   0A  40  284    0  RR   RRRR RRRR R RR  RRRRRR RRR  RRR RRRRR   R    RRRR  R RR R  R RR R
    91   93 A K  E     - d   0 118A  36  284    0  KK   KKKK KKKK K KK  KKKKKK KKK  KKK KKKKK   K    KKKK  K KK K  K KK K
    92   94 A F  E     + d   0 119A   4  284    0  FF   FFFF FFFF F FF  FFFFFF FFF  FFF FFFFF   F    FFFF  F FF F  F FF F
    93   95 A A        +     0   0    6  283   47  II   AIIA IIII I IA  VAAAIA III  IIA .IIII   A    VVVI  V VV V  A AA I
    94   96 A D        -     0   0   13  283    0  DD   DDDD DDDD D DD  DDDDDD DDD  DDD .DDDD   D    DDDD  D DD D  D DD D
    95   97 A I    >>  +     0   0   57  283    1  II   IIII IIII I II  IIIIII III  III .IIII   I    IIII  I II I  I II I
    96   98 A G  H 3> S-     0   0   37  283    0  GG   GGGG GGGG G GG  GGGGGG GGG  GGG .GGGG   G    GGGG  G GG G  G GG G
    97   99 A N  H 3> S+     0   0  113  283   28  NN   NNNN NNNN N NN  HTNNNN NNN  NNN .NNNN   N    SSNN  H HH N  N NK N
    98  100 A T  H <> S+     0   0   17  283    1  TT   TTTT TTTT T TT  TITTTT TTT  TTT .TTTT   T    TTTT  T TT T  T TT T
    99  101 A V  H  X S+     0   0    0  283    3  VV   VVVV VVVV V VV  VSVVVV VVV  VVV .VVVV   V    VVVV  V VV V  V VV V
   100  102 A K  H  X S+     0   0   21  283   59  QQ   HQQA QQQQ Q QK  QKAAQV QQQ  QQA .QQQQ   E    QQQQ  Q QQ Q  K AQ Q
   101  103 A L  H  X S+     0   0   63  283   75  KK   KKKL KKKK K KY  MQLLKH KKK  KKL .KKKK   L    KKKK  M MM K  Y LL K
   102  104 A Q  H  < S+     0   0   28  283    0  QQ   QQQQ QQQQ Q QQ  QQQQQQ QQQ  QQQ .QQQQ   Q    QQQQ  Q QQ Q  Q QQ Q
   103  105 A Y  H  < S+     0   0    0  284    0  YY   FYYY YYYY Y YY  YYYYYY YYY  YYY YYYYY   Y    YYYY  Y YY Y  Y YY Y
   104  106 A S  H  < S+     0   0   26  284   77  HH   THHG HHHH H HS  HESSHS HRH  HHS SHHHH   S    HHHH  H HH H  G SS H
   105  107 A A     X  +     0   0   38  284   52  NN   AGGG GNGG G GS  GKSSGR RGG  NNS RRRRG   A    GGGQ  G GG G  G SS G
   106  108 A G  T  4 S-     0   0   47  284    0  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GG G
   107  109 A V  T  4 S+     0   0   67  284   67  TT   IATV TTAA T AI  SIVVTI TAT  TTV VTTTT   V    SSAT  S SS A  I VI A
   108  110 A Y  T  4 S-     0   0   37  284   72  LL   YLLH LLLL L LY  LYYYLH LLL  LLH HLLLL   H    LLLL  L LL L  Y HY L
   109  111 A R    ><  -     0   0   93  284   34  RR   KRRK RRRR R HK  RRKKRK RRR  RRK RRRRR   K    RRQR  R RR Q  H KK R
   110  112 A I  G >> S+     0   0    1  284    2  II   IIII IIII I II  IIIIII III  III IIIII   I    IIII  I II I  I II I
   111  113 A A  G 34 S+     0   0    0  284   58  SS   SSSA SSSS S SA  SASSSA SYS  SSA SSSSS   A    SSSS  S SS S  A AS S
   112  114 A E  G <4 S+     0   0   71  284   59  EE   SEEQ EEEE E EE  EDSSES EEE  EES SEEEE   S    EEQE  E EE S  D SE E
   113  115 A W  T <4 S+     0   0    2  284    0  WW   WWWW WWWW W WW  WWWWWW WWW  WWW WWWWW   W    WWWW  W WW W  W WW W
   114  116 A A     <  -     0   0    0  284   29  AA   AAAS AAAS A AS  AAAAAA AAA  AAS SAAAA   S    AAAS  A AA A  A SA A
   115  117 A D  S    S+     0   0   10  284   44  HH   DHHH HHHH H HD  HSHHHH HHH  HHH HHHHH   H    HHHH  H HH D  H HD H
   116  118 A I  E     +de  87 144A   0  284    8  II   IIII IIII I II  ILLLII III  III IIIII   L    IIII  I II I  I II I
   117  119 A T  E     - e   0 145A   0  284   42  II   IIIT IIII I IT  VTTTIT III  IIT TIIII   T    VVVI  V VV V  I TI I
   118  120 A N  E     -de  91 146A   0  284    3  NN   NNNN NNNN N NN  NNNNNN NNN  NNN NNNNN   N    NNNN  N NN N  N NN N
   119  121 A A  E     -de  92 147A   0  284   46  CC   ACCA CCCC C CA  CCAACA CAC  CCA ACCCC   A    CCAC  C CC C  A AA C
   120  122 A H        -     0   0    0  284   53  SS   HSSH SSAA S SH  AHHHSH SSS  SSH HSSSS   H    AATS  A AA T  H HH A
   121  123 A G  S >  S+     0   0    0  283   80  II   MVIP IVII I IT  VIAAIP III  VVP IIIII   V    MMMV  V VV M  T PP I
   122  124 A V  T 3  S+     0   0    0  284   33  LL   LLLV LLLL L LV  LIVVLL LLL  LLV VLLLL   V    LLLL  L LL L  V VM L
   123  125 A V  T 3  S-     0   0    4  284   51  PP   PPPP PPPP P PP  APPPPP PAP  PPP PPPPP   P    AAPP  A AA P  P PP P
   124  126 A G    X   -     0   0    0  284    1  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GG G
   125  127 A P  T >> S+     0   0   44  284   67  EE   PEEP EEEE E EE  SPPPEP EEE  EEP PEEEE   P    PPPE  S SS E  A PE E
   126  128 A G  H 3> S+     0   0   25  284   30  GG   GGGS GGGG G GG  GGSSGG GGG  GGS GGGGG   G    GGGG  D GG G  G SG G
   127  129 A I  H <> S+     0   0    0  284   36  II   IIII IIII I IV  IIIIII III  III VIIII   I    IIII  I II I  V II I
   128  130 A V  H <> S+     0   0    2  284   13  VV   IVVI VVVV V VI  VIIIVI VIV  VVI IVVVV   I    VVIV  V VV V  I II V
   129  131 A S  H  X S+     0   0   71  284   73  EE   DEEQ EEQQ E ET  DETTET EQE  EES SEEEE   T    DDDE  D DD Q  E TD E
   130  132 A G  H  X S+     0   0    7  284   35  AA   GAAG AAAA A AG  AGGGAG AAA  AAG GAAAA   G    AAAA  A AA A  G GG A
   131  133 A L  H  X S+     0   0    0  284    1  LL   LLLL LLLL L LL  LLLLLL LLL  LLL LLLLL   L    LLLL  L LL L  L LL L
   132  134 A K  H  X S+     0   0   50  284   66  AA   KAAA AATT A SA  ARSSAA ADA  AAK AAAAA   G    AAAA  A AA T  Q SK A
   133  135 A Q  H  X S+     0   0   93  284   56  QQ   KQQS QQQQ Q KE  QESSQS QQQ  QQS RQQQQ   A    QQQQ  Q QQ Q  T SK Q
   134  136 A A  H  X S+     0   0    0  284   57  TT   DTTV TTTT T TV  ITIITV TTT  TTV ATTTT   V    TTVT  V II T  I VI T
   135  137 A A  H  X S+     0   0    6  284   28  AA   IAAG AAAA A AG  SGGGAG AIA  AAG GAAAA   G    AAAA  S SS A  G GG T
   136  138 A E  H  < S+     0   0  132  284   84  qq   dssK sqkt s kI  sLLLsL shs  qqL Qssss   K    sssq  s ss e  L LE k
   137  139 A E  H  < S+     0   0  129  222   34  dd   edd. dddd d d.  g...d. ded  dd. .dddd   .    ssdd  e hh d  . .. d
   138  140 A V  H  < S+     0   0   49  284   90  ff   Kffp ffff f fP  vPppfA fPf  ffp pffff   p    vvff  f yy f  S pP f
   139  141 A T     <  -     0   0   33  208   67  gg   .gg. gggg g g.  p...g. g.g  gg. .gggg   .    eeag  p aa k  . .. a
   140  142 A K  S    S+     0   0  181  232   87  SS   .PP. PSEN S SR  AK..P. P.S  SS. .PPPS   .    AVAS  A GG D  R .. N
   141  143 A E  S    S-     0   0   78  236   37  EE   .EE. EEDE E EG  GG..ES EEE  EE. .EEEE   .    eeHD  G EE Q  D .Q Q
   142  144 A P        -     0   0   37  195   61  ..   ...e .... . ..  E.gg.G ...  ..g g....   g    gg..  E .. .  . gG .
   143  145 A R        -     0   0   15  282   12  RR   TRRR RRKR R RR  RNRRRR RRR  RRR RRRRR   N    RRRR  R RR R  R RR R
   144  146 A G  E     -e  116   0A   0  284   15  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   A    AAGG  G GG A  G GG G
   145  147 A L  E     -ef 117 177A   0  284    4  LL   LLLL LLLL L LL  LLLLLL LIL  LLL LLLLL   L    LLLL  L LL L  L LL L
   146  148 A L  E     -ef 118 179A   0  284    8  LL   LLLL LLLL L LL  LLIILL LLL  LLL LLLLL   I    LLLL  L LL L  L LF L
   147  149 A M  E     -ef 119 180A   0  284   38  II   LIIL IIII I IL  ILLLIL III  IIP LIIII   L    IIII  I II I  L LL I
   148  150 A L  E     + f   0 181A   3  284    1  LL   LLLL LLLL L LL  LLLLLL LLL  LLL LLLLL   L    LLLL  L LL L  L LL L
   149  151 A A        +     0   0    0  284    7  AA   AAAA AAAA A AA  AASSAA AAA  AAA AAAAA   A    AAAA  A AA A  A AA A
   150  152 A E  S    S-     0   0   27  283   23  EE   QEEE EEEE E EE  EQEEEE EEE  EEE EEEEE   E    EEEE  E EE T  E EE E
   151  153 A L        -     0   0   23  283    7  MM   MMMM MMMM M MM  MMMMMM MMM  MMM MMMMM   M    MMMM  M MM M  M MM M
   152  154 A S        +     0   0   75  283   27  TT   STTS TTTT T TS  TSSSTS TTT  TTS STTTT   S    TTTT  T TT T  S SS T
   153  155 A C  S >  S-     0   0   28  284   20  SS   SSST SSSS S SS  SSSSSS SSS  SST SSSSS   S    SSSS  S SS S  S TS S
   154  156 A K  T 3  S+     0   0  188  284   47  KK   AKKK KKKK K KK  KKKKKA KKK  KKA AKKKK   A    KKKK  K KK K  A RK K
   155  157 A G  T 3  S+     0   0   44  283    1  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GG G
   156  158 A S    <   -     0   0   36  284   53  SS   NSSA SSSS S ST  SSAASC SSS  SSS ASSSS   N    SSSS  S SS S  N SC S
   157  159 A L        +     0   0   20  284   10  LL   LLLL LLLL L LL  LLLLLL LLL  LLL LLLLL   L    MMLL  M LL L  L LL L
   158  160 A A        +     0   0   18  284   49  AA   LAAT AAAA A AA  AATTAA AAA  AAA TAAAA   A    AAAA  A AA A  A AS A
   159  161 A T     >  -     0   0   66  284   73  TT   QTTK TTTK T TK  TQTTTK TVT  TTR TTTTT   S    TTTT  T TT T  Y TT T
   160  162 A G  H  > S+     0   0   48  284   37  GG   TGGG GGGG G GD  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GE G
   161  163 A E  H  > S+     0   0  123  284   48  AA   DDQA QSTE Q ES  EDSSQS QEQ  AAA EQQQQ   E    AAKA  E EE E  E TE E
   162  164 A Y  H  > S+     0   0    9  283    0  YY   YYYY YYYY Y YY  YYYYYY YYY  YYY YYYYY   Y    YYYY  Y YY Y  Y YY Y
   163  165 A T  H  X S+     0   0    3  284   16  TT   TTTT TTTT T TT  TTTTTT TTT  TTT TTTTT   T    TTTT  T TT T  T TV T
   164  166 A K  H  X S+     0   0  112  284   70  SS   QKTN TSTT T RV  KSEETA TRT  SSE KTTTT   E    QQES  K KK K  Q DN A
   165  167 A G  H  X S+     0   0   13  284   74  AA   TASS SARR S AE  LQDDSA SAS  AAD TSSSS   K    LLLA  L LL V  K EA R
   166  168 A T  H  X S+     0   0    0  284   59  SS   TSSA SSSS S ST  SAAASA SSS  SSA ASSSS   A    SSSS  S SS S  T AS S
   167  169 A V  H  X S+     0   0   15  284   12  VV   VVVV VVVV V VV  VVVVVV VVV  VVV VVVVV   V    VVVV  V VV V  L VI V
   168  170 A D  H  X S+     0   0   84  284   43  DD   KDDQ DDDD D EE  ECRRDQ DED  DDR RDDDD   Q    EEED  E EE E  E RK E
   169  171 A I  H >< S+     0   0    9  284   69  II   MYYM YIYY Y YM  MLMMYM YIY  IIM LYYYY   M    AAMY  M MM C  M MM Y
   170  172 A A  H >< S+     0   0    0  283    1  AA   AAAA ATAA A AA  AAAAAA AAA  AAA AAAAA   A    AAAA  A AA A  A AA A
   171  173 A K  H 3< S+     0   0   51  284   31  RR   TRRR RRRR R RR  RKRRRR RRR  RRR NRRRR   r    RRRR  R RR R  R RK R
   172  174 A S  T << S+     0   0   75  283   74  KK   AKKE KKRR K KR  RESSKE KKK  KKA EKKKK   a    RRKK  K RR K  I TK K
   173  175 A D    <>  +     0   0   26  284   68  YY   HYYH YYYY Y YH  HYRRYK YYY  YYR NYSYY   G    HHYY  H HH Y  Y HN Y
   174  176 A K  T  4 S+     0   0   75  284   44  PP   NKKK KPKK K KP  ASRRKR KPK  PPR SKKKK   L    RRRH  A AA S  R RK K
   175  177 A D  T  4 S+     0   0   90  284   44  SS   NKND NSEK K DE  GDDDND NRK  SSD DNNNK   D    AAGS  G GG R  D EE G
   176  178 A F  T  4 S+     0   0    8  284    5  FF   FFFF FFFF F FF  FFFFFF FSF  FFF FFFFF   W    FFFF  F FF F  F FF F
   177  179 A V  E  <  +f  145   0A   1  284    4  VV   VVVV VVVV V VV  VVVVVV VVV  VVV VVVVV   V    VVVV  V VV V  V VV V
   178  180 A I  E     -     0   0A   0  283   40  LL   MTMI MLMM M LI  MIVVMI MLM  LLI IMMMM   V    LLLL  M MM I  I II M
   179  181 A G  E     -fg 146 196A   0  284    0  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GG G
   180  182 A F  E     -fg 147 197A   0  284    0  FF   FFFF FFFF F FF  FFFFFF FFF  FFF YFFFF   F    FFFF  F FF F  F FF F
   181  183 A I  E     +fg 148 198A  10  283   12  VV   IVVI VVVV V VI  VIIIVI VVV  VVI IVVVV   I    VVVV  V VV V  I II V
   182  184 A A        -     0   0    0  283   33  SS   SSSA SSCC S SS  ACAASA SAS  SSA ASSSS   A    AAAS  A AA A  T AS S
   183  185 A Q  S    S+     0   0   34  284   49  tt   rttq ttnn t tq  tqqqtm ttt  ttq mtttt   m    tttt  t tt s  T qI t
   184  186 A R  S    S-     0   0  108  284   68  ee   kapp peqk p kh  kkeepk php  eek rpppp   r    ddka  k kk e  H pR k
   185  187 A D        -     0   0   38  204   79  te   ...G .et. . .s  ..AA.a .p.  ee. v....   V    ....  . .. v  . GR .
   186  188 A M        -     0   0   22  215   84  EA   ...V .AT. . .D  ..DD.D .D.  AA. Q....   D    ....  . .. V  . QW .
   187  189 A G        +     0   0   24  220   62  AP   L..D .PA. . .G  .LDD.P .A.  PP. S....   K    ....  . .. P  Q DP .
   188  190 A G    > > +     0   0   12  245   65  PA   SSST SATS S .A  .TVVSG SAS  AAA DSSSS   A    GGA.  . .. L  L VI E
   189  191 A R  G > 5S+     0   0  123  260   82  AQ   DEDT DQAE E ER  AETTDA DPE  QQE SDDDE   D    DDED  A PP E  I SL E
   190  192 A D  G 3 5S+     0   0  175  284   41  SG   DDED EGDD E EP  DDEEEV ENE  GGD EEEEE   D    EEDG  D DD N  D ET S
   191  193 A E  G < 5S-     0   0  111  284   28  EE   PEEE EEEE E GE  EPEEEE EEE  EEE KEEEE   P    EEEE  E EE E  Q EE E
   192  194 A G  T < 5S+     0   0   49  284   45  DD   GDDD DDDD D DD  DRDDDD DDD  DDD DDDDD   D    DDDD  D DD D  P DE D
   193  195 A Y      < -     0   0   42  284   24  FF   MFFF FFFF F FF  FFFFFF FFF  FFF FFFFF   F    FFFF  F FF F  Y FF F
   194  196 A D        -     0   0   38  116    1  ..   .... .... . ..  ...... ...  ... .....   .    ....  . .. .  . .. .
   195  197 A W        -     0   0   12  124    7  ..   .... .... . ..  ...... ...  ... .....   .    ....  . .. .  F .. .
   196  198 A L  E     -g  179   0A   0  284   28  VV   IVVL VVVV V IL  VILLVL VVV  VVL LVVVV   L    VVVV  V VV V  I LI V
   197  199 A I  E     -g  180   0A   1  284   59  VV   HVVI VVVV V VV  LHVVVI VVV  VVV IVVVV   V    VVLV  L LL L  N VL V
   198  200 A M  E     -gh 181 228A   0  284   23  FF   MFFL FFFF F FL  FMLLFM FFF  FFL LFFFF   I    FFFF  F FF F  F LM F
   199  201 A T  E     - h   0 229A   0  284   11  TT   TTTT TTTT T TS  TTAATT TTT  TTS TTTTT   T    TTTT  T TT T  T TT T
   200  202 A P        +     0   0   31  284   27  TT   PTTP TTTT T TP  TPPPTP TTT  TTP PTTTT   P    TTTT  T TT T  P PP T
   201  203 A G  S    S+     0   0   33  284    0  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GG G
   202  204 A V  E     +i  216   0B   8  284   31  VV   VVVV VVVV V VV  VIVVVV VVV  VVV VVVVV   V    VVVV  V VV V  I VV V
   203  205 A G  E     -i  217   0B   3  283   56  NN   QNNG NNNN N NG  NKGGNG NNN  NNG GNNNN   G    SSNN  N NN N  N GG N
   204  206 A L        -     0   0   35  283    8  LL   LLIL ILLL L LL  LLLLIL ILL  LLL LIIIL   L    LLLL  L LL M  L LY L
   205  207 A D        -     0   0   97  283   62  SS   QSSE SSAA S SD  ASDDSD SSS  SSD DSSSS   D    SSAS  A AA A  E EV S
   206  208 A D    >   -     0   0   41  283   76  SS   ESSM SSSS S SV  SESSSV SSS  SSV TSSSS   V    AASS  S SS S  K ST D
   207  209 A K  T 3  S+     0   0  216  283   49  KK   GKKK KKTA K KS  KGKKKA KKK  KKK KKKKK   K    SSKK  K KK K  T KN K
   208  210 A G  T 3  S+     0   0   77  258   14  GG   QGGG GGGG G GG  GSGGGG GGG  GGG GGGGG   G    GGGG  G GG G  S GN G
   209  211 A D    <>  +     0   0   42  265    9  DD   DDDD DDDD D DD  DDDDDD DDD  DDD DDDDD   D    DDDD  D DD D  D DD D
   210  212 A A  T  4 S+     0   0   76  266   64  KK   AKKA KKAA K KQ  QSAAKA KAK  KKG GKKKK   G    AAAK  K QQ K  D GS K
   211  213 A L  T >4 S+     0   0   87  267   44  LL   LLLM LLLL L LL  LLMMLM LLL  LLM LLLLL   R    LLLL  L LL L  L MV L
   212  214 A G  G >4 S+     0   0    9  281   17  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  K GG G
   213  215 A Q  G 3< S+     0   0   89  282   19  QQ   QQQQ QQQQ Q QQ  QQQQQQ QQQ  QQQ QQQQQ   Q    QQQQ  Q QQ Q  Q Qn Q
   214  216 A Q  G <  S+     0   0  148  282    3  QQ   CQQQ QQQQ Q QN  QQQQQQ QQQ  QQQ QQQQQ   Q    QQQQ  Q QQ Q  Q Qq Q
   215  217 A Y  S <  S-     0   0  109  282    0  YY   YYYY YYYY Y YY  YYYYYY YYY  YYY YYYYY   Y    YYYY  Y YY Y  Y YY Y
   216  218 A R  E     -i  202   0B  69  282   57  QQ   LQQR QQQQ Q QR  QNRRQR QQQ  QQR RQQQQ   R    QQQQ  Q QQ Q  T RR Q
   217  219 A T  E  >  -i  203   0B  45  282    7  TT   TTTT TTTT T TT  TTTTTT TTT  TTT TTTTT   T    TTTT  T TT T  T TT T
   218  220 A V  H  > S+     0   0    0  282   47  PP   PPPP PPPP P PP  PPPPPP PPP  PPP PPPPP   P    PPPP  P PP P  P PP P
   219  221 A D  H  > S+     0   0   71  282   63  QQ   DEGR GQQQ E QD  EERRGH ATE  QQR RAAAE   H    AAEQ  E EE Q  Y RE G
   220  222 A D  H  > S+     0   0   67  282   64  SS   HSSQ SSSS S SQ  SKEESA STS  SSE ESSSS   E    SSSS  S SS S  K QN S
   221  223 A V  H  X>S+     0   0    0  282   45  AA   VAAV AAAA A AV  AIVVAA AAA  AAV VAAAA   V    AAAA  A AA A  A VV A
   222  224 A V  H ><5S+     0   0    0  283   19  VV   IIIV IIVV V VV  VLVVIV IMV  IIV IIIIV   V    VVII  V VV V  I II V
   223  225 A S  H 3<5S+     0   0   78  284   81  GG   NGGL GGAA G GY  GSLLGY GAG  GGL FGGGG   Y    EEAD  G GG E  V LL G
   224  226 A T  H 3<5S-     0   0   58  284   84  RR   hRRe RRRR R Rq  RieeRe RGR  RRe dRRRR   d    RRGR  R RR A  e ed R
   225  227 A G  T <<5S+     0   0    6  284    3  GG   gGGg GGGG G Gg  GgggGg GGG  GGg gGGGG   g    GGGG  G GG G  g gg G
   226  228 A S      < -     0   0    0  284   59  AA   NAAC AAAA A AA  ASCCAS ASA  AAC CAAAA   C    AAAA  A AA A  T CS A
   227  229 A D  S    S+     0   0    0  284    0  DD   DDDD DDDD D DD  DDDDDD DDD  DDD DDDDD   D    DDDD  D DD D  D DD D
   228  230 A I  E    S- h   0 198A   0  284   31  FF   IFFV FFFF F FV  FIVVFI FFF  FFV VFFFF   V    FFFF  F FF F  V VI F
   229  231 A I  E     -ah  30 199A   0  284   19  II   IIII IIII I II  IMIIII ILI  III IIIII   I    IIII  I II I  I II I
   230  232 A I  E     -a   31   0A   6  284    0  II   IIII IIII I II  IIIIII III  III IIIII   I    IIII  I II I  I II I
   231  233 A V  E     +a   32   0A   1  284   33  SS   VAAV ASAS A AV  SVVVAV AAA  SSV VAAAA   V    SSSA  S SS A  V VV A
   232  234 A G    >   +     0   0   23  284    0  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GG G
   233  235 A R  G >> S+     0   0  126  284    0  RR   RRRR RRRR R RR  RRRRRR RRR  RRR RRRRR   R    RRRR  R RR R  R RR R
   234  236 A G  G 34 S+     0   0   18  284    0  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GN G
   235  237 A L  G <4 S+     0   0    0  284   25  II   IIII IIII I II  IIIIII III  IIV IIIII   I    IIII  I II I  I II I
   236  238 A F  T <4 S+     0   0   24  284   34  YY   YYYY YYYY Y YY  YAYYYY YYY  YYY YYYYY   Y    YYYY  Y YY Y  Y YY Y
   237  239 A A  S >< S+     0   0   22  284   59  AA   DAAg AAAA A Ag  AEggAg AAA  AAg gAAAA   K    AAAA  A AA A  N gA K
   238  240 A K  T 3  S-     0   0  176  165   62  ..   ...a .... . .s  ..dd.d ...  ..l d....   N    ....  . .. .  . eS .
   239  241 A G  T 3  S+     0   0   84  284   53  AA   DAAV AAAA A VN  AAVVAV AAA  AAT NAAAA   K    AAAA  A AA V  S PG A
   240  242 A R    <   -     0   0   78  284   77  AA   SPPD PAPP P EQ  PKEEPE PAP  AAE EPPPP   D    EEPP  P PP P  Q SK D
   241  243 A D     >  -     0   0   91  284   27  DD   QDDV DDDD D NA  DDNNDE DDD  DDK SDDDD   A    DDDD  D DD D  N TD D
   242  244 A A  H  > S+     0   0    8  284   53  PP   PPPI PPPP P PI  PPVVPM PPP  PPI IPPPP   V    PPPP  P PP P  P II P
   243  245 A K  H  > S+     0   0   92  283   82  VV   LVVA VVVV V VI  VSRRVK VVV  VVA RVVVV   A    LLVV  V VV V  E AV V
   244  246 A V  H  > S+     0   0   79  283   82  EE   KEQA QEEE E EA  EKKKQR QSE  EEE KQQQE   S    EEEE  E EE A  K AT E
   245  247 A E  H  X S+     0   0   23  283   47  AA   MAAR AAAA A AQ  AEQQAQ AAA  AAQ DAAAA   E    AAAA  A AA S  M KE A
   246  248 A G  H  X S+     0   0    0  283   40  AA   AAAA AAVV A AA  IAAAAA AVA  VVA SAAAA   A    VVAA  I II A  A AT V
   247  249 A E  H  X S+     0   0   55  283   56  KK   QQQE QKKK K KI  KEEEQE QKK  KKK EQQQK   K    LLRK  K KK K  R EL Q
   248  250 A R  H  X S+     0   0   78  283   26  QQ   SRQR QQQR Q QR  QRRRQR QEQ  QQR RQQQQ   R    RRQQ  Q QQ A  Q RK R
   249  251 A Y  H  X S+     0   0    9  283    0  YY   YYYY YYYY Y YY  YYYYYY YYY  YYY YYYYY   Y    YYYY  Y YY Y  Y YY Y
   250  252 A R  H  X S+     0   0   37  283   33  QQ   RQQM QQRQ Q QK  QRRRQR QQQ  QQR RQQQQ   Q    RRQQ  Q QQ K  R MK R
   251  253 A K  H  X S+     0   0   95  283   64  QQ   HKKT KQEE K KQ  SKQQKQ KKK  QQD KKKKK   E    EESQ  A AA E  E AN E
   252  254 A A  H  X S+     0   0   16  283   49  QQ   AEEE EQQQ E EA  AEEEEA EAE  QQE EEEEE   A    EEAQ  A AA E  L EA E
   253  255 A G  H  X S+     0   0    0  283   20  GG   GGGG GGGG G GG  GGGGGG GGG  GGG GGGGG   G    GGGG  G GG G  G GG G
   254  256 A W  H  X S+     0   0   19  283    0  WW   WWWW WWWW W WW  WWWWWW WWW  WWW WWWWW   W    WWWW  W WW W  W WW W
   255  257 A E  H  X S+     0   0   83  283   62  EE   QDEA EEKN D EE  SKSSEE EDD  EEK EEEED   K    KKNE  N SS N  D AK K
   256  258 A A  H  X S+     0   0    1  283    1  AA   AAAA AAAA A AA  AAAAAA AAA  AAA AAAAA   A    AAAA  A AA A  A AA A
   257  259 A Y  H  < S+     0   0   21  281    0  YY   YYYY YYYY Y YY  Y YYYY YYY  YYY YYYYY   Y    YYYY  Y YY Y  Y YY Y
   258  260 A L  H  < S+     0   0  113  277   62  LL   LMLQ LLLL L LL  L LLLL LLL  LLL ELLLL   E    LLLL  L LL L  Q QM E
   259  261 A R  H  <        0   0  157  277   66  AA   KAAE AAEE K AK  K EEAS ARK  AAE SAAAK   D    EEQA  Q KK G  K ET K
   260  262 A R     <        0   0   89  273    4  RR   RRRR RRRR R RR  R RRRR RRR  RRR RRRRR   R    RRRR  R RR R  R RR R
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58                  T   R          K                K     K        K      
   263    4 C A        -     0   0   31  121   71                  Q   Q          Q           Q    LQ    L        K      
   264    5 C T     >  -     0   0   47  219   38    ST     T    T T   T          TT         TST TTNT    T  T  T PS    T 
   265    6 C Y  H  > S+     0   0    0  253    0    YY     Y    Y Y  YY      Y   YY   Y     YYY YYFY    YY Y  Y YY    Y 
   266    7 C K  H  > S+     0   0  122  253   72    TA     G    A E  AA      G   AA   V     SSS STSA    GV A  A SA    A 
   267    8 C E  H  > S+     0   0   70  253   62    ED     A    Q S  QA      E   QS   Q     EAE EEEQ    QQ S  E EA    E 
   268    9 C R  H  X S+     0   0    2  253    1    RR     R    R R  RR      R   RR   R     RRR RRRR    RR R  R RR    R 
   269   10 C A  H  < S+     0   0   21  253   21    AA     A    A S  AA      A   AI   A     GAA AGTA    AA I  A AA    A 
   270   11 C A  H  < S+     0   0   47  253   71    EA     S    D Q  DA      K   TS   D     QEK KQAE    AD G  A KA    A 
   271   12 C T  H  < S+     0   0   31  253   83    QR     K    H T  NK      A   RL   N     QGQ QQFK    RN L  K QT    K 
   272   13 C H     <  -     0   0   13  254   44    HH     H    H H  YQ      H   HH   Y     HMH HHCH    FY H  H HQ    H 
   273   14 C P  S    S+     0   0   45  257   60    PP     P    T P  TP      P   PT   T     PKP PPLA    TT T  P SS    P 
   274   15 C S     >  -     0   0    0  257   59    NN     N    N T  NN      H   NN   N     NNN NNNN    NN N  I NN N  V 
   275   16 C P  H  > S+     0   0   82  261   28    AG     P    P A  PP      K   PP   P     APA AAVP    PP P  P AP P  P 
   276   17 C V  H  > S+     0   0    0  264   54    CCL    L    A A  AA      L   AT   A     CIC CCTA    AA T  V CA T  V 
   277   18 C A  H  > S+     0   0    0  264   29    AAA    A    A G  AA      A   AA   A     AAA AAAA    AA A  A AA R  A 
   278   19 C A  H  X S+     0   0   22  264   67    RKN    K    K R  KK      K   KQ   K     RKR RRQK    KK R  K RR V  K 
   279   20 C K  H  X S+     0   0   73  264   74    SAQ    R    S K  EA      R   AR   E     SES SSRA    AE R  Q SS A  Q 
   280   21 C L  H  X S+     0   0    0  265    2    LLL    L    L L  LL      L   LI   L     LLL LLLL    LL I  L LL L  L 
   281   22 C F  H  X S+     0   0    0  265   13    FFL    F    L L  LL      L   LL   L     FLF FFCL    LL L  L LL A  L 
   282   23 C N  H  X S+     0   0   69  265   71    EEE    E    Q Q  LE      T   ET   L     EAE EEQE    EL T  D EE K  D 
   283   24 C I  H  X S+     0   0    2  265   41    LLI    I    T I  TC      L   TI   T     LLL LLLT    TT I  I LC I  I 
   284   25 C M  H  X>S+     0   0    0  266   52    MMI    A    M M  MI      M   IM   M     MMM MMII    MM M  C MI I  C 
   285   26 C H  H  <5S+     0   0   75  266   50    EEN    E    E A  EE      E   ED   E     EEE EEAE    EE D  D ES Q  D 
   286   27 C E  H  <5S+     0   0  112  266   83    RRR    A    R Q  RR      S   RR   R     RER RRKR    RR R  R RR D  R 
   287   28 C K  H  <5S-     0   0   40  266    0    KKK    K    K K  KK      K   KK   K     NKK KKKK    KK K  K KK K  K 
   288   29 C Q  T  <5 +     0   0  109  266   48    KQQ    K    Q R  KQ      Q   RR   K     EQQ QQKS    KK R  K QQ Q  K 
   289   30 C T      < +     0   0    0  266   40    TTS    T    S T  ST      T   TT   S     SSS SSTS    SS T  T TT S  T 
   290   31 C N        +     0   0    0  266    0    NNN    N    N N  NN      N   NN   N     NNN NNNN    NN N  N NN N  N 
   291   32 C L  E     -s  740   0E   0  266   15    LLL    V    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   292   33 C C  E     -st 741 577E   0  266   47    SSC    T    A C  SC      C   SC   S     SSS SSCC    SS C  C SC A  C 
   293   34 C A  E     -st 742 578E   0  265   57    VIV    V    V L  VV      V   VV   V     VVV VVLV    VV V  V VV V  V 
   294   35 C S  E     - t   0 579E  14  266   11    AAS    S    S S  SS      S   SS   S     AAA AASS    SS S  S AS A  S 
   295   36 C L        +     0   0    2  266   60    VAV    A    V V  VV      V   VV   V     VVV VVAV    VV V  V VV A  V 
   296   37 C D        +     0   0   54  266    0    DDD    D    D D  DD      D   DD   D     DDD DDDD    DD D  D DD D  D 
   297   38 C V        -     0   0    6  266   11    VVF    V    V H  VV      V   VV   V     VLV VVVV    VV V  V VV V  V 
   298   39 C R  S    S+     0   0  150  266   65    TTT    T    T T  TT      T   TT   T     TTT TTTT    VT T  T TT T  T 
   299   40 C T     >  -     0   0   17  266   45    TTH    T    K D  KN      T   KK   K     TKT TTRK    KK R  S TN T  S 
   300   41 C T  H  > S+     0   0   13  266   53    KKS    T    S P  SK      K   RA   S     KKK KKAK    SS A  K KK A  K 
   301   42 C K  H  > S+     0   0  139  266   68    KKD    R    Q E  RQ      T   EA   R     KSK KKSA    AR D  A KQ N  A 
   302   43 C E  H  > S+     0   0   77  266   31    EET    E    D K  DD      S   DE   D     EEE EEDD    DD E  G ED E  G 
   303   44 C L  H  X S+     0   0    5  266   12    LLL    L    F I  FL      F   FV   F     LIL LLLF    LF V  L LL L  L 
   304   45 C L  H  X S+     0   0   40  266    4    LLL    L    L L  LL      L   FL   L     LLL LLLL    LL L  L IV V  L 
   305   46 C E  H  X S+     0   0  108  266   75    SHQ    D    S A  AD      R   RE   A     SES SSHR    AA E  R SD K  R 
   306   47 C L  H  X S+     0   0   29  266   27    IIL    L    I L  IV      I   IV   I     ILI IILI    II I  I IV L  I 
   307   48 C V  H  X S+     0   0    0  265   56    AAV    A    I V  IC      V   VV   I     AVA AAAI    VI V  A AC V  A 
   308   49 C E  H  < S+     0   0   77  266   24    DDD    D    D R  DD      D   DR   D     DDD DDDD    DD K  E DN Q  E 
   309   50 C A  H  < S+     0   0   26  266   77    SAA    R    A Q  AA      A   IR   A     AKS SATI    TA M  A AA Q  A 
   310   51 C L  H >X S+     0   0    0  263   31    VCV    L    V L  VV      V   VV   V     VIV VVVV    VV V  A IV V  A 
   311   52 C G  G >< S+     0   0    0  263    2    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   312   53 C P  G 34 S+     0   0   48  266   17    PPP    P    P P  PP      P   PA   P     PPP PPKP    PP A  P PP D  P 
   313   54 C K  G <4 S+     0   0   30  266   73    YYH    Y    F K  YN      Y   YS   Y     FYY YFEY    YY S  Y YN S  Y 
   314   55 C I    <<  -     0   0    0  266   15    VIV    I    V I  VV      V   VV   A     VVV VVIV    IA V  C IV I  C 
   315   56 C C  S    S+     0   0    0  265   43    CCC    A    C C  CC      C   CC   C     CCC CCCC    CC C  C CC C  C 
   316   57 C L  E     -tu 553 607E   0  265   31    VIM    V    L L  LL      M   LM   L     VVV VVVL    LL M  C VL V  C 
   317   58 C L  E     -tu 554 608E   0  265   31    LLI    I    V L  IV      I   VV   I     LIL LLLV    II V  I LV L  I 
   318   59 C K  E     -tu 555 609E  22  265    1    KKK    K    K K  KK      K   KK   K     KKK KKKK    KK K  K KK K  K 
   319   60 C T  E     - u   0 610E   2  264    2    TTT    T    T T  TT      T   TT   T     TTT TTTT    TT T  T TT T  T 
   320   61 C H    >   +     0   0   26  264    1    HHH    H    H H  HH      H   HH   H     HHH HHHH    HH H  H HH H  H 
   321   62 C V  G >   +     0   0    3  265   39    III    I    I I  VI      I   IC   V     III IIVV    VV C  I II I  I 
   322   63 C D  G 3  S+     0   0   74  265    1    DDD    D    D D  DD      D   DD   D     DDD DDDD    DD D  D DD D  D 
   323   64 C I  G <  S+     0   0   82  265   11    III    I    I I  II      I   II   I     IVI IIII    VI I  I II V  I 
   324   65 C L    <   -     0   0   15  266   28    VII    L    I I  LV      L   II   L     VVV VVLI    VL I  V VV I  V 
   325   66 C T  S    S+     0   0   88  266   64    EDC    T    E A  EE      S   EE   E     EEE EETE    EE E  E EQ S  E 
   326   67 C D  S    S+     0   0   71  266   10    DDD    D    D F  DD      D   DD   D     DDD DDDD    DD D  D DD D  D 
   327   68 C F        +     0   0   35  266    7    FFF    F    F p  FF      F   FF   F     FFF FFFF    FF F  F FF F  F 
   328   69 C S     >> -     0   0   45  202   62    D.D    S    D s  DD      D   DT   D     DDD DDTD    DD T  D DD T  D 
   329   70 C M  I  4>S+     0   0   44  203   88    KDI    V    Q I  FM      A   PL   F     HQA ARAS    SF L  Q AM P  R 
   330   71 C E  I  45S+     0   0  135  194   54    .E.    .    . K  ..      .   ..   .     ... ....    .. .  . .. .  . 
   331   72 C G  I  45S+     0   0   33  250   62    DDN    D    S S  TD      D   SE   T     DDD DDES    ST E  D DD D  D 
   332   73 C T  I  X5S+     0   0    2  252   41    LLL    T    L F  LL      L   AF   L     LML LLFL    LL F  L LL L  L 
   333   74 C V  I  > S+     0   0   37  266   72    QQS    G    S K  SQ      Q   RE   S     QKQ QQQR    KS K  Q QR T  Q 
   336   77 C L  H  X S+     0   0    3  266    0    LLL    L    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   337   78 C K  H  X S+     0   0   68  265   79    ECS    N    V Q  QT      Q   KV   Q     EVQ QEAK    QQ V  Q QT L  Q 
   338   79 C A  H  X S+     0   0   60  266   62    AES    V    D E  AA      R   AK   A     QAK KQCE    AA E  A EE D  A 
   339   80 C L  H  X S+     0   0   13  266   12    LLL    L    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   340   81 C S  H  X>S+     0   0   15  266   37    AAS    A    S S  SS      S   SS   S     AGA AAAS    AR S  A AS K  A 
   341   82 C A  H  <5S+     0   0   80  266   70    KKR    Q    R R  KE      K   EK   K     KKE EKQA    EK H  D KK K  D 
   342   83 C K  H  <5S+     0   0  134  266   19    KKK    K    K E  KK      K   KQ   K     KKK KKKK    KK Q  K KK Q  K 
   343   84 C Y  H  <5S-     0   0   51  266   36    HHH    H    H H  HH      H   HL   H     HHH HHHH    HH L  H HH Y  H 
   344   85 C N  T  <5 +     0   0   60  266   55    DDD    N    D A  DD      D   DD   D     DRD DDED    DD D  D DD Q  D 
   345   86 C F      < -     0   0    0  266    0    FFF    F    F F  FF      F   FF   F     FFF FFFF    FF F  F FF F  F 
   346   87 C L  E     -u  577   0E   6  266   11    LLL    L    V M  ML      L   LV   M     LLL LLLL    LM V  L LL L  L 
   347   88 C L  E     -u  578   0E   0  266   12    ILI    I    I I  II      I   II   I     III IILI    II I  I FI I  I 
   348   89 C F  E     -uv 579 638E   0  266    0    FFF    F    F F  FF      F   FF   F     FFF FFFF    FF F  W FF F  W 
   349   90 C E  E     -u  580   0E   0  266    0    EEE    E    E E  EE      E   EE   E     EEE EEEE    EE E  E EE E  E 
   350   91 C N  E     +     0   0E  30  266    0    DDD    D    D D  DD      D   DD   D     DDD DDDD    DD D  D DD D  D 
   351   92 C R  E     -     0   0E  47  266    0    RRR    R    R R  RR      R   RR   R     RRR RRRR    RR R  R RR R  R 
   352   93 C K  E     - v   0 640E  85  266    0    KKK    K    K K  KK      K   KK   K     KKK KKKK    KK K  K KK K  K 
   353   94 C F  E     + v   0 641E   3  266    0    FFF    F    F F  FF      F   FF   F     FFF FFFF    FF F  F FF F  F 
   354   95 C A        +     0   0   46  265   45    AAA    I    A A  AA      A   AA   A     AAA AAAA    AA A  A AA A  A 
   355   96 C D        -     0   0   67  265    0    DDD    D    D D  DD      D   DD   D     DDD DDDD    DD D  D DD D  D 
   356   97 C I    >>  +     0   0   79  265    1    III    I    I I  II      I   II   I     III IIII    II I  I II I  I 
   357   98 C G  H 3> S-     0   0   39  265    0    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   358   99 C N  H 3> S+     0   0  113  265   28    NNN    N    N S  NN      N   NN   N     NNN NNSN    NN N  N NN N  N 
   359  100 C T  H <> S+     0   0   75  265    2    TTT    T    T T  TT      T   TT   T     TTT TTTT    TT T  T TT T  T 
   360  101 C V  H  X S+     0   0    0  265    5    VVV    V    A V  VA      V   VV   V     VVV VVVV    VV V  V VA V  V 
   361  102 C K  H  X S+     0   0   23  265   59    KKS    Q    A Q  AS      K   AS   A     KKK KKKA    AA S  R KS K  R 
   362  103 C L  H  X S+     0   0   92  265   78    HHL    K    L H  LL      L   LL   L     HLH HHQL    LL L  L HL L  L 
   363  104 C Q  H  < S+     0   0   76  265    0    QQQ    Q    Q Q  QQ      Q   QQ   Q     QQQ QQQQ    QQ Q  Q QQ Q  Q 
   364  105 C Y  H  < S+     0   0    0  266    0    YYY    Y    Y Y  YY      Y   YY   Y     YYY YYYY    YY Y  Y YY Y  Y 
   365  106 C S  H  < S+     0   0   23  266   78    EGS    H    S R  SS      E   SS   S     AAG GAAS    SS A  S AS G  S 
   366  107 C A  S  X S+     0   0   34  266   52    KKS    G    S G  SA      S   AS   S     NSK KNGS    SS S  S NS G  S 
   367  108 C G  T  4 S-     0   0   60  266    0    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   368  109 C V  T  4 S+     0   0  105  266   63    VVA    A    I V  VV      I   VT   V     IVV VIVV    VV T  I IV I  I 
   369  110 C Y  T  4 S-     0   0   49  266   65    YYH    L    Y Y  HH      Y   HH   H     YYH YYYH    HH H  Y YH Y  Y 
   370  111 C R    ><  +     0   0   95  266   34    KKK    R    K E  RK      K   KK   R     KKK KKRK    KR K  K KK R  K 
   371  112 C I  G >>  +     0   0    0  266    2    III    I    I I  II      I   II   I     III IIII    II I  I II I  I 
   372  113 C A  G 34 S+     0   0    0  266   52    AAA    S    A A  AA      A   AA   A     AAA AASA    AA A  A AA A  A 
   373  114 C E  G <4 S+     0   0   81  266   60    SSS    E    D S  SS      T   SS   S     SSS SSDS    SS S  S SS D  S 
   374  115 C W  T <4 S+     0   0    3  266    0    WWW    W    W W  WW      W   WW   W     WWW WWWW    WW W  W WW W  W 
   375  116 C A     <  -     0   0    0  266   30    SAS    A    A A  SS      A   SS   S     SAS SSAS    SS S  A SS A  A 
   376  117 C D  S    S+     0   0    8  266   44    HHH    H    H D  QH      H   HD   Q     HHH HHDH    HQ D  H HH D  H 
   377  118 C I  E     +vw 609 666E   0  266    8    IIL    I    I I  II      I   SL   I     III IIII    II L  I II I  I 
   378  119 C T  E     - w   0 667E   0  266   42    TTT    I    T T  TT      T   TT   T     TTT TTIT    TT T  T TT I  T 
   379  120 C N  E     -vw 613 668E   1  266    2    NNN    N    N N  NN      N   NN   N     NNN NNNN    NN N  N NN N  N 
   380  121 C A  E     -vw 614 669E   0  266   41    AAA    C    A A  AA      A   AA   A     ACA AAAA    AA A  A AA A  A 
   381  122 C H    >   -     0   0   37  266   50    HHH    S    H H  HH      H   HH   H     HHH HHHH    HH H  H HH H  H 
   382  123 C G  G >  S+     0   0    5  265   79    TTA    V    P A  SL      S   PS   S     TTT TSPP    PS S  L TL V  L 
   383  124 C V  G 3  S+     0   0   99  266   30    VVL    L    V V  VV      V   VV   V     VVV VVIV    VV V  V VL V  V 
   384  125 C V  G <  S-     0   0   53  266   52    PPP    P    P P  PP      P   PP   P     PPP PPPP    PP P  P PP P  P 
   385  126 C G    X   -     0   0   15  266    1    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   386  127 C P  T >> S+     0   0   74  266   64    EED    E    P P  PP      D   PP   P     EEE EEPP    PP P  E EP P  E 
   387  128 C G  H 3> S+     0   0   26  266   25    GGG    G    S G  SS      G   SG   S     GGG GGGG    SS G  G GG G  G 
   388  129 C I  H <> S+     0   0    0  266   24    III    I    V I  IV      I   II   I     III IIII    II I  I IV I  I 
   389  130 C V  H <> S+     0   0    2  266   13    IIV    V    V I  VI      V   II   V     III IIIV    IV I  L IV I  L 
   390  131 C S  H  X S+     0   0   72  266   72    KTH    E    T R  AT      T   ST   A     KQK KKRT    SA T  T KT E  T 
   391  132 C G  H  X S+     0   0    6  266   30    GGG    A    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   392  133 C L  H  X S+     0   0    0  266    0    LLL    L    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   393  134 C K  H  X S+     0   0   54  266   67    GRK    A    A K  SA      K   KS   S     GKA AGQA    AS S  A AA W  A 
   394  135 C Q  H  X S+     0   0   97  266   56    EEK    Q    S E  SK      A   AS   S     EEE EEES    SS S  S EK E  S 
   395  136 C A  H  X S+     0   0    1  266   60    VVV    T    V V  VV      V   VI   V     VVV VVIV    VV V  V VV V  V 
   396  137 C A  H  X S+     0   0    4  266   31    GGG    A    G A  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   397  138 C E  H  < S+     0   0  134  266   84    LLL    s    L D  LL      L   LL   L     LLL LLLT    QL L  Q LV K  L 
   398  139 C E  H  < S+     0   0  125  202   30    ...    d    . G  ..      .   ..   .     ... ....    .. .  . .. .  . 
   399  140 C V  H  < S+     0   0   51  266   88    ppp    f    P I  pp      P   pp   p     ppp ppVp    pp p  p pp T  p 
   400  141 C T     <  -     0   0   35  193   67    ...    g    . .  ..      .   ..   .     ... ....    .. .  . .. .  . 
   401  142 C K  S    S+     0   0  179  212   85    ...    P    R G  ..      L   ..   .     ... ..K.    .. .  . .. K  . 
   402  143 C E  S    S-     0   0   91  218   33    ...    E    G Q  ..      E   ..   .     ... ..K.    .. .  . .. G  . 
   403  144 C P        -     0   0   33  183   56    ggn    .    . P  gn      .   gg   g     ggg gg.g    gg g  g gg .  g 
   404  145 C R        -     0   0   20  264   15    RRR    R    R R  RR      R   RR   R     RRR RRRR    RR R  R RR A  R 
   405  146 C G  E     -w  638   0E   0  266   17    GGG    G    G G  GG      G   GA   G     GGG GGGG    GG G  G GG G  G 
   406  147 C L  E     -wx 639 699E   0  266    6    LLL    L    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   407  148 C L  E     -wx 640 701E   0  266   11    LLL    L    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   408  149 C M  E     -wx 641 702E   0  266   38    LLL    V    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   409  150 C L  E     + x   0 703E   3  266    2    LLL    L    L L  LL      L   LL   L     LLL LLLL    LL L  L LL L  L 
   410  151 C A        +     0   0    0  266    8    AAA    A    A A  AA      A   AA   A     AAA AAAA    AA A  A AA A  A 
   411  152 C E  S    S-     0   0   24  266   18    EEQ    E    E E  EE      E   EN   E     EEE EEEE    EE N  E EE E  E 
   412  153 C L        -     0   0   44  266    7    MMM    M    M M  MM      M   MM   M     MMM MMMM    MM M  M MM M  M 
   413  154 C S        +     0   0   78  266   31    SSS    T    S S  SS      S   SS   S     SSS SSSS    SS S  S SS S  S 
   414  155 C C  S >  S-     0   0   79  266   22    SSS    S    T S  TS      S   TS   T     SSS SSST    TT S  A SS S  A 
   415  156 C K  T 3  S+     0   0  214  266   44    KKA    K    E K  AA      Q   KK   A     KKQ QKKK    KA K  K KA A  K 
   416  157 C G  T 3  S+     0   0   68  265    2    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   417  158 C S    <   -     0   0   38  266   49    AAS    S    S N  SA      S   SA   N     ASA AAAN    SN A  N AA N  N 
   418  159 C L        +     0   0  148  266    8    LLL    L    L L  LL      F   LL   L     LLL LLLL    LL L  L LL L  L 
   419  160 C A        +     0   0    6  266   41    TTA    A    A G  AT      A   AA   A     TAT TTAA    AA A  A TT A  A 
   420  161 C T    >   -     0   0   55  266   75    KKD    T    T G  VK      T   TT   V     KTK KKTT    TV R  T KK T  T 
   421  162 C G  T 3> S+     0   0   20  266   28    GGS    G    G G  GG      G   GG   G     GGG GGEG    GG G  G GG G  G 
   422  163 C E  H 3> S+     0   0   81  266   50    SSS    E    S E  RA      S   SE   Q     SSI ISGT    AH E  E SS D  E 
   423  164 C Y  H <> S+     0   0   59  265    0    YYY    Y    Y Y  YY      Y   YY   Y     YYY YYYY    YY Y  Y YY Y  Y 
   424  165 C T  H  > S+     0   0    3  266   18    TTT    T    T Q  TT      T   TT   T     TTT TTTT    TT T  T TT T  T 
   425  166 C K  H  X S+     0   0   78  266   69    TTQ    K    E Q  EQ      S   EK   E     SEA ASKA    EE R  T TE K  A 
   426  167 C G  H  X S+     0   0   26  266   76    EEA    A    A R  EA      K   EQ   E     EKE EEAD    AE E  K DA T  K 
   427  168 C T  H  X S+     0   0    2  266   58    SST    S    A T  TC      T   AT   T     STS SSSA    AT T  N SC A  N 
   428  169 C V  H  X S+     0   0   16  266   12    VVL    V    V L  YV      V   VM   Y     VLV VVLV    VY V  V VV V  V 
   429  170 C D  H  < S+     0   0   78  266   45    EED    D    Q A  QD      D   RR   Q     EEN NETR    QQ R  E EQ A  E 
   430  171 C I  H >< S+     0   0   21  266   63    MMM    Y    M M  MQ      M   MM   M     MWM MMMM    MM M  A ME W  A 
   431  172 C A  H >< S+     0   0    0  265    1    AAA    A    A A  AA      A   AA   A     AFA AAAA    AA A  A AA A  A 
   432  173 C K  T 3< S+     0   0   53  266   33    RRR    R    R r  Rk      R   Rr   R     RER RRAR    RR r  R Rk Q  R 
   433  174 C S  T <  S+     0   0   73  265   75    RRR    K    D r  Dd      R   Aa   D     RKR RRRA    ED a  R Rd K  R 
   434  175 C D    <>  +     0   0   19  266   71    NNH    Y    H E  HT      H   NG   H     NHN NNYH    NH G  H NT Y  H 
   435  176 C K  T  4 S+     0   0   81  266   48    KQS    K    S W  RT      K   RR   R     KTK KKPS    RR R  P KT S  P 
   436  177 C D  T  4 S+     0   0   84  266   43    DDD    N    D r  DG      E   DD   D     DDD DDDD    GD D  E DG D  E 
   437  178 C F  T  4 S+     0   0   10  266    7    FFF    F    F f  FF      F   FF   F     FFF FFFF    FF F  F FF F  F 
   438  179 C V  E  <  +x  667   0E   1  266    5    VVV    V    V V  VV      V   VV   V     VCV VVVV    VV V  V VV V  V 
   439  180 C I  E     -     0   0E   0  265   40    FFI    M    I M  IC      M   IV   I     FFF FFII    II I  M FC I  M 
   440  181 C G  E     -xy 668 718E   0  266    0    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   441  182 C F  E     -xy 669 719E   0  266    0    FFF    F    F F  FF      F   FF   F     FFF FFFF    FF F  F FF F  F 
   442  183 C I  E     +xy 670 720E  10  265   12    III    V    I I  II      V   II   I     III IIII    II I  V II I  V 
   443  184 C A        -     0   0    0  265   31    AAA    S    A A  GA      A   AA   G     AAA AAAA    AG A  A AA G  A 
   444  185 C Q  S    S+     0   0   34  266   53    qQQ    t    q M  Qm      g   qq   Q     qGq qqQm    qQ q  m qm m  m 
   445  186 C R  S    S-     0   0  111  266   66    kHQ    q    r K  rr      a   rr   r     kRk kkHg    pr r  v kr r  v 
   446  187 C D        -     0   0   41  192   77    MKR    s    . E  pe      d   g.   p     MRM MM.g    gp e  . Me .  . 
   447  188 C M        -     0   0   20  204   82    NML    S    K V  TT      P   EV   S     NFN NN.E    VA E  A NR .  A 
   448  189 C G        +     0   0   25  210   61    ENG    A    V G  GG      S   SD   G     EPQ QEQA    NG A  P QE L  P 
   449  190 C G    > > +     0   0    6  236   63    YET    S    D G  EG      S   SE   E     HNY YHLV    VK Q  G YG L  G 
   450  191 C R  G > 5S+     0   0  123  254   81    PKL    E    E G  GP      L   PG   G     DLD DDSE    EG K  E DP D  E 
   451  192 C D  G 3 5S+     0   0  160  266   42    DDD    D    Q E  GN      P   DE   D     DQD DDKD    DD E  G DN D  G 
   452  193 C E  G < 5S-     0   0  108  266   30    EDE    E    R E  EM      D   EE   E     ESE EENE    EE E  A ET P  A 
   453  194 C G  T < 5S+     0   0   55  266   45    DEG    D    D G  DQ      D   DG   D     DDD DDPD    DD E  D DE N  D 
   454  195 C Y      < -     0   0   50  266   25    FDF    F    F E  FR      F   FD   F     FYF FFAF    FF e  Y FR F  Y 
   455  196 C D        -     0   0   39  116    5    ...    .    . D  .D      .   ..   .     ... ....    .. d  . .D .  . 
   456  197 C W        -     0   0   10  123    9    .F.    .    . F  .L      .   .W   .     ... ..W.    .. W  . .L .  . 
   457  198 C L  E     -y  701   0E   0  266   29    VVL    V    L I  LL      L   LL   L     VIV VVLL    LL L  V IL V  V 
   458  199 C I  E     -y  702   0E   2  266   51    VVI    V    I V  VI      C   II   V     VTV VVTI    VV I  I VI T  I 
   459  200 C M  E     -yz 703 739E   0  266   26    MML    F    L M  LL      F   LM   L     MMM MMML    LL M  M ML M  M 
   460  201 C T  E     - z   0 740E   0  266   13    TAT    T    T T  TT      S   TS   T     SSS SSTT    TT S  T ST T  T 
   461  202 C P        +     0   0   28  266   31    PPP    T    P P  PP      P   PP   P     PPP PPPP    PP P  P PP P  P 
   462  203 C G  S    S+     0   0   54  266    0    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   463  204 C V              0   0   12  266   14    VVV    T    V V  VV      V   VV   V     VIV VVVV    VV V  V VV I  V 
   464  205 C G              0   0   61  266   52    ggg    P    g g  gg      g   gg   g     ggg ggkg    gg g  g gg n  g 
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54    rrr    .    r r  rr      r   rr   r     rrr rrir    rr r  r rr v  r 
   467  219 C T     >  -     0   0   79  264    8    TTT    .    T T  TT      T   TT   T     TTT TTST    TT T  T TT T  T 
   468  220 C V  H  > S+     0   0   11  264   49    PPP    .    P P  PP      P   PP   P     PPP PPPP    PP P  P PP P  P 
   469  221 C D  H  > S+     0   0   79  265   63    HYD    A    R E  RD      K   RK   R     HEH HHER    KR R  D RD E  D 
   470  222 C D  H  > S+     0   0   59  265   63    EQE    S    E E  EQ      E   EE   E     EEQ QEQE    QE E  E EE Q  E 
   471  223 C V  H  X>S+     0   0    0  265   45    VVV    A    V V  VV      V   VV   V     VVV VVAV    VV V  V VV A  V 
   472  224 C V  H ><5S+     0   0    0  265   19    IIV    I    V V  II      I   VV   I     III IIIV    VI V  I II I  I 
   473  225 C S  H 3<5S+     0   0   52  266   85    VVD    G    Y G  LR      G   IL   L     VVV VVAL    QL L  R VR Q  R 
   474  226 C T  H 3<5S-     0   0   59  266   80    eeA    R    k r  ee      q   ee   e     ene eeee    ee e  g ee G  e 
   475  227 C G  T <<5S+     0   0    8  266    4    ggG    G    g g  gg      g   ng   g     ggg gggg    gg g  g gg G  g 
   476  228 C S      < -     0   0    0  266   60    CCT    A    C C  CC      S   CA   C     GSG GGAC    CC A  C AC S  C 
   477  229 C D  S    S+     0   0    0  266    0    DDD    D    D D  DD      D   DD   D     DDD DDDD    DD D  D DD D  D 
   478  230 C I  E     - z   0 720E   0  266   33    VVV    F    V V  VV      I   VV   V     III IIIV    VV V  V VV I  V 
   479  231 C I  E     -sz 552 721E   0  266   11    III    I    I V  II      I   II   I     III IIII    II I  I II I  I 
   480  232 C I  E     -s  553   0E   7  266    0    III    I    I I  II      I   II   I     III IIII    II I  I II I  I 
   481  233 C V  E     +s  554   0E   2  266   36    VVV    A    V V  VV      V   VV   V     VVV VVVV    VV V  V VV V  V 
   482  234 C G    >   +     0   0   22  266    0    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   483  235 C R  T 3> S+     0   0  121  266    0    RRR    R    R R  RR      R   RR   R     RRR RRRR    RR R  R RR R  R 
   484  236 C G  T 34 S+     0   0   21  266    0    GGG    G    G G  GG      G   GG   G     GGG GGGG    GG G  G GG G  G 
   485  237 C L  T <4 S+     0   0    0  266   26    IIV    I    I I  VI      I   VI   I     IVI IIII    IV I  I II I  I 
   486  238 C F  T  4 S+     0   0   27  266   29    YYT    Y    Y V  YY      Y   YY   Y     YYY YYYY    YY Y  Y YY Y  Y 
   487  239 C A  S >< S+     0   0   10  266   52    GGg    A    g G  gg      g   gg   g     GGG GGQg    gg g  g Gg G  g 
   488  240 C K  T 3  S-     0   0  178  164   62    KNd    .    l .  la      e   ng   l     NAQ QN.s    kl g  p Qa .  p 
   489  241 C G  T 3  S+     0   0   83  266   55    PPY    A    T A  TF      T   AE   T     PGP PPAD    VT E  N PW A  N 
   490  242 C R    <   -     0   0  111  266   76    DDI    P    E D  EE      S   EE   E     DRD DDDA    EE E  E DR S  E 
   491  243 C D     >  -     0   0   96  266   30    EQK    D    A D  AR      V   AA   A     QNQ QQNE    EA A  E KR D  E 
   492  244 C A  H  > S+     0   0    8  266   56    VIS    P    I P  IV      I   VV   I     VPV VVPV    II V  I LV P  I 
   493  245 C K  H  > S+     0   0   83  265   82    EEA    V    K V  AR      V   RK   A     EVE EEVR    RA K  V VR S  V 
   494  246 C V  H  > S+     0   0   81  265   81    AFE    E    S A  QE      E   AA   Q     AVA AAIE    RQ A  K EE L  K 
   495  247 C E  H  X S+     0   0   22  265   50    QQQ    A    Q I  QQ      E   QE   Q     QEQ QQSQ    QQ E  Q QQ A  Q 
   496  248 C G  H  X S+     0   0    0  265   42    SAA    A    A A  AG      A   AA   A     AAA AAAA    AA A  C AG A  C 
   497  249 C E  H  X S+     0   0   67  265   58    KKL    Q    K E  EE      K   EE   E     KKQ QKQE    EE E  K QE K  K 
   498  250 C R  H  X S+     0   0  141  265   28    RRR    R    R V  RR      R   RR   R     RRR RRQR    RR R  R RR Q  R 
   499  251 C Y  H  X S+     0   0   20  265    0    YYY    Y    Y Y  YY      Y   YY   Y     YYY YYYY    YY Y  Y YY Y  Y 
   500  252 C R  H  X S+     0   0   41  265   36    RKK    Q    Q R  RK      K   RR   R     RRR RRRR    QR R  Q RK R  Q 
   501  253 C K  H  X S+     0   0  101  265   61    EEK    K    V E  DK      E   AE   E     QEQ QQKR    AE E  E QK E  E 
   502  254 C A  H  X S+     0   0   28  265   48    AAA    E    E R  AA      A   EE   S     AAA AALE    AS E  A AA A  A 
   503  255 C G  H  X S+     0   0    0  265   15    GGG    G    G S  GG      G   GG   G     GGG GGAG    GG G  G GG G  G 
   504  256 C W  H  X S+     0   0   22  265    0    WWW    W    W W  WW      W   WW   W     WWW WWWW    WW W  W WW W  W 
   505  257 C E  H  X S+     0   0   86  265   62    NND    E    A R  SE      T   KK   S     DKD DDEV    AS K  K DE K  K 
   506  258 C A  H  X S+     0   0    2  265    2    AAA    A    A A  AA      A   AA   A     AAA AATA    AA A  A AA A  A 
   507  259 C Y  H  < S+     0   0   25  262    0    YY     Y    Y Y  YY      Y   YY   Y     YYY YYYY    YY Y  Y YY Y  Y 
   508  260 C L  H  < S+     0   0  108  258   55    LL     M    L E  LL      L   QE   L     LQL LLLE    IL E  E LL Q  E 
   509  261 C R  H  < S+     0   0  136  258   68    EE     A    D G  EA      A   EE   E     EQE EESG    EE E  D EK H  D 
   510  262 C R  S  < S-     0   0   31  254    5    RR     R    R R  RR      R   RR   R     RRR RR R    RR R  R RR R  R 
   511  263 C C        -     0   0   48  210   53    VV     V      V  C       I   V    C     VLV VV V    VC L     I      
   512  264 C G        -     0   0   35  164   41     Q                       A   G           S     S    N  G     G      
   513  265 C Q              0   0  142  129   68     K                                       Q     P             E      
   514  266 C Q              0   0  185   69   46     H                                       H     R                    
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    3 A K              0   0   88  128   55                Q R    R                                        SS S    
     2    4 A A        -     0   0   48  149   71                V Q    Q                                        KK S    
     3    5 A T     >  -     0   0   57  246   38                P T   TS         T                              ST S    
     4    6 A Y  H  > S+     0   0    0  278    1  Y   Y         Y Y Y YY         Y  Y             F           Y YY Y    
     5    7 A K  H  > S+     0   0  120  278   72  A   A         G G S ES         G  S             S           S AA T    
     6    8 A E  H  > S+     0   0  109  278   63  V   E         D Q V QT         A  V             T           V QQ Q    
     7    9 A R  H >X S+     0   0    6  278    0  R   R         R R R RR         R  R             R           R RR R    
     8   10 A A  H 3< S+     0   0    7  278   23  A   A         A I A GA         A  A             A           A GG I    
     9   11 A A  H 3< S+     0   0   88  279   72  S   R         K Q S ES         S  S             S           S QH A    
    10   12 A T  H << S+     0   0  114  278   80  R   Q         A N R LV         K  R             N           R AA N    
    11   13 A H     <  -     0   0   22  279   56  H   H         H H H HH         H  H             H           H HH H    
    12   14 A P  S    S+     0   0   62  280   63  S   D         A T G KP         P  S             P           S QQ S    
    13   15 A S     >  -     0   0    1  281   63  N   N         N N N SS         N  N             N           N HH N    
    14   16 A P  H  > S+     0   0   79  281   27  P   P         P P P PP         P  P             P           P PP P    
    15   17 A V  H  > S+     0   0    0  283   52  L   I         L A L VL         L  L             L           L VV A    
    16   18 A A  H  > S+     0   0    0  283   37  A   A         A A A AA         A  A             A           A AA A    
    17   19 A A  H  X S+     0   0   18  283   69  R   R         R K K KQ         K  K             R           K RR K    
    18   20 A K  H  X S+     0   0   72  283   81  Q   K         R L R RR         R  Q             K           Q KK R    
    19   21 A L  H  X S+     0   0    0  283    2  L   L         L L L LL         L  L             L           L LL L    
    20   22 A F  H  X S+     0   0    0  283   14  F   F         F L F FL         F  F             F           F FF L    
    21   23 A N  H  X S+     0   0   58  283   71  Q   E         E E Q SK         E  Q             E           Q EE F    
    22   24 A I  H  X S+     0   0    3  283   39  I   I         I T I IL         I  I             V           I II L    
    23   25 A M  H  X>S+     0   0    0  284   48  A   A         A M A AM         A  A             A           A AA M    
    24   26 A H  H ><5S+     0   0   74  284   50  E   E         V E E TD         E  E             E           E EE D    
    25   27 A E  H 3<5S+     0   0  127  284   87  E   A         Q R E SQ         A  D             A           D SL S    
    26   28 A K  H 3<5S-     0   0   39  284    0  K   K         K K K KK         K  K             K           K KK K    
    27   29 A Q  T <<5 +     0   0  110  284   53  K   K         Q K K KQ         K  K             K           K KK Q    
    28   30 A T      < +     0   0    0  284   41  S   S         S S S SS         T  S             S           S SS T    
    29   31 A N        +     0   0    0  284    0  N   N         N N N NN         N  N             N           N NN N    
    30   32 A L  E     -a  229   0A   0  284   14  V   V         V L V LL         V  V             V           V LL L    
    31   33 A C  E     -ab 230  55A   0  284   42  V   V         V A V VC         T  V             T           V VV S    
    32   34 A A  E     -ab 231  56A   0  283   58  V   V         V V L IV         V  V             V           V VI I    
    33   35 A S  E     - b   0  57A  15  284    9  S   S         S S S SS         S  S             S           S SS A    
    34   36 A L        +     0   0    3  284   60  A   A         A V A AV         A  A             A           A AA A    
    35   37 A D        +     0   0   42  284    0  D   D         D D D DD         D  D             D           D DD D    
    36   38 A V        -     0   0    8  284    9  V   L         V V V LV         V  V             V           V LL V    
    37   39 A R  S    S+     0   0  162  284   66  T   T         T T T TT         T  T             T           T EE S    
    38   40 A T     >  -     0   0   42  284   42  T   T         T K T DN         T  T             T           T DD T    
    39   41 A T  H  > S+     0   0    4  284   55  S   T         T S T SK         T  T             T           T TT K    
    40   42 A K  H  > S+     0   0  115  284   69  K   K         S K K KA         R  K             K           K EE A    
    41   43 A E  H  > S+     0   0   74  284   28  E   E         E D E SS         E  E             E           E SS E    
    42   44 A L  H  X S+     0   0    4  284   11  L   L         L F L LF         L  L             L           L LL L    
    43   45 A L  H  X S+     0   0   40  284    4  L   L         L L L LL         L  L             L           L LL L    
    44   46 A E  H  X S+     0   0  112  284   81  D   E         D A D KR         D  D             D           D KK H    
    45   47 A L  H  X S+     0   0   19  284   26  L   L         L I L CI         L  L             L           L CC I    
    46   48 A V  H  X S+     0   0    0  283   55  A   A         A I A AV         A  A             A           A AA A    
    47   49 A E  H  < S+     0   0   79  284   22  D   D         E D D DE         D  D             D           D DD D    
    48   50 A A  H  < S+     0   0   24  284   75  R   H         R A R DA         R  R             R           R GG T    
    49   51 A L  H >X S+     0   0    0  282   33  L   L         P V L LV         L  L             L           L .. L    
    50   52 A G  G >< S+     0   0    0  282    3  G   G         Y G G GG         G  G             G           G .. G    
    51   53 A P  G 34 S+     0   0   50  284   18  P   P         M P P PD         P  P             P           P PP P    
    52   54 A K  G <4 S+     0   0   45  284   77  Y   Y         V F Y LH         Y  Y             Y           Y YY Y    
    53   55 A I    <<  -     0   0    0  284   14  I   I         V V I IV         I  I             I           I II I    
    54   56 A C  S    S+     0   0    1  283   49  T   A         L C T AC         A  T             A           T AA C    
    55   57 A L  E     -bc  31  85A   0  283   32  V   V         K L V VM         V  V             V           V VV I    
    56   58 A L  E     -bc  32  86A   1  283   30  L   L         T T L FI         I  L             I           L FF L    
    57   59 A K  E     -bc  33  87A  20  283    2  K   K         H H K KK         K  K             K           K KK K    
    58   60 A T  E     - c   0  88A   2  281    3  T   T         . V T TT         T  T             T           T TT T    
    59   61 A H    >>  +     0   0   18  281    2  H   H         . D H HH         H  H             H           H HH H    
    60   62 A V  G >4  +     0   0    2  283   49  I   I         I I I VI         I  I             I           I II I    
    61   63 A D  G 34 S+     0   0   18  283    2  D   D         D I D DD         D  D             D           D DD D    
    62   64 A I  G <4 S+     0   0   15  283   18  I   I         I E I LI         I  I             I           I VV I    
    63   65 A L    <<  -     0   0   15  284   28  L   V         I D L VI         L  L             L           L VV V    
    64   66 A T  S    S+     0   0   99  284   65  T   S         T F T HE         T  T             S           T RR S    
    65   67 A D  S    S+     0   0   33  284    1  D   D         D D D DD         D  D             D           D DD D    
    66   68 A F        +     0   0   29  284    6  L   F         F Q L FF         F  L             F           L FF F    
    67   69 A S     >> -     0   0   39  279   61  S   N         S S T ND         S  T             G           T GG D    
    68   70 A M  I  4>S+     0   0   38  283   97  P   K         P L P EQ         V  P             P           P DD Q    
    69   71 A E  I  45S+     0   0  109  157   60  .   .         . . . ..         .  .             .           . .. .    
    70   72 A G  I  45S+     0   0   16  283   60  T   E         Q . S DD         D  S             E           S AA D    
    71   73 A T  I  X5S+     0   0    2  283   43  T   T         T . T TL         T  T             T           T TT L    
    72   74 A V  I  > S+     0   0   37  284   73  S   G         G Q S GK         G  S             G           S GG Q    
    75   77 A L  H  X S+     0   0    2  284    1  L   L         L L L LL         L  L             L           L LL L    
    76   78 A K  H  X S+     0   0   64  283   80  K   K         Q Q K KV         N  Q             N           Q KK V    
    77   79 A A  H  X S+     0   0   60  284   64  S   S         A D T TE         V  A             A           A TT A    
    78   80 A L  H  X S+     0   0   14  284   11  L   L         A L L LI         L  L             L           L LL L    
    79   81 A S  H  X>S+     0   0   14  284   35  A   S         A S A AS         A  A             A           A AA S    
    80   82 A A  H  <5S+     0   0   81  284   70  S   E         E I T EN         Q  K             E           K KK K    
    81   83 A K  H  <5S+     0   0  142  284   20  K   K         K K K KR         K  K             K           K KK K    
    82   84 A Y  H  <5S-     0   0   52  284   36  H   H         H H H HK         H  H             H           H HH H    
    83   85 A N  T  <5 +     0   0   64  284   57  R   N         N D R NQ         N  R             N           R NN S    
    84   86 A F      < -     0   0    3  284    0  F   F         F F F FF         F  F             F           F FF F    
    85   87 A L  E     -c   55   0A   8  284   10  L   L         L V L LM         L  L             L           L MM M    
    86   88 A L  E     -c   56   0A   0  284   12  L   I         L I L II         I  L             I           L II I    
    87   89 A F  E     -cd  57 116A   0  284    0  F   F         F F F FF         F  F             F           F FF F    
    88   90 A E  E     -c   58   0A   0  284    0  E   E         E E E EE         E  E             E           E EE E    
    89   91 A N  E     +     0   0A   4  284    0  D   D         D D D DD         D  D             D           D DD D    
    90   92 A R  E     -     0   0A  40  284    0  R   R         R R R RR         R  R             R           R RR R    
    91   93 A K  E     - d   0 118A  36  284    0  K   K         K K K KK         K  K             K           K KK K    
    92   94 A F  E     + d   0 119A   4  284    0  F   F         F F F LF         F  F             F           F LL F    
    93   95 A A        +     0   0    6  283   47  V   V         V A V VA         I  V             I           V VV A    
    94   96 A D        -     0   0   13  283    0  D   D         D D D DD         D  D             D           D DD D    
    95   97 A I    >>  +     0   0   57  283    1  I   I         I I I II         I  I             I           I II I    
    96   98 A G  H 3> S-     0   0   37  283    0  G   G         G G G GG         G  G             G           G GG G    
    97   99 A N  H 3> S+     0   0  113  283   28  S   N         N N S SN         N  S             N           S SN N    
    98  100 A T  H <> S+     0   0   17  283    1  T   T         T T T TT         T  T             T           T TT T    
    99  101 A V  H  X S+     0   0    0  283    3  V   V         V V V VV         V  V             V           V VV V    
   100  102 A K  H  X S+     0   0   21  283   59  Q   Q         Q A Q QK         Q  Q             Q           Q QQ K    
   101  103 A L  H  X S+     0   0   63  283   75  K   K         K L K KY         K  K             K           K KK L    
   102  104 A Q  H  < S+     0   0   28  283    0  Q   Q         Q Q Q QQ         Q  Q             Q           Q QQ Q    
   103  105 A Y  H  < S+     0   0    0  284    0  Y   Y         Y Y Y YY         Y  Y             Y           Y YY Y    
   104  106 A S  H  < S+     0   0   26  284   77  H   H         H S H HS         H  H             H           H HH S    
   105  107 A A     X  +     0   0   38  284   52  G   G         G S G GS         G  G             G           G NN K    
   106  108 A G  T  4 S-     0   0   47  284    0  G   G         G G G GG         G  G             G           G GG G    
   107  109 A V  T  4 S+     0   0   67  284   67  S   A         S V S VI         A  S             A           S AA I    
   108  110 A Y  T  4 S-     0   0   37  284   72  L   L         L H L LY         L  L             L           L LL Y    
   109  111 A R    ><  -     0   0   93  284   34  R   R         R K R RK         R  R             K           R RR H    
   110  112 A I  G >> S+     0   0    1  284    2  I   I         I I I II         I  I             I           I II I    
   111  113 A A  G 34 S+     0   0    0  284   58  S   S         S A S SA         S  S             S           S SS A    
   112  114 A E  G <4 S+     0   0   71  284   59  E   E         E N E EE         E  E             E           E EE D    
   113  115 A W  T <4 S+     0   0    2  284    0  W   W         W W W WW         W  W             W           W WW W    
   114  116 A A     <  -     0   0    0  284   29  A   A         A S A AS         A  A             A           A AA A    
   115  117 A D  S    S+     0   0   10  284   44  H   H         H H H DD         H  H             H           H DD D    
   116  118 A I  E     +de  87 144A   0  284    8  I   L         I I I LI         I  I             I           I II I    
   117  119 A T  E     - e   0 145A   0  284   42  V   V         V T V VT         I  V             I           V VV T    
   118  120 A N  E     -de  91 146A   0  284    3  N   N         N N N NN         N  N             N           N NN N    
   119  121 A A  E     -de  92 147A   0  284   46  C   A         C A C LA         C  C             C           C LL A    
   120  122 A H        -     0   0    0  284   53  A   S         A H A SH         S  A             A           A SS H    
   121  123 A G  S >  S+     0   0    0  283   80  M   I         V P M IT         V  M             V           M II P    
   122  124 A V  T 3  S+     0   0    0  284   33  L   L         L V L LV         L  L             L           L LL L    
   123  125 A V  T 3  S-     0   0    4  284   51  A   A         A P A GP         P  A             P           A SS P    
   124  126 A G    X   -     0   0    0  284    1  G   G         G G G GG         G  G             A           G GG G    
   125  127 A P  T >> S+     0   0   44  284   67  P   D         S P P DE         E  P             E           P DD E    
   126  128 A G  H 3> S+     0   0   25  284   30  G   G         G S G GG         G  G             G           G GG G    
   127  129 A I  H <> S+     0   0    0  284   36  I   I         I I I IV         I  I             I           I II V    
   128  130 A V  H <> S+     0   0    2  284   13  V   V         V I V VI         V  V             V           V VV V    
   129  131 A S  H  X S+     0   0   71  284   73  D   E         D S D ES         E  D             Q           D DD H    
   130  132 A G  H  X S+     0   0    7  284   35  A   A         A G A AG         A  A             A           A AA G    
   131  133 A L  H  X S+     0   0    0  284    1  L   L         L L L LL         L  L             L           L LL L    
   132  134 A K  H  X S+     0   0   50  284   66  A   A         A S A SA         A  A             A           A TT K    
   133  135 A Q  H  X S+     0   0   93  284   56  Q   Q         Q S Q QQ         Q  Q             E           Q QQ E    
   134  136 A A  H  X S+     0   0    0  284   57  T   T         A V T TV         T  T             T           T TT V    
   135  137 A A  H  X S+     0   0    6  284   28  A   G         A G A IG         A  A             A           A IV G    
   136  138 A E  H  < S+     0   0  132  284   84  s   t         s L s sI         s  s             q           s tt l    
   137  139 A E  H  < S+     0   0  129  222   34  s   e         d . q d.         d  q             d           q gg e    
   138  140 A V  H  < S+     0   0   49  284   90  v   H         f p t fP         f  r             f           r ff T    
   139  141 A T     <  -     0   0   33  208   67  e   K         p . g p.         g  a             g           a rr .    
   140  142 A K  S    S+     0   0  181  232   87  V   G         A . A EK         P  A             S           A GG N    
   141  143 A E  S    S-     0   0   78  236   37  e   E         G . E QG         E  E             E           E EE g    
   142  144 A P        -     0   0   37  195   61  g   .         E g G ..         .  G             .           G .. t    
   143  145 A R        -     0   0   15  282   12  R   R         R R R RR         R  R             R           R RR R    
   144  146 A G  E     -e  116   0A   0  284   15  A   G         G G A AG         G  A             G           A GG G    
   145  147 A L  E     -ef 117 177A   0  284    4  L   L         L L L FL         L  L             L           L FF L    
   146  148 A L  E     -ef 118 179A   0  284    8  L   L         L L L LL         L  L             L           L LL L    
   147  149 A M  E     -ef 119 180A   0  284   38  I   M         I L I IL         V  I             I           I LL L    
   148  150 A L  E     + f   0 181A   3  284    1  L   L         L L L LL         L  L             L           L LL I    
   149  151 A A        +     0   0    0  284    7  A   A         A S A AA         A  A             A           A AA A    
   150  152 A E  S    S-     0   0   27  283   23  E   E         E E E EE         E  E             E           E EE E    
   151  153 A L        -     0   0   23  283    7  M   M         M M M MM         M  M             M           M MM M    
   152  154 A S        +     0   0   75  283   27  T   T         T S T TS         T  T             T           T TT S    
   153  155 A C  S >  S-     0   0   28  284   20  S   T         S T S SS         S  S             S           S SS S    
   154  156 A K  T 3  S+     0   0  188  284   47  K   R         K K Q KQ         K  K             K           K KK K    
   155  157 A G  T 3  S+     0   0   44  283    1  G   G         G G G GG         G  G             G           G GG G    
   156  158 A S    <   -     0   0   36  284   53  S   T         S A S ST         S  S             S           S SS S    
   157  159 A L        +     0   0   20  284   10  M   F         L L M LL         L  M             L           M LL L    
   158  160 A A        +     0   0   18  284   49  A   A         A A A AA         A  A             A           A AA A    
   159  161 A T     >  -     0   0   66  284   73  T   T         T V T TK         T  T             T           T TT T    
   160  162 A G  H  > S+     0   0   48  284   37  G   G         G G G GD         G  G             G           G GG G    
   161  163 A E  H  > S+     0   0  123  284   48  A   A         E S A AS         E  P             E           P LS L    
   162  164 A Y  H  > S+     0   0    9  283    0  Y   Y         Y Y Y YY         Y  Y             Y           Y YY Y    
   163  165 A T  H  X S+     0   0    3  284   16  T   T         T T T TT         T  T             T           T TT S    
   164  166 A K  H  X S+     0   0  112  284   70  Q   K         K Q E KV         K  E             S           E SS D    
   165  167 A G  H  X S+     0   0   13  284   74  L   A         L E L RE         A  L             A           L RQ A    
   166  168 A T  H  X S+     0   0    0  284   59  S   S         S A S CT         S  S             S           S CC A    
   167  169 A V  H  X S+     0   0   15  284   12  V   I         V V V VV         V  V             V           V VV V    
   168  170 A D  H  X S+     0   0   84  284   43  E   E         E R R DQ         D  Q             D           Q DS Q    
   169  171 A I  H >< S+     0   0    9  284   69  A   S         M M A LM         Y  A             Y           A LL M    
   170  172 A A  H >< S+     0   0    0  283    1  A   A         A A A AA         A  A             A           A AA A    
   171  173 A K  H 3< S+     0   0   51  284   31  R   K         R R R RR         R  R             R           R RR C    
   172  174 A S  T << S+     0   0   75  283   74  R   K         K A K EK         K  K             K           K SR R    
   173  175 A D    <>  +     0   0   26  284   68  H   H         H H H HH         Y  H             Y           H HH H    
   174  176 A K  T  4 S+     0   0   75  284   44  R   S         A R R PR         K  R             P           R PP R    
   175  177 A D  T  4 S+     0   0   90  284   44  A   S         G D G DD         N  G             S           G GE D    
   176  178 A F  T  4 S+     0   0    8  284    5  F   F         F F F SF         F  F             F           F SS F    
   177  179 A V  E  <  +f  145   0A   1  284    4  V   V         V V V MV         V  V             V           V TT V    
   178  180 A I  E     -     0   0A   0  283   40  L   I         M I L LI         M  L             L           L FF F    
   179  181 A G  E     -fg 146 196A   0  284    0  G   G         G G G GG         G  G             G           G GG G    
   180  182 A F  E     -fg 147 197A   0  284    0  F   F         F F F FF         F  F             F           F FF F    
   181  183 A I  E     +fg 148 198A  10  283   12  V   I         V I V VI         V  V             V           V VV I    
   182  184 A A        -     0   0    0  283   33  A   S         A A A AS         S  A             S           A AA G    
   183  185 A Q  S    S+     0   0   34  284   49  t   n         t q t tq         t  t             t           t tt q    
   184  186 A R  S    S-     0   0  108  284   68  d   t         r q g rn         a  e             a           e qr k    
   185  187 A D        -     0   0   38  204   79  .   .         . E k .a         .  e             .           e q. s    
   186  188 A M        -     0   0   22  215   84  .   .         . N E .Q         .  E             .           E DD T    
   187  189 A G        +     0   0   24  220   62  .   .         . T G .S         .  E             .           E GA S    
   188  190 A G    > > +     0   0   12  245   65  G   .         K V E .A         S  E             .           E GG S    
   189  191 A R  G > 5S+     0   0  123  260   82  D   H         A D G AS         E  E             D           E RP C    
   190  192 A D  G 3 5S+     0   0  175  284   41  E   M         D K E DQ         D  E             N           E YD L    
   191  193 A E  G < 5S-     0   0  111  284   28  E   E         E D E EE         E  E             E           E EE D    
   192  194 A G  T < 5S+     0   0   49  284   45  D   D         D D D DD         D  D             D           D DD D    
   193  195 A Y      < -     0   0   42  284   24  F   F         F F F FF         F  F             F           F FF F    
   194  196 A D        -     0   0   38  116    1  .   .         . . . ..         .  .             .           . .. .    
   195  197 A W        -     0   0   12  124    7  .   .         . . . ..         .  .             .           . .. .    
   196  198 A L  E     -g  179   0A   0  284   28  V   I         V L V VL         V  V             V           V VV I    
   197  199 A I  E     -g  180   0A   1  284   59  V   V         L I V VV         V  V             V           V VV Y    
   198  200 A M  E     -gh 181 228A   0  284   23  F   F         F L F FL         F  F             F           F FF M    
   199  201 A T  E     - h   0 229A   0  284   11  T   T         T T T TS         T  T             T           T TT T    
   200  202 A P        +     0   0   31  284   27  T   T         T P T TP         T  T             T           T TT P    
   201  203 A G  S    S+     0   0   33  284    0  G   G         G G G GG         G  G             G           G GG G    
   202  204 A V  E     +i  216   0B   8  284   31  V   V         V V V VV         T  V             V           V II V    
   203  205 A G  E     -i  217   0B   3  283   56  S   N         N G N NG         P  N             N           N NN G    
   204  206 A L        -     0   0   35  283    8  L   R         L L L ML         A  L             L           L LL M    
   205  207 A D        -     0   0   97  283   62  S   A         A D S ED         S  S             S           S EG P    
   206  208 A D    >   -     0   0   41  283   76  A   T         S A S SV         A  S             S           S SS E    
   207  209 A K  T 3  S+     0   0  216  283   49  S   K         K K S KT         I  S             K           S RR S    
   208  210 A G  T 3  S+     0   0   77  258   14  G   G         G G G GG         .  G             G           G GG .    
   209  211 A D    <>  +     0   0   42  265    9  D   D         D D D DD         .  D             D           D DD .    
   210  212 A A  T  4 S+     0   0   76  266   64  A   P         Q A A KQ         .  A             K           A KK .    
   211  213 A L  T >4 S+     0   0   87  267   44  L   L         L M L LL         .  L             L           L LL .    
   212  214 A G  G >4 S+     0   0    9  281   17  G   G         G G G GG         .  G             G           G GG G    
   213  215 A Q  G 3< S+     0   0   89  282   19  Q   Q         Q Q Q QQ         .  Q             Q           Q QQ s    
   214  216 A Q  G <  S+     0   0  148  282    3  Q   Q         Q Q Q QN         .  Q             Q           Q QQ q    
   215  217 A Y  S <  S-     0   0  109  282    0  Y   Y         Y Y Y YY         .  Y             Y           Y YY Y    
   216  218 A R  E     -i  202   0B  69  282   57  Q   Q         Q R Q QR         .  Q             Q           Q QQ R    
   217  219 A T  E  >  -i  203   0B  45  282    7  T   T         T T T TS         .  T             T           T TT T    
   218  220 A V  H  > S+     0   0    0  282   47  P   P         P P P PP         .  P             P           P PP P    
   219  221 A D  H  > S+     0   0   71  282   63  T   E         E R A AH         .  A             Q           A AA Q    
   220  222 A D  H  > S+     0   0   67  282   64  S   A         S Q S GQ         .  S             S           S EE Q    
   221  223 A V  H  X>S+     0   0    0  282   45  A   A         A V A AV         .  A             A           A AA V    
   222  224 A V  H ><5S+     0   0    0  283   19  V   I         I I V VI         .  V             I           V VV I    
   223  225 A S  H 3<5S+     0   0   78  284   81  E   K         G L G AY         G  G             G           G GG L    
   224  226 A T  H 3<5S-     0   0   58  284   84  R   R         R e R Ne         R  R             R           R RR d    
   225  227 A G  T <<5S+     0   0    6  284    3  G   G         G g G Gg         G  G             G           G GG h    
   226  228 A S      < -     0   0    0  284   59  A   A         A C A AA         A  A             A           A AA C    
   227  229 A D  S    S+     0   0    0  284    0  D   D         D D D DD         D  D             D           D DD D    
   228  230 A I  E    S- h   0 198A   0  284   31  F   F         F V F FV         F  F             F           F FF V    
   229  231 A I  E     -ah  30 199A   0  284   19  I   I         I I I II         I  I             I           I II I    
   230  232 A I  E     -a   31   0A   6  284    0  I   I         I I I II         I  I             I           I II I    
   231  233 A V  E     +a   32   0A   1  284   33  S   S         S V S AV         A  S             A           S AA V    
   232  234 A G    >   +     0   0   23  284    0  G   G         G G G GG         G  G             G           G GG G    
   233  235 A R  G >> S+     0   0  126  284    0  R   R         R R R RR         R  R             R           R RR R    
   234  236 A G  G 34 S+     0   0   18  284    0  G   G         G G G GG         G  G             G           G GG G    
   235  237 A L  G <4 S+     0   0    0  284   25  I   I         I I I II         I  I             I           I II I    
   236  238 A F  T <4 S+     0   0   24  284   34  Y   Y         Y Y Y YY         Y  Y             Y           Y YY Y    
   237  239 A A  S >< S+     0   0   22  284   59  A   A         A g A Ag         A  A             T           A AA G    
   238  240 A K  T 3  S-     0   0  176  165   62  .   .         . l . .s         .  .             .           . .. .    
   239  241 A G  T 3  S+     0   0   84  284   53  A   T         A V A SD         A  A             A           A AA S    
   240  242 A R    <   -     0   0   78  284   77  E   S         P D S EQ         P  L             P           S GG K    
   241  243 A D     >  -     0   0   91  284   27  D   D         D E D DA         D  D             D           D DD N    
   242  244 A A  H  > S+     0   0    8  284   53  P   P         P I P AI         P  P             P           P AA M    
   243  245 A K  H  > S+     0   0   92  283   82  L   I         V R V VI         V  V             V           V VV V    
   244  246 A V  H  > S+     0   0   79  283   82  E   Q         E A E SS         E  E             E           E AA E    
   245  247 A E  H  X S+     0   0   23  283   47  A   A         A Q A AQ         A  A             A           A AA R    
   246  248 A G  H  X S+     0   0    0  283   40  V   A         I A V AA         A  V             A           V AA A    
   247  249 A E  H  X S+     0   0   55  283   56  L   K         K K L EI         Q  Q             K           Q KK K    
   248  250 A R  H  X S+     0   0   78  283   26  R   L         Q R R AR         R  R             Q           R RR A    
   249  251 A Y  H  X S+     0   0    9  283    0  Y   Y         Y Y Y YY         Y  Y             Y           Y YY F    
   250  252 A R  H  X S+     0   0   37  283   33  R   Q         Q M R RK         Q  R             Q           R RR K    
   251  253 A K  H  X S+     0   0   95  283   64  E   N         K E E KQ         K  E             Q           E DD E    
   252  254 A A  H  X S+     0   0   16  283   49  E   E         A A E AA         E  E             Q           E EE A    
   253  255 A G  H  X S+     0   0    0  283   20  G   G         G G G GG         G  G             G           G GG G    
   254  256 A W  H  X S+     0   0   19  283    0  W   W         W W W WW         W  W             W           W WW W    
   255  257 A E  H  X S+     0   0   83  283   62  K   A         D E R EE         E  R             E           R NK S    
   256  258 A A  H  X S+     0   0    1  283    1  A   A         A A A AA         A  A             A           A AA A    
   257  259 A Y  H  < S+     0   0   21  281    0  Y   Y         Y Y Y YY         Y  Y             Y           Y YY Y    
   258  260 A L  H  < S+     0   0  113  277   62  L   E         L Q L EI         M  L             L           L LL Q    
   259  261 A R  H  <        0   0  157  277   66  E   T         K D E NN         A  E             A           E QQ Q    
   260  262 A R     <        0   0   89  273    4  R   R         R R R RR         R  R             R           R RR R    
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58     K   S  R                           TQ      Q     T  R KKQ    Q     
   263    4 C A        -     0   0   31  121   71     L   K  Q                Q          QQ    Q V     K  K QLV    V QQ  
   264    5 C T     >  -     0   0   47  219   38   PPT TTSTTTSTT        TT  TSTNT TT  T STTTTTTTP  TTTTSTTTPPP T  S TTTT
   265    6 C Y  H  > S+     0   0    0  253    0   YYY YYYYYYYYY Y Y Y  YYYYYYYYY YY YYYYYYYYYYYYY YYYYYYYYYYY Y  Y YYYY
   266    7 C K  H  > S+     0   0  122  253   72   SSG AALGAAGAS A G G  AQAAGAGLA SS ESGSGSSSSASEE STSAATATSGG S  G EETT
   267    8 C E  H  > S+     0   0   70  253   62   EEQ SSEEAQQEA D D D  QKDDASTEE AA DAETEAAAASADD AAASAAEAVVD A  D QQAA
   268    9 C R  H  X S+     0   0    2  253    1   RRR RRRRRRRRR R R R  RRRRRRRRR RR RRRRRRRRRRRRR RRRRRRRRRRR R  R RRRR
   269   10 C A  H  < S+     0   0   21  253   21   AAA IISAAAAAA A A A  AIAAAAAAA AA AAAASAAAAAAAA AAAAAAAAAAA A  A AAAA
   270   11 C A  H  < S+     0   0   47  253   71   KKA PPKSSALAS T A A  EDTTSAREA QQ RSKSKSSQQASRR QQQASSKSKKK T  K KKSS
   271   12 C T  H  < S+     0   0   31  253   83   QQR LLLAKKKKK R L L  NFRRKKTHK SS DKNINNKSSKKDD SSSSKKNKNNA S  T KKKK
   272   13 C H     <  -     0   0   13  254   44   HHF HHHCHHQHH H C C  HCHHHQHTH HH HHHHYHHHHQHHH HHHHHHYHHHH H  H HHHH
   273   14 C P  S    S+     0   0   45  257   60   SST TTSRPPTPP K S S  HKKKPPPEP PP PPPPTPPPPPPPP PPPPPPKPPPA P  P GGPP
   274   15 C S     >  -     0   0    0  257   59   NNN NNNNNNNVN N N N  NNNNNNNNV NN NNNSNNNNNNNNN NNNNNNNNNNN N  N NNNN
   275   16 C P  H  > S+     0   0   82  261   28   AAP PPPPPPPPA P P P  PPPPPPPKP PP PAPPPAAPPAAPP PPPPPAPAPIP P  P PPAA
   276   17 C V  H  > S+     0   0    0  264   54   CCA TTTLLAAVL A A A  ALAALALVV LL LLLIALLLLALLL LLLTLLALLLL L  L AALL
   277   18 C A  H  > S+     0   0    0  264   29   AAA AAATAAAAV A S S  AAAAAAVAA AA AVAAAAVAAAVAA AAAAAAAAVVA A  V AAAA
   278   19 C A  H  X S+     0   0   22  264   67   RRK RRKRKKIKK K K K  KKKKKKKKK RR RKRRRKKRRKKRR RRRRKKVKRRR R  R RRKK
   279   20 C K  H  X S+     0   0   73  264   74   SSA RRASRALQK L K K  AKLLRARKQ KK RKKRRRKRRAKRR KKKRRRRRKKR R  R KKRR
   280   21 C L  H  X S+     0   0    0  265    2   LLL IIFLLLLLL L L L  LLLLLLLLL LL LLLLLLLLLLLLL LLLVLLLLLLL L  L LLLL
   281   22 C F  H  X S+     0   0    0  265   13   LLL LLLLFLLLF L F F  LLLLFLFLL FF FFFLLFFFFLFFF FFFLFFLFFFF F  F LLFF
   282   23 C N  H  X S+     0   0   69  265   71   EEE SSEHEEEDE E T T  EHEEEEETD QQ QEEKEQEHHEEQQ QQQEEEEEAAE E  E EEEE
   283   24 C I  H  X S+     0   0    2  265   41   LLT IILIITTIV T L L  TLTTICVLI VV IVILIIVVVCVII VVVTIITITII V  I TTII
   284   25 C M  H  X>S+     0   0    0  266   52   MMM MMMMAIMCA I M M  IIIIAMAMC AA AAAMMAAAAIAAA AAAMAAIAAAA A  A MMAA
   285   26 C H  H  <5S+     0   0   75  266   50   EEE DDEMEEEDE H E E  GSHHEEEAD EE TEEDDEEEEEETT EEEEEEEEEEV E  E EEEE
   286   27 C E  H  <5S+     0   0  112  266   83   RRR RRREARRRA R Q Q  RERRARAER EE EATDRTAEERAEE EEERAARAAAQ A  Q RRAA
   287   28 C K  H  <5S-     0   0   40  266    0   KKK KKKKKKKKK K K K  KKKKKKKKK KK KKKKKKKKKKKKK KKKKKKKKKKK K  K KKKK
   288   29 C Q  T  <5 +     0   0  109  266   48   QQK RRKEKKKKK R Q Q  KKRRKQKQK KK QKKQKKKKKQKQQ KKRKHKKKKKQ K  Q KKKK
   289   30 C T      < +     0   0    0  266   40   TTS TTSTTTTTT S T T  STSSTTTTT SS STTSSTTSSSTSS SSSTSTTTTTS S  S TTTT
   290   31 C N        +     0   0    0  266    0   NNN NNNNNNNNN N N N  NNNNNNNNN NN NNNNNNNNNNNNN NNNNNNNNNNN N  N NNNN
   291   32 C L  E     -s  740   0E   0  266   15   LLL LLLLVLLLV L L L  LLLLVLVLL VV VVVLLVVVVLVVV VVVLVVLVVVV V  V LLVV
   292   33 C C  E     -st 741 577E   0  266   47   SSS CCSCTCACT A A A  CAAATCTSC TT VTTCCTTTTCTAV TTTCTTCTTTV T  V SSTT
   293   34 C A  E     -st 742 578E   0  265   57   VVV VVVVVVVVV V V V  VLVVVVVLV VV VVVVLVVVVVVVV VVVVVVVVVVV V  V VVVV
   294   35 C S  E     - t   0 579E  14  266   11   AAS SSAASSSSS S N N  SSSSSSSSS SS SSSSSSSSSSSSS SSSSSSSSSSS S  S SSSS
   295   36 C L        +     0   0    2  266   60   VVV VVAVAVVVA V C C  VLVVAIAAV AA AAAVIAAAAVAAA AAAVAAVAAAA A  A VVAA
   296   37 C D        +     0   0   54  266    0   DDD DDDDDDDDD D D D  DDDDDDDDD DD DDDDDDDDDDDDD DDDDDDDDDDD D  D DDDD
   297   38 C V        -     0   0    6  266   11   VVV VVLVVVVVV V G G  VVVVVVVVV VV VVVVVVVVVVVVV VVVVVVTVVVV V  V VVVV
   298   39 C R  S    S+     0   0  150  266   65   TTV TTTTTTTTT T A A  TTTTTTSTT TT TTTTTTTTTTTTT TTTTTTPTTTT T  T TTTT
   299   40 C T     >  -     0   0   17  266   45   TTK KKSSTKTST Q H H  KTQQTNTSS TT TTTNTTTTTNTTT TTTKTTKTTTT T  T KKTT
   300   41 C T  H  > S+     0   0   13  266   53   KKS AAKSTSSKT S S S  QSSSTKTAK TT TTSKTTTTTKTTT TTTSTTTTTTT T  T KKTT
   301   42 C K  H  > S+     0   0  139  266   68   KKA AAASRDAAK S A A  AESSRQKAA KK KKKAEKKKKRKKK KKKAKKEKKKS K  S KKKK
   302   43 C E  H  > S+     0   0   77  266   31   EED EEAAEDDGE D Q Q  DKDDEDEQG EE EEESKEEEEDEEE EEEEEEDEQEE E  A DDEE
   303   44 C L  H  X S+     0   0    5  266   12   LLL VVLLLFFLL F L L  FIFFLLLLL LL LLLFILLLLLLLL LLLILLFLLLL L  L FFLL
   304   45 C L  H  X S+     0   0   40  266    4   IIL LLILLLLLL L L L  LILLLLLIL LL LLLLLLLLLLLLL LLLLLLLLLLL L  L LLLL
   305   46 C E  H  X S+     0   0  108  266   75   SSA EEEDDKTRD A D D  RAAADDDQR DD DDERNDDDDDDDD DDDDDDTDDDD D  D AADD
   306   47 C L  H  X S+     0   0   29  266   27   III VVLLLVIIL I F F  ILIILVLLI LL LLLIILLLLVLLL LLLILLILLLL L  L IILL
   307   48 C V  H  X S+     0   0    0  265   56   AAV VVAIAIVAA I I I  IAIIACAAA AA AAAVVAAAACAAA AAAVAAIAAAA A  A IIAA
   308   49 C E  H  < S+     0   0   77  266   24   DDD RRDPDDDED D E E  DDDDDEDDE DD DDDEDDDDDDDDD DDDRDDDDDDE D  E DDDD
   309   50 C A  H  < S+     0   0   26  266   77   AAT RRKEHLAAR A Q Q  VQAARARSA RR RRRAARRRRARRR RpRQRRVRQQR R  R VVRR
   310   51 C L  H >X S+     0   0    0  263   31   IIV VVVILVVAL V V V  VLVVLVLIA LL LLLVTLLLLVLLL LlLVLLVLLL. L  L VVLL
   311   52 C G  G >< S+     0   0    0  263    2   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGHGGGGGGGG GGGAGGGGGG. G  G GGGG
   312   53 C P  G 34 S+     0   0   48  266   17   PPP AAPPPPPPP P P P  PPPPPRPPP PP PPPDVPPPPPPPP PPPPPPPPPPP P  P PPPP
   313   54 C K  G <4 S+     0   0   30  266   73   YYY SSYHYYFYY L H H  YELLYNHEY YY YYYHDHYYYDYYY YYYYHYYYYYY Y  H FFYY
   314   55 C I    <<  -     0   0    0  266   15   III VVIIIVVCI V I I  IIVVIVIIC II MIIVIIIIIVIMM IIIVIIVIIIM I  M VVII
   315   56 C C  S    S+     0   0    0  265   43   CCC CCCCACCCA C C C  CCCCACACC AA VAAC.AAAACAVV AAACAACAAAV A  V CCAA
   316   57 C L  E     -tu 553 607E   0  265   31   VVL MMLVVMLCV L V V  LVLLVLVLC VV VVVM.VVVVLVVV VVVMVVLVVVV V  V LLVV
   317   58 C L  E     -tu 554 608E   0  265   31   LLI VVLLIVIII I L L  VLIIIVILI II LIII.IIIIVILL IIIVIIIIFLL I  L IIII
   318   59 C K  E     -tu 555 609E  22  265    1   KKK KKKKKKKKK K K K  KKKKKKKKK KK KKKK.KKKKKKKK KKKKKKkKKKK K  K KKKK
   319   60 C T  E     - u   0 610E   2  264    2   TTT TTTLTTTTT T T T  TTTTTTTTT TT TTTT.TTTTTTTT TTTTTTtTTTT T  T TTTT
   320   61 C H    >   +     0   0   26  264    1   HHH HHHHHHHHH H H H  HHHHHHHHH HH HHHH.HHHHHHHH HHHHHHHHHHH H  H HHHH
   321   62 C V  G >   +     0   0    3  265   39   IIV CCIIIVIII I I I  VVIIIIIII II IIII.IIIIIIII IIIIIIVIIII I  I IIII
   322   63 C D  G 3  S+     0   0   74  265    1   DDD DDDDDDDDD D D D  DDDDDDDDD DD DDDD.DDDDDDDD DDDDDDDDDDD D  D DDDD
   323   64 C I  G <  S+     0   0   82  265   11   IIV IIVIIIIII I L L  VIIIIIIII II IIII.IIIIIIII IIIIIIIIIII I  I IIII
   324   65 C L    <   -     0   0   15  266   28   VVV IIVLLILVL L L L  IILLLVLIV LL LLLIILLLLVLLL LLLVLLLLLLI L  I IILL
   325   66 C T  S    S+     0   0   88  266   64   EEE EEDTTEEES E E E  EEEETESEE SS ASSDESSSSESAA SSSESSESSST S  T EESS
   326   67 C D  S    S+     0   0   71  266   10   DDD DDDDDDDDD D D D  DDDDDDDDD DD DDDDDDDDDDDDD DDDDDDDDDDD D  D DDDD
   327   68 C F        +     0   0   35  266    7   FFF FFFfFFFFF F f F  FfFFFFfFF ff ffLfFffffFfff fffFfffffff f  f ffff
   328   69 C S     >> -     0   0   45  202   62   DDD TTDsSAEDS D s T  EdDDSD.TD .. ..TdS....D... ...T..s.... .  . tt..
   329   70 C M  I  4>S+     0   0   44  203   88   AAS LLQVVPYRE S I P  FLSSVM.PR .. ..PLE....L... ...I..V.... .  . VV..
   330   71 C E  I  45S+     0   0  135  194   54   ... ......... . . .  ......d.. qq ae...ekqq.eaa qqq.dn.ntpp e  p ..nd
   331   72 C G  I  45S+     0   0   33  250   62   DDS EED.DTSDE N . S  S.NNDDEED EE EEA.EEEAADEEE EEEDDE.EEEQ E  Q ..EE
   332   73 C T  I  X5S+     0   0    2  252   41   LLL FFL.TLLLT L . I  M.LLTLTLL TT TTT.FTTTTLTTT TTTLTT.TTTT T  T ..TT
   333   74 C V  I  > S+     0   0   37  266   72   QQK EEQAGRRQG K K K  RTKKGQGTQ GG GGEKRGGGGQGGG GGGEGGRGGGG G  G HHGG
   336   77 C L  H  X S+     0   0    3  266    0   LLL LLLLLLLLL L L L  LLLLLLLLL LL LLLLLLLLLLLLL LLLLLLLLLLL L  L LLLL
   337   78 C K  H  X S+     0   0   68  265   79   QQQ VVTLNQEQK V T T  KKVVNTKKQ NN QKQVRKKNNTKQQ NNNKTKEKKKQ K  K QQKK
   338   79 C A  H  X S+     0   0   60  266   62   EEA KKAAVENAA E Q Q  EKEEVQAEA AA SAAEQTAAAAASS AAARAASAAHA A  A EEAA
   339   80 C L  H  X S+     0   0   13  266   12   LLL LLLLLLLLL L L L  LLLLLLLLL LL LLLLLLLLLLLLL LLLLLLLLILA L  A LLLL
   340   81 C S  H  X>S+     0   0   15  266   37   AAA SSAKASSAA S A A  SASSASAAA AA SAASSAAAASASS AAAAAASAAAA A  A SSAA
   341   82 C A  H  <5S+     0   0   80  266   70   KKE KKKAQVLDE K E E  AQKKQEEKD QQ QEEQDEEQQQEQQ QQQDKQRQEQE A  Q VVQQ
   342   83 C K  H  <5S+     0   0  134  266   19   KKK QQKRKNKKK K R R  KQKKKKKQK KK KKKRKKKKKKKKK KKKEKKRKKKK K  K KKKK
   343   84 C Y  H  <5S-     0   0   51  266   36   HHH LLHYHHHHH H H H  HHHHHHHHH HH HHHHYHHHHHHHH HHHLHHHHHHH H  H HHHH
   344   85 C N  T  <5 +     0   0   60  266   55   DDD DDDNNDDDN D Q Q  DNDDNDNQD NN NNNNDNNNNDNNN NNNDNNDNNNN N  N DDNN
   345   86 C F      < -     0   0    0  266    0   FFF FFFFFFFFF F F F  FFFFFFFFF FF FFFFFFFFFFFFF FFFFFFFFFFF F  F FFFF
   346   87 C L  E     -u  577   0E   6  266   11   LLL VVMLLVLLL V L L  LLVVLLLLL LL LLLMLLLLLLLLL LLLVLLLLLLL L  L LLLL
   347   88 C L  E     -u  578   0E   0  266   12   FFI IIIIIIIII I I I  IIIIIIIII II IIIIIIIIIIIII IIIIIIIIIIL I  I IIII
   348   89 C F  E     -uv 579 638E   0  266    0   FFF FFFFFFFWF F F F  FFFFFFFFW FF FFFFFFFFFFFFF FFFFFFFFFFF F  F FFFF
   349   90 C E  E     -u  580   0E   0  266    0   EEE EEEEEEEEE E E E  EEEEEEEEE EE EEEEEEEEEEEEE EEEEEEEEEEE E  E EEEE
   350   91 C N  E     +     0   0E  30  266    0   DDD DDDDDDDDD D D D  DDDDDDDDD DD DDDDDDDDDDDDD DDDDDDDDDDD D  D DDDD
   351   92 C R  E     -     0   0E  47  266    0   RRR RRRRRRRRR R R R  RRRRRRRRR RR RRRRRRRRRRRRR RRRRRRRRRRR R  R RRRR
   352   93 C K  E     - v   0 640E  85  266    0   KKK KKKKKKKKK K K K  KKKKKKKKK KK KKKKKKKKKKKKK KKKKKKKKKKK K  K KKKK
   353   94 C F  E     + v   0 641E   3  266    0   FFF FFFFFFFFF F F F  FFFFFFFFF FF FFFFFFFFFFFFF FFFFFFFFFFF F  F FFFF
   354   95 C A        +     0   0   46  265   45   AAA AAAAIAAAI A A A  AAAAIAIAA II VIIAAIIIIAIVV IIIAIIAIIIV I  V AAII
   355   96 C D        -     0   0   67  265    0   DDD DDDDDDDDD D D D  DDDDDDDDD DD DDDDDDDDDdDDD DDDDDDDDDDD D  D DDDD
   356   97 C I    >>  +     0   0   79  265    1   III IIIIIIIII I I I  IIIIIIIII II IIIIIIIIItIII IIIIIIIIIII I  I IIII
   357   98 C G  H 3> S-     0   0   39  265    0   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   358   99 C N  H 3> S+     0   0  113  265   28   NNN NNNSNNNSN N T T  NHNNNNNNN NN NNNNNNNNNNNNN NNNNNNNNNNN N  H NNNN
   359  100 C T  H <> S+     0   0   75  265    2   TTT TTTTTTTTT T I I  TTTTTTTTT TT TTTTTTTTTTTTT TTTTTTTTTTT T  T TTTT
   360  101 C V  H  X S+     0   0    0  265    5   VVV VVVVVVVVV V S S  VVVVVVVVV VV VVVVVVVVVAVVV VVVVVVVVVVV V  V VVVV
   361  102 C K  H  X S+     0   0   23  265   59   KKA SSKAQAARQ A K K  AQAAQSQHR QQ QQQKVQQQQSQQQ QQQEQQAQQQQ Q  Q AAQQ
   362  103 C L  H  X S+     0   0   92  265   78   HHL LLLSKLHLK L Q Q  LLLLKLKKL KK KKKYHKKKKLKKK KKKLKKLKKKK K  M LLKK
   363  104 C Q  H  < S+     0   0   76  265    0   QQQ QQQQQQQQQ Q Q Q  QQQQQQQQQ QQ QQQQQQQQQQQQQ QQQQQQQQQQQ Q  Q QQQQ
   364  105 C Y  H  < S+     0   0    0  266    0   YYY YYYYYYYYY Y Y Y  YYYYYYYFY YY YYYYYYYYYYYYY YYYYYYYYYYY Y  Y YYYY
   365  106 C S  H  < S+     0   0   23  266   78   AAS SSSRHASSH S E E  SESSHSHTS HH HHHSSHHHHSHHH HHHSHHGHHHH H  H SSHH
   366  107 C A  S  X S+     0   0   34  266   52   NNS SSSAGASSG S K K  SKSSGAGAS NN GGGSRGGNNSGGG NNNAGGGGGGG Q  G SSGR
   367  108 C G  T  4 S-     0   0   60  266    0   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   368  109 C V  T  4 S+     0   0  105  266   63   IIV TTVIAVVIT V I I  VIVVAVAII TT ATAIITTTTVTAA TTTVATVTAAS T  S VVTT
   369  110 C Y  T  4 S-     0   0   49  266   65   YYH HHYYLHYYL H Y Y  YYHHLHLYY LL LLLYHLLLLHLLL LLLHLLHLLLL L  L YYLL
   370  111 C R    ><  +     0   0   95  266   34   KKK KKKKRKKKR K R R  KHKKRKRKK RR HRHKKRRRRKRHH RRRKRRKRRRR R  R KKRR
   371  112 C I  G >>  +     0   0    0  266    2   III IIIIIIIII I I I  IIIIIIIII II IIIIIIIIIIIII IIIIIIIIIII I  I IIII
   372  113 C A  G 34 S+     0   0    0  266   52   AAA AAAVSAAAS A A A  SAAASASSA SS SSSAASSSSASSS SSSASSASSSS S  S SSSS
   373  114 C E  G <4 S+     0   0   81  266   60   SSS SSSEESRSE S D D  SDSSESESS EE EEEESEEEESEEE EEESEEQEEEE E  E SSEE
   374  115 C W  T <4 S+     0   0    3  266    0   WWW WWWWWWWWW W W W  WWWWWWWWW WW WWWWWWWWWWWWW WWWWWWWWWWW W  W WWWW
   375  116 C A     <  -     0   0    0  266   30   SSS SSSAAASAA S A A  SASSASAAA AA AAASAAAAASAAA AAASAASAASA S  A AAAA
   376  117 C D  S    S+     0   0    8  266   44   HHH DDDDHHHHH H S S  HDHHHHHDH HH HHHDHHHHHHHHH HHHHHHHHHHH H  H HHHH
   377  118 C I  E     +vw 609 666E   0  266    8   III LLILILLII I L L  IIIIIIIII II IIIIIIIIIIIII IIILIIIIIII I  I LLII
   378  119 C T  E     - w   0 667E   0  266   42   TTT TTTVITTTI T T T  TVTTITIIT II VIITTIIIITIVV IIITIITIIIV I  V TTII
   379  120 C N  E     -vw 613 668E   1  266    2   NNN NNNTNNNNN N N N  NNNNNNNNN NN NNNNNNNNNNNNN NNNNNNNNNNN N  N NNNN
   380  121 C A  E     -vw 614 669E   0  266   41   AAA AAAVCAAAC A C C  AAAACACAA CC ACCAACCCCACAA CCCACCACCCC C  C AACC
   381  122 C H    >   -     0   0   37  266   50   HHH HHHHSHHHS H H H  HHHHSHSHH SS TSSHHSSSSHSTT SSSHSSHSAAA S  A HHSS
   382  123 C G  G >  S+     0   0    5  265   79   TTP SSTSVPPLI P I I  PSPPVLVM. VI VIITPIIVVLIVV VIIVVIPIIIV V  V AAII
   383  124 C V  G 3  S+     0   0   99  266   30   VVV VVVVLVVVL V I I  ILVVLVLLL LL LLLVLLLLLVLLL LLLVLLVLLLL L  L VVLL
   384  125 C V  G <  S-     0   0   53  266   52   PPP PPPPPPPPP P P P  PPPPPPPPS PP PPPPPPPPPPPPP PPPPPPPPPPA P  A PPPP
   385  126 C G    X   -     0   0   15  266    1   GGG GGGGGGGGG G G G  GGGGGGGGP GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   386  127 C P  T >> S+     0   0   74  266   64   EEP PPEPEPPEE P P P  PPPPEPEPA EE PEEEPEEEEPEPP EEEPEEPEEES E  S PPEE
   387  128 C G  H 3> S+     0   0   26  266   25   GGS GGGGGGSGG S G G  GGSSGSGGR GG GGGGGGGGGGGGG GGGGGGSGGGG G  G SSGG
   388  129 C I  H <> S+     0   0    0  266   24   III IIIIIIIII V I I  IIVVIVIIH II IIIVIIIIIVIII IIIIIIIIIII I  I IIII
   389  130 C V  H <> S+     0   0    2  266   13   III IIIIVVILV I I I  IIIIVIVIP VV IVVIIVVVVIVII VVVIVVIVVVV V  V IIVV
   390  131 C S  H  X S+     0   0   72  266   72   KKS TTQTESKTE S E E  TSSSESEDD EE DEETTDEEESEDD QEETEEQEQQD E  D TTEE
   391  132 C G  H  X S+     0   0    6  266   30   GGG GGGGAGGGA G G G  GGGGAGAGG AA AAAGGAAAAGAAA AAAGAAGAAAA A  A GGAA
   392  133 C L  H  X S+     0   0    0  266    0   LLL LLLLLLLLL L L L  LLLLLLLLL LL LLLLLLLLLLLLL LLLLLLLLLLL L  L LLLL
   393  134 C K  H  X S+     0   0   54  266   67   AAA AARKAAAAA A R R  SAAAAAAKA AA AASAASAAAAAAA AAAGAAAATTA A  A SSAA
   394  135 C Q  H  X S+     0   0   97  266   56   EES SSESQASSQ A E E  SEAAQKQKS QQ QQKESQQQQKQQQ QQQAQQSQQQQ Q  Q SSQQ
   395  136 C A  H  X S+     0   0    1  266   60   VVV IIVATVVVT V T T  IIVVTVTDV TT VTTVVTTTTVTVV TTTVTTVTTTA T  I IITT
   396  137 C A  H  X S+     0   0    4  266   31   GGG GGGTAGGGA G G G  GGGGAGAIG AA AAAGGAAAAGAAA AAAGAAGAAAA A  S GGAA
   397  138 C E  H  < S+     0   0  134  266   84   LLQ LLLAsRLLs L L L  TLLLsQadL qq sskILssqqQsss qqqKssKskts q  s LLss
   398  139 C E  H  < S+     0   0  125  202   30   ... ...Gd...e . . .  ....d.de. dd ded..dedd.edd ddd.dd.dddd d  g ..dd
   399  140 C V  H  < S+     0   0   51  266   88   ppp pppVfpppd p P P  pPppfpfKp ff fdfPAfdffpdff fffpffpffff f  v ppff
   400  141 C T     <  -     0   0   35  193   67   ... ....g...g . . .  ....g.g.. gg agg..gggg.gaa ggg.gg.gggp g  p ..gg
   401  142 C K  S    S+     0   0  179  212   85   ... ...QP...S . K K  .K..P.P.. SS SSSR.PSSS.SSS SSS.PP.PENA S  A ..PP
   402  143 C E  S    S-     0   0   91  218   33   ... ...SE...E . G G  .Q..E.E.. EE DEEGSEEEE.EDD EEE.EE.EDEG D  G ..EE
   403  144 C P        -     0   0   33  183   56   ggg ggnP.ggg. g . .  g.gg.g..g .. ....G....g... ...g..e...E .  E gg..
   404  145 C R        -     0   0   20  264   15   RRR RRRRRRRRR R N N  RRRRRRRTR RR RRRRRRRRRRRRR RRRNRRRRKRR R  R RRRR
   405  146 C G  E     -w  638   0E   0  266   17   GGG AACGGGGGG G G G  GAGGGGGGG GG GGGGGGGGGGGGG GGGAGGGGGGG G  G GGGG
   406  147 C L  E     -wx 639 699E   0  266    6   LLL LLLILLLLL L L L  LLLLLLLLL LL LLLLLLLLLLLLL LLLLLLLLLLL L  L LLLL
   407  148 C L  E     -wx 640 701E   0  266   11   LLL LLLLLLLLL L L L  ILLLLLLLL LL LLLLLLLLLLLLL LLLILLLLLLL L  L IILL
   408  149 C M  E     -wx 641 702E   0  266   38   LLL LLLLILLLI L L L  LLLLVLILL II IIILLIIIILIII IIILIILIIII I  I LLII
   409  150 C L  E     + x   0 703E   3  266    2   LLL LLLLLLLLL L L L  LLLLLLLLL LL LLLLLLLLLLLLL LLLLLLLLLLL L  L LLLL
   410  151 C A        +     0   0    0  266    8   AAA AAAAAAAAA A A A  AAAAAAAAA AA AAAAAAAAAAAAA AAAAAAAAAAA A  A SSAA
   411  152 C E  S    S-     0   0   24  266   18   EEE NNEEEEEEE E Q Q  EEEEEEEQE EE TEEEEEEEEEETT EEEEEEEEEEE E  E EEEE
   412  153 C L        -     0   0   44  266    7   MMM MMMMMMMMM M M M  MMMMMMMMM MM MMMMMMMMMMMMM MMMMMMMMMMM M  M MMMM
   413  154 C S        +     0   0   78  266   31   SSS SSSSTSSST S S S  SSSSTSTSS TT TTTSSTTTTSTTT TTTSTTSTTTT T  T SSTT
   414  155 C C  S >  S-     0   0   79  266   22   SST SSSSSTTAS T S S  SSTTSSSSA SS SSSSSSSSSSSSS SSSSSSTSSSS S  S SSSS
   415  156 C K  T 3  S+     0   0  214  266   44   KKK KKAAKKKKK K K K  KTKKKEKAK KK KKKKAKKKKAKKK KKKAKKKKKKK K  K KKKK
   416  157 C G  T 3  S+     0   0   68  265    2   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   417  158 C S    <   -     0   0   38  266   49   AAS AATNSSSNS T S S  TNTTSASNN SS SSSTCSSSSASSS SSSNSSASSSS S  S AASS
   418  159 C L        +     0   0  148  266    8   LLL LLLLLLLLL L L L  LLLLLLLLL LL LLLLLLLLLLLLL LLLLLLLLLLL L  L LLLL
   419  160 C A        +     0   0    6  266   41   TTA AAACAAAAA A A A  AFAAATALA AA AAAAAAAAATAAA AAAAAATAAAA A  A TTAA
   420  161 C T    >   -     0   0   55  266   75   KKT TTKPTTTTT R Q Q  STRRTKTQT TT TTTKKTTTTKTTT TTTSTTKTTKT T  T TTTT
   421  162 C G  T 3> S+     0   0   20  266   28   GGG GGGGGGGGG G G G  GEGGGGGTG GG GGGDGGGGGGGGG GGGGGGGGGGG G  G GGGG
   422  163 C E  H 3> S+     0   0   81  266   50   SSA EEDEEATEQ E D D  ADEEEDQDE SA QQESSEQAASQQQ SAAEDQAQTEE A  E SSQQ
   423  164 C Y  H <> S+     0   0   59  265    0   YYY YYYYYYYYY Y Y Y  YYYYYYYYY YY YYYYYYYYYYYYY YYYYYYYYYYY Y  Y YYYY
   424  165 C T  H  > S+     0   0    3  266   18   TTT TTTATTTTT T T T  TKTTTTTTT TT TTTTTTTTTTTTT TTTTTTTTTTT T  T TTTT
   425  166 C K  H  X S+     0   0   78  266   69   TTE KKTRKEEAT D S S  SQDDKQTQA SS ETRVAKTSSQTEE SSSEKTNTTTK S  K EETT
   426  167 C G  H  X S+     0   0   26  266   76   DDA QQTRAADKS D Q Q  QKDDAAATK AA LSAEAASAAASLL AAAKASSSRRL A  L DDSS
   427  168 C T  H  X S+     0   0    2  266   58   SSA TTTTSAANS A A A  ATAASCSTN SS SSSTASSSSCSSS SSSASSASSSS S  S AASS
   428  169 C V  H  X S+     0   0   16  266   12   VVV MMVVVVVVV V V V  VRVVVVVVV VV VVVVVVVVVVVVV VVVVVVVVVVV V  V VVVV
   429  170 C D  H  < S+     0   0   78  266   45   EEQ RREEDRRED R C C  QHRRDDDKE DD EDEEQDDDDDDEE DDDQDDQDDDE D  E RRDD
   430  171 C I  H >< S+     0   0   21  266   63   MMM MMLMYMMAY M L L  MLMMYEYMA II LYYMMHYIIEYLL IIIMYYMYYYM Y  M MMYY
   431  172 C A  H >< S+     0   0    0  265    1   AAA AAAAAAAAA A A A  AAAAAAAAA TA AAAAAAAAAAAAA AAAAAAAAAAA A  A AAAA
   432  173 C K  T 3< S+     0   0   53  266   33   RRR rrRGRRRRR R K K  RERRRhRTR RR RRRRRRRRRKRRR RRRrRRRRRRR R  R RRRR
   433  174 C S  T <  S+     0   0   73  265   75   RRE aaKDKELRK S E E  AQSSKdKAR KK KKKREKKKKKKKK KKKaKKEKRRK K  R SSKK
   434  175 C D    <>  +     0   0   19  266   71   NNN GGYHYHNHY N Y Y  HFNNYTYHH YY YYYHKFYYYDYYY YYYGYYHYYYH Y  H RRYY
   435  176 C K  T  4 S+     0   0   81  266   48   KKR RRKKKRRPK S S S  RSSSKTKNP PP KKKPRKKPPTKKK PPPLKKKKKKA H  A RRKK
   436  177 C D  T  4 S+     0   0   84  266   43   DDG EEDDNDDEK E D D  DDEENGNNE SS GKDEDGKSStKGG SSSDKNDNEKG S  G DDNN
   437  178 C F  T  4 S+     0   0   10  266    7   FFF FFFFFFFFF F F F  FFFFFFFFF FF FFFFFFFFFfFFF FFFWFFFFFFF F  F FFFF
   438  179 C V  E  <  +x  667   0E   1  266    5   VVV VVVVVVVVV V V V  VVVVVVVVV VV VVVVVVVVVVVVV VVVVVVVVVVV V  V VVVV
   439  180 C I  E     -     0   0E   0  265   40   FFI VVVVMVVMM I I I  IIIIMCMMM LL LMLIILMLLCMLL LLLVTMIMMMM L  M VVMM
   440  181 C G  E     -xy 668 718E   0  266    0   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   441  182 C F  E     -xy 669 719E   0  266    0   FFF FFFFFFFFF F F F  FFFFFFFFF FF FFFFFFFFFFFFF FFFFFFFFFFF F  F FFFF
   442  183 C I  E     +xy 670 720E  10  265   12   III IIIIVIIVV I I I  IIIIVIVIV VV VVVIIVVVVIVVV VVVIVVIVVVV V  V IIVV
   443  184 C A        -     0   0    0  265   31   AAA AAASSAAAS A C C  AAAASASSA SS ASSSASSSSASAA SSSASSASCCA S  A AASS
   444  185 C Q  S    S+     0   0   34  266   53   qqq qqmqtqqmt q q q  mQqqtmtrm tt sttqmttttmtss tttmttqtnnt t  t qqtt
   445  186 C R  S    S-     0   0  111  266   66   kkp rrrraspvp k k k  eRkkqrrkv ee kpkhkppeerpkk eeerapppqkr a  k eepp
   446  187 C D        -     0   0   41  192   77   MMg ..Y...D.. . . .  s...sEs.. ee ...sas.eee... eteV..g.t.. .  . AA..
   447  188 C M        -     0   0   20  204   82   NNV VVEP..EA. . . .  T...SRA.A AA ...DDV.AAR... AEAD..V.T.. .  . DD..
   448  189 C G        +     0   0   25  210   61   QQN DDDE.VDP. . L L  D...AAPLP PP ...GPA.PPE... PAPK..D.A.. .  . DD..
   449  190 C G    > > +     0   0    6  236   63   YYV AAKTSDVGS . T T  L...SNSSG AA AS.AGSSAAGSAA APAASSTSTSK .  . VVSS
   450  191 C R  G > 5S+     0   0  123  254   81   DDE GGEIEPTEE P E E  AKLPETDDE QQ DEERADEQQPEDD QAQDEDTDAEA D  A TTDD
   451  192 C D  G 3 5S+     0   0  160  266   42   DDD EEGTDEDGE D D D  NLDDDHEDG GG DEEPVEEGGNEDD GSGDDEDEDDD G  D EEEE
   452  193 C E  G < 5S-     0   0  108  266   30   EEE DDDDEEEAE E P P  ETEEEREPA EE EEGEEEEEETEEE EEEPEEEEEEE E  E EEEE
   453  194 C G  T < 5S+     0   0   55  266   45   DDD GGDEDDDDD D R R  DEDDDDDGD DD DDDDDDDDDEDDD DDDDDDDDDDD D  D DDDD
   454  195 C Y      < -     0   0   50  266   25   FFF DDFYFFFYF F F F  FhFFFLFMY FF FFFFFFFFFRFFF FFFFFFFFFFF F  F FFFF
   455  196 C D        -     0   0   39  116    5   ... ......... . . .  .g....... .. .........D... ........... .  . ....
   456  197 C W        -     0   0   10  123    9   ... WW....... . . .  .W....... .. .........L... ........... .  . ....
   457  198 C L  E     -y  701   0E   0  266   29   IIL LLILVLLVV L I I  LILLVLVIV VV VVILLVVVVLVVV VVVLVVLVVVV V  V LLVV
   458  199 C I  E     -y  702   0E   2  266   51   VVV IIYVVIVIV I H H  IYIIVIVHI VV LVVVIVVVVIVLL VVVVVVIVVVL V  L VVVV
   459  200 C M  E     -yz 703 739E   0  266   26   MML MMMLFLLMF L M M  LLLLFLFMM FF FFFLMFFFFLFFF FFFIFFLFFFF F  F LLFF
   460  201 C T  E     - z   0 740E   0  266   13   SST SSTTTTTTT T T T  TTTTTTTTT TT TTTSTTTTTTTTT TTTTTTTTTTT T  T AATT
   461  202 C P        +     0   0   28  266   31   PPP PPPPTPPPT P P P  PPPPTPTPP TT TTTPPTTTTPTTT TTTPTTPTTTT T  T PPTT
   462  203 C G  S    S+     0   0   54  266    0   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   463  204 C V              0   0   12  266   14   VVV VVVVVVVVV V I I  VVVVVVVVV VV VVVVVVVVVVVVV VVVVVVVVVVV V  V VVVV
   464  205 C G              0   0   61  266   52   ggg gggsngggn g k k  gqggngnqg nn nnnggnnnngnnn nnngnngnnnn n  n ggnn
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54   rrr rrkaqrrrq r n n  rirrqrqlr qq qqqrrqqqqrqqq qqqrqqrqqqq q  q rrqq
   467  219 C T     >  -     0   0   79  264    8   TTT TTHTTTTTT T T T  TTTTTTTTT TT TTTTTTTTTTTTT TTTTTTTTTTT T  T TTTT
   468  220 C V  H  > S+     0   0   11  264   49   PPP PPPPPPPPP P P P  PPPPPPPPP PP PPPPPPPPPPPPP PPPPPPPPPPP P  P PPPP
   469  221 C D  H  > S+     0   0   79  265   63   RRK KKRQAKEDE D E E  RSDDADEDD QQ EEQDHEEQQDEEE QQQHEGRGQQE Q  E RRGA
   470  222 C D  H  > S+     0   0   59  265   63   EEQ EEENSEEES E K K  EDEESQSHE SS SSSQASSSSQSSS SSSESSQSSSS S  S EESS
   471  223 C V  H  X>S+     0   0    0  265   45   VVV VVVAAVVVA V I I  VAVVAVAVV AA AAAVAAAAAVAAA AAAVAAVAAAA A  A VVAA
   472  224 C V  H ><5S+     0   0    0  265   19   IIV VVVIIIIIV I L L  VIIIIIIII IV IVVVVIVIIIVII IVVVIIVIVVI I  V VVII
   473  225 C S  H 3<5S+     0   0   52  266   85   VVQ RRYEGTLRG R S S  LLRRGRGNR GG GGGYYGGGGRGGG GGGYGGLGAAG D  G LLGG
   474  226 C T  H 3<5S-     0   0   59  266   80   eee dddRRedeR q i i  eqqqReRhe RR GRRqeRRRReRGG RRRdRReRRRR R  R eeRR
   475  227 C G  T <<5S+     0   0    8  266    4   ggg gggNGgggG g g g  geggGgGgg GG GGGggGGGGgGGG GGGgGGgGGGG G  G ggGG
   476  228 C S      < -     0   0    0  266   60   AAC AACSACCCA C S S  CTCCACANC AA AAAASAAAACAAA AAACAACAAAA A  A CCAA
   477  229 C D  S    S+     0   0    0  266    0   DDD DDDDDDDDD D D D  DDDDDDDDD DD DDDDDDDDDDDDD DDDDDDDDDDD D  D DDDD
   478  230 C I  E     - z   0 720E   0  266   33   VVV VVVIFVVVF V I I  VIVVFVFIV FF FFFVIFFFFVFFF FFFVFFVFFFF F  F VVFF
   479  231 C I  E     -sz 552 721E   0  266   11   III IIIIIIIII I M M  IIIIIIIII II IIIIIIIIIIIII IIIIIIIIIII I  I IIII
   480  232 C I  E     -s  553   0E   7  266    0   III IIIIIIIII I I I  IIIIIIIII II IIIIIIIIIIIII IIIIIIIIIII I  I IIII
   481  233 C V  E     +s  554   0E   2  266   36   VVV VVVVAVVVA V V V  VVVVAVAVV SS SAAVVAASSVASS SSSVAAVAASS A  S VVAA
   482  234 C G    >   +     0   0   22  266    0   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   483  235 C R  T 3> S+     0   0  121  266    0   RRR RRRRRRRRR R R R  RRRRRRRRR RR RRRRRRRRRRRRR RRRRRRRRRRR R  R RRRR
   484  236 C G  T 34 S+     0   0   21  266    0   GGG GGGGGGGGG G G G  GGGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   485  237 C L  T <4 S+     0   0    0  266   26   III IIIIIIVII V I I  IIVVIIIII II IIIIIIIIIIIII IIIIIIIIIII I  I IIII
   486  238 C F  T  4 S+     0   0   27  266   29   YYY YYYYYYYYY Y T A  YIYYYYYYY YY YYYYYYYYYYYYY YYYYYYYYYYY Y  Y YYYY
   487  239 C A  S >< S+     0   0   10  266   52   GGg ggGGAgggA g E E  gKggAgADg AA AAAggAAAAgAAA AAAKAAgAAAA A  A ggAA
   488  240 C K  T 3  S-     0   0  178  164   62   QQk ggK..dap. d . .  n.dd.a..p .. ...sd....a... ...N..a.... .  . dd..
   489  241 C G  T 3  S+     0   0   83  266   55   PPV EEGAAVTNA V A A  DAVVAFADN AA AAVNVAAAAFAAA AAAKAAVAAAA A  A VVAA
   490  242 C R    <   -     0   0  111  266   76   DDE EERAPQAEP E K K  AKEEPAASE AA PPEQEPPAADPPP AAADPPDPPPP P  P EEPP
   491  243 C D     >  -     0   0   96  266   30   KKE AADDDAAED A D D  DDAADKDQE DD DDNAEDDDDKDDD DDDADDVDDDD D  D NNDD
   492  244 C A  H  > S+     0   0    8  266   56   LLI VVPIPVIIP I P P  IPIIPVPPI PP PPPIMPPPPVPPP PPPVPPIPPPP P  P VVPP
   493  245 C K  H  > S+     0   0   83  265   82   VVR KKAAVQVVV R S S  QLRRVSVLV VV VVVIKVVVVRVVV VVVAVVAVVVV V  V RRVV
   494  246 C V  H  > S+     0   0   81  265   81   EER AAKGEAAKE Q K K  AQQQEEEKK EE DEEAREEEEQEDD EEESEQAQEEE E  E KKQQ
   495  247 C E  H  X S+     0   0   22  265   50   QQQ EEETAQRQA R E E  QERRAQAMQ AA AAAQQAAAAQAAA AAAEAARAAAA A  A QQAA
   496  248 C G  H  X S+     0   0    0  265   42   AAA AAATAAACA A A A  AAAAAGVAC AA AAAAAAAVVGAAA AAAAAAAAVVI A  I AAAA
   497  249 C E  H  X S+     0   0   67  265   58   QQE EEKMREEKK E E E  EKEEQEQQK KK RKKIEKKKKSKRR KKKKQQEQKKK K  K EEQQ
   498  250 C R  H  X S+     0   0  141  265   28   RRR RRRERRRRR R R R  RHRRRRRSR QQ RQQRRQQQQRQRR QQQRRQRQQRQ Q  Q RRQQ
   499  251 C Y  H  X S+     0   0   20  265    0   YYY YYYYYYYYY Y Y Y  YYYYYYYYY YY YYYYYYYYYYYYY YYYYYYYYYYY Y  Y YYYY
   500  252 C R  H  X S+     0   0   41  265   36   RRQ RRQKQRMQQ R R R  RRRRQKQRQ QQ QQQKRQQQQKQQQ QQQQQQMQRQQ Q  Q RRQQ
   501  253 C K  H  X S+     0   0  101  265   61   QQA EEEQKAAEK Q K K  KNQQKTKHE QQ KKKQQRKQQKKKK QQQEKKTKEEK Q  S QQKK
   502  254 C A  H  X S+     0   0   28  265   48   AAA EEAAEEEAE E E E  EIEEEAEAA QQ AEEAAAEQQAEAA QQQAEEEEQQA Q  A EEEE
   503  255 C G  H  X S+     0   0    0  265   15   GGG GGGGGGGGG G G G  GAGGGGGGG GG GGGGGGGGGGGGG GGGGGGGGGGG G  G GGGG
   504  256 C W  H  X S+     0   0   22  265    0   WWW WWWWWWWWW W W W  WWWWWWWWW WW WWWWWWWWWWWWW WWWWWWWWWWW W  W WWWW
   505  257 C E  H  X S+     0   0   86  265   62   DDA KKNQEAAKD D K K  ADDDEDEQK EE DDEEEEDEEEDDD EEEKDEAEKND E  S SSEE
   506  258 C A  H  X S+     0   0    2  265    2   AAA AAAAAAAAA A A A  AAAAAAAAA AA AAAAAAAAAAAAA AAAAAAAAAAA A  A AAAA
   507  259 C Y  H  < S+     0   0   25  262    0   YYY YYYYYYYYY Y      YYYYYYYYY YY YYYYYYYYYYYYY YYYYYYYYYYY Y  Y YYYY
   508  260 C L  H  < S+     0   0  108  258   55   LLI EELLMLLEL L      E LLMLLLE LL LLLLLTLLLLLLL LLLEMLQLLLL L  L LLLL
   509  261 C R  H  < S+     0   0  136  258   68   EEE EEEDAARDK K      E KKAKKKD AA KKAKSAKAAAKKK AAADAAEAEEK A  K EEAA
   510  262 C R  S  < S-     0   0   31  254    5   RRR RRRKRRRRR R      R RRRRRRR RR RRRRRRRRRRRRR RRRRRRRRRRR R  R RRRR
   511  263 C C        -     0   0   48  210   53     V   IHVI  V        I   VIV   VV VVT  VVVVLVVV VVV VVIVVVV V  I VVVV
   512  264 C G        -     0   0   35  164   41     N   SPG   G        S    GG   GG GGG  AGGGGGGG GGG GGAGGGS G  S SSGG
   513  265 C Q              0   0  142  129   68         KRG   A        V    QG   AA RAQ   AAAQARR AAA GG GQ K G  R   GG
   514  266 C Q              0   0  185   69   46          EK   Q        Q    KN   QQ  Q    QQQKQ   QQQ KK N    Q      NN
## ALIGNMENTS  421 -  490
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    3 A K              0   0   88  128   55                                    TTTKKTTTT TK    TKT KTK KKK TKKK KKQ
     2    4 A A        -     0   0   48  149   71                                    QQSAAQSSSQSA    SAQ ASA AAQ QQAA AAT
     3    5 A T     >  -     0   0   57  246   38                P                   SSSTTSTTTPST    TTT TTT TTSTTSTT TTP
     4    6 A Y  H  > S+     0   0    0  278    1                Y                   YYYFYYYYYYYY    YYY FYF YYFYFFFF FFY
     5    7 A K  H  > S+     0   0  120  278   72                S                   IIRAAIRRRSRA    RAR ARA AAANAAAA AAE
     6    8 A E  H  > S+     0   0  109  278   63                A                   EEAESKAAAEAS    ASE STS SSEEEERS SSE
     7    9 A R  H >X S+     0   0    6  278    0                R                   RRRRRRRRRRRR    RRR RRR RRRRRRRR RRR
     8   10 A A  H 3< S+     0   0    7  278   23                A                   AAAAAAAAAAAA    AAA SAA AAVSAVAA AAQ
     9   11 A A  H 3< S+     0   0   88  279   72                A                   llaAAlsssKaQ    gQf EsE QQEeEEEE EES
    10   12 A T  H << S+     0   0  114  278   80                S                   pppTTppssTpS    pSp TpS TTSsKSST TT.
    11   13 A H     <  -     0   0   22  279   56                H                   EETAADSSSATA    TAG ASA AASNASAV VA.
    12   14 A P  S    S+     0   0   62  280   63                P                   TTTATTAAATTT    TTT TTS TTTNTTGS STA
    13   15 A S     >  -     0   0    1  281   63                H                   SSGHHSGGGHGH    GHS HNH HHHTHHHH HHH
    14   16 A P  H  > S+     0   0   79  281   27                P                   PHPPPPPPPPPP    PPP PPP PPPPPPPP PPP
    15   17 A V  H  > S+     0   0    0  283   52                V                   LLLLLLLLLLLL    LLL LLL LLLLLLLL LLL
    16   18 A A  H  > S+     0   0    0  283   37                A                   TTANNAAAASAN    ANA NAT NNTATTTS STS
    17   19 A A  H  X S+     0   0   18  283   69                K                   AASAAASSSRSA    SAA RAA AASSRSAR RTA
    18   20 A K  H  X S+     0   0   72  283   81                K                   YYYYYYYYYYYY    YYY HYY YYYYYYYH HYY
    19   21 A L  H  X S+     0   0    0  283    2                L                   LLLLLLLLLLLL    LLL LLL LLLLLLLL LLL
    20   22 A F  H  X S+     0   0    0  283   14                F                   LLLFFLLLLFLF    LFL FLL FFFLFFLY YLY
    21   23 A N  H  X S+     0   0   58  283   71                R                   RRRKKRSSSRRK    SKR KRR KKRRRRRK KRR
    22   24 A I  H  X S+     0   0    3  283   39                I                   LLLLLLLLLLLL    LLL LLL LLLLLLLL LLL
    23   25 A M  H  X>S+     0   0    0  284   48                A                   IIVMMIMIIMVM    VMI MIM MMMAMMMM MMM
    24   26 A H  H ><5S+     0   0   74  284   50                D                   AASDDAAAADSD    ADA DSD DDEHEEDD DDV
    25   27 A E  H 3<5S+     0   0  127  284   87                S                   IIILLIAAALIL    VLI LIL LLVLLVLL LLV
    26   28 A K  H 3<5S-     0   0   39  284    0                K                   KKKKKKKKKKKK    KKK KKK KKKKKKKK KKK
    27   29 A Q  T <<5 +     0   0  110  284   53                R                   RRQAARQQQAQA    QAR AQA AAQRQQAA AAE
    28   30 A T      < +     0   0    0  284   41                S                   TTTSSTTTTSTS    TST STS SSSTSSSS SSS
    29   31 A N        +     0   0    0  284    0                N                   NNNNNNNNNNNN    NNN NNN NNNNNNNN NNN
    30   32 A L  E     -a  229   0A   0  284   14                L                   LLLLLLLLLLLL    LLL LLL LLLLLLLL LLL
    31   33 A C  E     -ab 230  55A   0  284   42                I                   CCCCCCCCCCCC    CCC CCC CCCCCCCC CCC
    32   34 A A  E     -ab 231  56A   0  283   58                I                   LLLLLLLLLLLL    LLL LLL LLLVLLLL LLL
    33   35 A S  E     - b   0  57A  15  284    9                S                   SSSSSSSSSSSS    SSS SSS SSSSSSSS SSS
    34   36 A L        +     0   0    3  284   60                A                   AAAAAAAAAAAA    AAA AAA AAAAAAAA AAA
    35   37 A D        +     0   0   42  284    0                D                   DDDDDDDDDDDD    DDD DDD DDDDDDDD DDD
    36   38 A V        -     0   0    8  284    9                F                   VVVVVVVVVVVV    VVV VVV VVVVVVVV VVV
    37   39 A R  S    S+     0   0  162  284   66                T                   TTEAATEEETEA    EAS AEP TTETTEAA APS
    38   40 A T     >  -     0   0   42  284   42                D                   TTTTTTTTTTTT    TTT TTT TTHTTHTT TTS
    39   41 A T  H  > S+     0   0    4  284   55                T                   TTSAATSSSASA    SAT ASA AAATAAAA AAA
    40   42 A K  H  > S+     0   0  115  284   69                D                   QQAHRAAAARAR    ARA RAR RRRARRRR RRR
    41   43 A E  H  > S+     0   0   74  284   28                S                   AAEEEREEEEEE    EEE EEE EEDEGDEE EET
    42   44 A L  H  X S+     0   0    4  284   11                L                   LLLLLLLLLLLL    LLL LLL LLLLLLLL LLL
    43   45 A L  H  X S+     0   0   40  284    4                L                   LLLLLLLLLLIL    LLL LLL IILLLLLL LLL
    44   46 A E  H  X S+     0   0  112  284   81                K                   SSQYYAQQQAQY    QYA YAH YYASAAYY YYR
    45   47 A L  H  X S+     0   0   19  284   26                C                   LLLFFLLLLLLF    IFV FLL VVLIILLF FLL
    46   48 A V  H  X S+     0   0    0  283   55                A                   AAAAAAAAAAAA    AAA AAA AAAAAAAA AAA
    47   49 A E  H  < S+     0   0   79  284   22                D                   DEEDDEEEEDED    EDE DED DDDEDDDD DDN
    48   50 A A  H  < S+     0   0   24  284   75                g                   EEDRKEEEERDK    EKE KDK KKEDKEKK KKS
    49   51 A L  H >X S+     0   0    0  282   33                l                   VVVIIVVVVVVL    VLV IVI LLVVVVVI IVI
    50   52 A G  G >< S+     0   0    0  282    3                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
    51   53 A P  G 34 S+     0   0   50  284   18                P                   DDDPPDDDDPDP    DPD PDP PPPEPPPP PPP
    52   54 A K  G <4 S+     0   0   45  284   77                Y                   SSSAASSSSSSS    YSS SSS SSSHYSSS SSS
    53   55 A I    <<  -     0   0    0  284   14                I                   IIIIIIIIIIII    III III IIIIIIII III
    54   56 A C  S    S+     0   0    1  283   49                A                   CCCVVCCCCVCV    CVC VCV VVVCVVVV VVV
    55   57 A L  E     -bc  31  85A   0  283   32                V                   LLLVVLLLLVLV    LVV VVV VVVVVVVV VVV
    56   58 A L  E     -bc  32  86A   1  283   30                F                   LLLLLLLLLLLL    LLL LLL LLLLLLLL LLL
    57   59 A K  E     -bc  33  87A  20  283    2                K                   KKKKKKKKKKKK    KKK KKK KKKKKKKK KKK
    58   60 A T  E     - c   0  88A   2  281    3                T                   TTTTTTTTTTTT    TTT TTT TTTTTTTT TTT
    59   61 A H    >>  +     0   0   18  281    2                H                   HHHHHHHHHHHH    HHH HHH HHHHHHHH HHH
    60   62 A V  G >4  +     0   0    2  283   49                V                   AACHHACCCYCY    CYA HCH YYYAYYHY YHY
    61   63 A D  G 34 S+     0   0   18  283    2                D                   DDDDDDDDDDDD    DDD DDD DDDDDDDD DDD
    62   64 A I  G <4 S+     0   0   15  283   18                I                   IIIMMIIIILIM    IMI MII MMLILLIM MII
    63   65 A L    <<  -     0   0   15  284   28                I                   IIVVVVVVVIVV    VVI VVV VVIIIIVV VVV
    64   66 A T  S    S+     0   0   99  284   65                H                   SSTssSTTTsTs    TsN sTa sstSstaa aas
    65   67 A D  S    S+     0   0   33  284    1                D                   DDDddDDDDdDd    DdD dDd dddDdddd ddd
    66   68 A F        +     0   0   29  284    6                F                   FFWFFFWWWYWF    WFF FWY FFYFYYYF FFV
    67   69 A S     >> -     0   0   39  279   61                S                   NNSHHSSSSNSH    THG DSN HHHGNHND DNE
    68   70 A M  I  4>S+     0   0   38  283   97                D                   DDDppDDDDpDp    DpD pDp pppEpppp ppT
    69   71 A E  I  45S+     0   0  109  157   60                .                   ...rh....t.t    .t. t.t ttt.tttt tt.
    70   72 A G  I  45S+     0   0   16  283   60                K                   RRRGGRRRRGRG    RGR GRG GGGRGGGG GGG
    71   73 A T  I  X5S+     0   0    2  283   43                T                   TTTTTTTTTTTT    TTT TTT TTTTTTTT TTT
    72   74 A V  I  > S+     0   0   37  284   73                G                   QQAKKGAAAKAK    AKG RAR KKKGKKKK KKQ
    75   77 A L  H  X S+     0   0    2  284    1                L                   LLLLLLLLLLLL    LLL LLL LLLLLLLL LLL
    76   78 A K  H  X S+     0   0   64  283   80                K                   RRRAARRRRARA    RAR AKA AAANAAAA AGA
    77   79 A A  H  X S+     0   0   60  284   64                E                   DDEAADEEEAES    ESD AEA SSAEAAAS SAA
    78   80 A L  H  X S+     0   0   14  284   11                L                   IIVLLIVVVLVL    ILI LII LLLILLIL LLL
    79   81 A S  H  X>S+     0   0   14  284   35                A                   AAAAAAAAAAAA    AAA AAA AAASAAAA AAA
    80   82 A A  H  <5S+     0   0   81  284   70                A                   KKKRRKAAARKR    QRR RRR RRRRRRRR RRA
    81   83 A K  H  <5S+     0   0  142  284   20                K                   RRRRRRRRRKRR    RRR KRK RRKRKKKK KKK
    82   84 A Y  H  <5S-     0   0   52  284   36                H                   KKKHHKKKKHKH    KHK HKH HHHKHHHH HHH
    83   85 A N  T  <5 +     0   0   64  284   57                D                   RKYGGRSSSGCG    RGR GWG GGGKGGGG GGG
    84   86 A F      < -     0   0    3  284    0                F                   FFFFFFFFFFFF    FFF FFF FFFFFFFF FFF
    85   87 A L  E     -c   55   0A   8  284   10                L                   LLLLLLLLLLLL    LLL LIL LLLLLLLL LLL
    86   88 A L  E     -c   56   0A   0  284   12                I                   VVIIIVIIIIII    III III IIIVIIII III
    87   89 A F  E     -cd  57 116A   0  284    0                F                   FFFFFFFFFFFF    FFF FFF FFFFFFFF FFF
    88   90 A E  E     -c   58   0A   0  284    0                E                   EEEEEEEEEEEE    EEE EEE EEEEEEEE EEE
    89   91 A N  E     +     0   0A   4  284    0                D                   DDDDDDDDDDDD    DDD DDD DDDDDDDD DDD
    90   92 A R  E     -     0   0A  40  284    0                R                   RRRRRRRRRRRR    RRR RRR RRRRRRRR RRR
    91   93 A K  E     - d   0 118A  36  284    0                K                   KKKKKKKKKKKK    KKK KKK KKKKKKKK KKK
    92   94 A F  E     + d   0 119A   4  284    0                F                   FFFFFFFFFFFF    FFF FFF FFFFFFFF FFF
    93   95 A A        +     0   0    6  283   47                V                   GGAGGGAAAVAA    AAG GAG GGVGVVGG GGS
    94   96 A D        -     0   0   13  283    0                D                   DDDDDEDDDDDD    DDD DDD DDDDDDDD DDD
    95   97 A I    >>  +     0   0   57  283    1                I                   IIIIIIIIIIII    III III IIIIIIII III
    96   98 A G  H 3> S-     0   0   37  283    0                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
    97   99 A N  H 3> S+     0   0  113  283   28                T                   EEENNEEEEKEN    ENE NEN NNSNKSNN NNS
    98  100 A T  H <> S+     0   0   17  283    1                T                   TTTTTITTTTTT    TTT TTT TTTTTTTT TTT
    99  101 A V  H  X S+     0   0    0  283    3                V                   VVVVVIVVVVVV    VVV VVV VVVVVVVV VVV
   100  102 A K  H  X S+     0   0   21  283   59                Q                   QQQEEQQQQQQE    QEQ EQQ EEQQQQQE EQQ
   101  103 A L  H  X S+     0   0   63  283   75                K                   KKKLLKKKKMKL    KLK LKM MMKQMKML LMK
   102  104 A Q  H  < S+     0   0   28  283    0                Q                   QQQQQQQQQQQQ    QQQ QQQ QQQQQQQQ QQQ
   103  105 A Y  H  < S+     0   0    0  284    0                Y                   YYYYYYYYYYYY    YYY YYY YYYYYYYY YYY
   104  106 A S  H  < S+     0   0   26  284   77                H                   TTTTTTTTTTTI    TIT TTV IITVTTVT TVT
   105  107 A A     X  +     0   0   38  284   52                G                   GGSSSGSSSASG    SGA SSA GGAGAAAS SAD
   106  108 A G  T  4 S-     0   0   47  284    0                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
   107  109 A V  T  4 S+     0   0   67  284   67                A                   PPHSSPHHHTHS    HSP AYS SSTPTTSA ASP
   108  110 A Y  T  4 S-     0   0   37  284   72                L                   LLHAALHHHAHA    YAL AHA AAALAAAA AAG
   109  111 A R    ><  -     0   0   93  284   34                R                   AARRRARRRRRR    RRR RRR RRRTRRRR RRK
   110  112 A I  G >> S+     0   0    1  284    2                I                   IIIIIIIIIIII    III III IIIIIIII IIA
   111  113 A A  G 34 S+     0   0    0  284   58                S                   AAAIIAAAAIAI    AIS IAI IIVVIVII IVV
   112  114 A E  G <4 S+     0   0   71  284   59                E                   RRLEERLLLELE    LEL ESE EEERDEEE EEE
   113  115 A W  T <4 S+     0   0    2  284    0                W                   WWWWWWWWWWWW    WWW WWW WWWWWWWW WWW
   114  116 A A     <  -     0   0    0  284   29                A                   AAAAAAAAAAAA    AAA AAA AAAAAAAA AAA
   115  117 A D  S    S+     0   0   10  284   44                D                   EEEHHEEEEHEH    EHD HEH HHHPHHHH HHH
   116  118 A I  E     +de  87 144A   0  284    8                I                   IIIIIIIIIIII    III ILI IIIIIIII III
   117  119 A T  E     - e   0 145A   0  284   42                V                   VTTVVTTTTTTV    TVT VTT VVTVTTTV VIT
   118  120 A N  E     -de  91 146A   0  284    3                N                   NNNNNSNNNNNN    NNN NNN NNNNNNNN NNN
   119  121 A A  E     -de  92 147A   0  284   46                V                   AAAVVAAAAAAV    AVA VAV VVACAAVV VVA
   120  122 A H        -     0   0    0  284   53                S                   HHHNNHHHHNHN    HNH NHN NNDHNDNN NNH
   121  123 A G  S >  S+     0   0    0  283   80                L                   IIVMMIIVVIVM    VMI MLM MMIIIIMM MMI
   122  124 A V  T 3  S+     0   0    0  284   33                L                   FFLVVFLLLDLV    LVF VLV VVHFDHVV VVL
   123  125 A V  T 3  S-     0   0    4  284   51                G                   PPPPPPPPPAPP    PPP PPP PPAPAAPP PPP
   124  126 A G    X   -     0   0    0  284    1                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
   125  127 A P  T >> S+     0   0   44  284   67                D                   PPPKKPPPPKPK    PKP KPK KKEPKEKK KKA
   126  128 A G  H 3> S+     0   0   25  284   30                G                   AAAAAAAAADAA    AAA AAA AAAADAAA AAA
   127  129 A I  H <> S+     0   0    0  284   36                V                   IIISSVIIIMIS    ISI SIA SSMIMMAS SAI
   128  130 A V  H <> S+     0   0    2  284   13                V                   VVVVVLVVVVVV    VVV VVV VVVIVVVV VVV
   129  131 A S  H  X S+     0   0   71  284   73                D                   SSTTTTTTTRTT    TTR TTT TTSTRSTT TTS
   130  132 A G  H  X S+     0   0    7  284   35                A                   SSASSSAAAAAS    ASA SAA SSAAAAAS SSA
   131  133 A L  H  X S+     0   0    0  284    1                L                   LLLLLLLLLMLL    LLL LLL LLMLLMLL LLL
   132  134 A K  H  X S+     0   0   50  284   66                E                   KKEAAKEEEAEA    EAK SHA EAASAAAA AAA
   133  135 A Q  H  X S+     0   0   93  284   56                Q                   DEKNNEKKKEKN    KNE NKE NNQQEQEH HED
   134  136 A A  H  X S+     0   0    0  284   57                V                   AAAAAAAAAAAA    AAA AAA AAAAAAAA AAA
   135  137 A A  H  X S+     0   0    6  284   28                I                   ASAAAAAAAAAA    AAA AAA AAAAAAAA AAA
   136  138 A E  H  < S+     0   0  132  284   84                s                   ssessaeeeaet    eta aaa ttqqaqan nas
   137  139 A E  H  < S+     0   0  129  222   34                e                   eeeeeeeeeeee    eed eee eeedeeed dee
   138  140 A V  H  < S+     0   0   49  284   90                t                   rrdeekdddeeE    nEg eee EEeseeAe eeA
   139  141 A T     <  -     0   0   33  208   67                r                   sssppsnnnps.    n.d pnp ..pgppPp ppP
   140  142 A K  S    S+     0   0  181  232   87                S                   TTLLLTLLLMLA    LAR IVM AALDALMI IML
   141  143 A E  S    S-     0   0   78  236   37                E                   ppdEEpdddDdp    dpD EDD ppDDDDDE EDD
   142  144 A P        -     0   0   37  195   61                .                   lla..laaa.aa    aa. ... tt.P.... ...
   143  145 A R        -     0   0   15  282   12                R                   RRTRRRTTTRTR    AR. R.R RRRERRRR RRR
   144  146 A G  E     -e  116   0A   0  284   15                G                   AAEGGGEEEGEG    EGG GKG GGGTGGGG GGG
   145  147 A L  E     -ef 117 177A   0  284    4                L                   LLLLLLLLLLLL    LLM LAL LLLLLLLL LLL
   146  148 A L  E     -ef 118 179A   0  284    8                L                   LLVLLLIIILVL    LLL LTL LLLDLLLL LLL
   147  149 A M  E     -ef 119 180A   0  284   38                L                   LLHIILRRRLHI    RIE IMI IIIHLIII IIL
   148  150 A L  E     + f   0 181A   3  284    1                L                   LLLLLLLLLLLL    LLR LLL LLLLLLLL LLL
   149  151 A A        +     0   0    0  284    7                A                   AAgAAAgggAgA    gAl AaA AAAgAAAA AAA
   150  152 A E  S    S-     0   0   27  283   23                E                   EEeQQ.eeeQeQ    eQe QeQ QQQqQQQQ QQQ
   151  153 A L        -     0   0   23  283    7                M                   MMMMM.MMMMMM    MMM MMM MMMMMMMM MMM
   152  154 A S        +     0   0   75  283   27                T                   SSSSS.SSSSSS    SSS SSS SSSSSSSS SSS
   153  155 A C  S >  S-     0   0   28  284   20                T                   SSSSSESSSSSS    SSS SSS SSSSSSSS SSS
   154  156 A K  T 3  S+     0   0  188  284   47                A                   AAAEQMEEEKAA    AAE QEA AAKAKKAE EAA
   155  157 A G  T 3  S+     0   0   44  283    1                G                   GGGGGGGGGGGG    GGG GGG GGGNGGGG GGG
   156  158 A S    <   -     0   0   36  284   53                S                   NNHNNNHHHCHN    HNN NHN NNCNCCNN NNN
   157  159 A L        +     0   0   20  284   10                L                   LLLFFLLLLLLF    LFL FLF FFLFLLFF FFL
   158  160 A A        +     0   0   18  284   49                A                   MLMMMLMMMMMM    MML MMM MMMFMMMM MML
   159  161 A T     >  -     0   0   66  284   73                V                   TTTNNATTTTTN    TNT NTN NNDTTDNN NND
   160  162 A G  H  > S+     0   0   48  284   37                G                   GGPKKGPPPKPK    PKG KPK KKGPRGKK KKE
   161  163 A E  H  > S+     0   0  123  284   48                E                   AAEEESEEEDEE    EES EEE EEKEEKEE EEA
   162  164 A Y  H  > S+     0   0    9  283    0                Y                   YYYYYYYYYYYY    YYY YYY YYYYYYYY YYY
   163  165 A T  H  X S+     0   0    3  284   16                T                   TTQTTTQQQTQT    QTT TTT TTTTTTTT TTA
   164  166 A K  H  X S+     0   0  112  284   70                Q                   EEKQQQKKKQKQ    KQE QQQ QQWTQWQQ QQK
   165  167 A G  H  X S+     0   0   13  284   74                R                   QKEAAQTTTAEA    EAQ AKA AAEAAEAA AAA
   166  168 A T  H  X S+     0   0    0  284   59                C                   CCTCCCTTTCTC    TCC CTC CCCCCCCC CCC
   167  169 A V  H  X S+     0   0   15  284   12                V                   VVVVVVVVVVVV    VVV VVV VVVLVVVV VVV
   168  170 A D  H  X S+     0   0   84  284   43                D                   EEKEEEQQQEKE    EEA EEE EEKHEKEE EEE
   169  171 A I  H >< S+     0   0    9  284   69                V                   IVIAAIIIIAIA    IAI AVA AAAHAAAA AAI
   170  172 A A  H >< S+     0   0    0  283    1                A                   AAAAAAAAAAAA    AAA AAA AAAAAAAA AAA
   171  173 A K  H 3< S+     0   0   51  284   31                r                   RRRRRRRRRRRR    RRR RRR RRRRRRRR RRR
   172  174 A S  T << S+     0   0   75  283   74                k                   EEDEEQSSSEDE    KEE ENE EEKEDKEE EEN
   173  175 A D    <>  +     0   0   26  284   68                G                   HHHHHHHHHHHH    NHH HNN HHNNHNNH HHN
   174  176 A K  T  4 S+     0   0   75  284   44                M                   KKRKKKRRRKRK    RKR KRK RRKKRKKK KKK
   175  177 A D  T  4 S+     0   0   90  284   44                g                   DDDDDEDDDDDD    EDE SEN DDGDDGDS SSD
   176  178 A F  T  4 S+     0   0    8  284    5                a                   FFFFFFFFFFFF    FFF FFF FFFFFFFF FFF
   177  179 A V  E  <  +f  145   0A   1  284    4                V                   VVVVVVVVVVVV    VVV VVV VVVVVVVV VVV
   178  180 A I  E     -     0   0A   0  283   40                M                   MMMMIMMMMMMM    MMM IMM MMMMMMMM MMM
   179  181 A G  E     -fg 146 196A   0  284    0                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
   180  182 A F  E     -fg 147 197A   0  284    0                F                   FFFFFFFFFYFF    FFF FFF FFYFFYFF FFF
   181  183 A I  E     +fg 148 198A  10  283   12                V                   IIIVVIIIIVIV    IVI VIV VVVIVVVI IVI
   182  184 A A        -     0   0    0  283   33                A                   AAASSAAAAAAS    ASA SAS SSAASASS SSA
   183  185 A Q  S    S+     0   0   34  284   49                t                   QQQQQQQQQqQQ    QQQ qQq QQqQQqqq qqQ
   184  186 A R  S    S-     0   0  108  284   68                g                   rrrEerrrrpre    rer prp eetketpp ppe
   185  187 A D        -     0   0   38  204   79                d                   lllAlllll.ll    lll .l. llemle.. ..q
   186  188 A M        -     0   0   22  215   84                P                   NNNLNNNNN.NN    NNN .N. NNENNE.. ..N
   187  189 A G        +     0   0   24  220   62                S                   SSTNTSSSS.TT    TTA .T. TTEESE.. ..T
   188  190 A G    > > +     0   0   12  245   65                L                   QAEAQEEEE.EE    EEE .T. QQAGAA.. ..A
   189  191 A R  G > 5S+     0   0  123  260   82                A                   PPPQDPPPP.PL    PLA .P. VVQSDQ.. ..A
   190  192 A D  G 3 5S+     0   0  175  284   41                D                   GGEDDGEEEDED    DDG DDD DDAEDAED DED
   191  193 A E  G < 5S-     0   0  111  284   28                E                   DDDDDDDDDDDD    DDD DDD DDDDDDDD DDD
   192  194 A G  T < 5S+     0   0   49  284   45                D                   NNNDANNNNNNE    NEN ANS QQNNANSD DAQ
   193  195 A Y      < -     0   0   42  284   24                F                   FFFVFFFFFFFF    FFF FFF FFFFFFFF FFF
   194  196 A D        -     0   0   38  116    1                .                   ............    ... ... ........ ...
   195  197 A W        -     0   0   12  124    7                .                   ...F........    ... ... ........ ...
   196  198 A L  E     -g  179   0A   0  284   28                V                   LLIVVLIIIIII    IIV III IIIIIIII III
   197  199 A I  E     -g  180   0A   1  284   59                I                   TTTHHTTTTHTH    THT HTH HHHTHHHH HHT
   198  200 A M  E     -gh 181 228A   0  284   23                F                   MMMMMMMMMMMM    MMM MMM MMMMMMMM MMM
   199  201 A T  E     - h   0 229A   0  284   11                T                   TTTTTTTTTTTT    TTT TTT TTTTTTTT TTT
   200  202 A P        +     0   0   31  284   27                T                   PPPPPPPPPPPP    PPP PPP PPPPPPPP PPP
   201  203 A G  S    S+     0   0   33  284    0                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
   202  204 A V  E     +i  216   0B   8  284   31                V                   VVCCCVCCCCCC    CCV CCC CCCVCCCC CCC
   203  205 A G  E     -i  217   0B   3  283   56                N                   KKQQQKQQQKQQ    QQQ QQQ QQKQKKQQ QQQ
   204  206 A L        -     0   0   35  283    8                G                   IILLLILLLLLL    LLL LLL LLLLLLLL LLL
   205  207 A D        -     0   0   97  283   62                S                   PPPPPLPPPPPP    PPP PPP PPPQPPPP PPP
   206  208 A D    >   -     0   0   41  283   76                K                   PPPPPPPPPPPP    PPK PPP PPPAPPPP PPS
   207  209 A K  T 3  S+     0   0  216  283   49                S                   KKPQAKPPPpPe    PeE EPE QqPGPPEE EEG
   208  210 A G  T 3  S+     0   0   77  258   14                G                   ....G....e.e    .e. G.G DdGG.GGG GG.
   209  211 A D    <>  +     0   0   42  265    9                N                   ...DDA...E.D    .D. E.D EDED.EDA AD.
   210  212 A A  T  4 S+     0   0   76  266   64                V                   ...ESQ...E.Q    .Q. D.E DQEG.EED DE.
   211  213 A L  T >4 S+     0   0   87  267   44                L                   ...VDE...N.N    .N. E.E QNAM.AEE EE.
   212  214 A G  G >4 S+     0   0    9  281   17                G                   GGGNGGGGGGGG    GGG NGN DGPGGPNN NN.
   213  215 A Q  G 3< S+     0   0   89  282   19                Q                   qqqgtqqqqhqt    qtq aqe gsqQeqge ege
   214  216 A Q  G <  S+     0   0  148  282    3                R                   qqqqqqqqqqqq    qqq qqq qqqQqqqq qqq
   215  217 A Y  S <  S-     0   0  109  282    0                Y                   YYYYYYYYYYYY    YYY YYY YYYYYYYY YYY
   216  218 A R  E     -i  202   0B  69  282   57                Q                   TTNNNNNNNNNN    NNN NNN NNNNNNNN NNN
   217  219 A T  E  >  -i  203   0B  45  282    7                T                   SSTTTNTTTTTT    TTT TTT TTTTTTTT TTT
   218  220 A V  H  > S+     0   0    0  282   47                P                   PPPPPPPPPPPP    PPP PPP PPPPPPPP PPP
   219  221 A D  H  > S+     0   0   71  282   63                A                   RRHAARHHHAHQ    HQR QRE QQDADDQQ QQQ
   220  222 A D  H  > S+     0   0   67  282   64                A                   QQKSSQKKKKKK    KKR KKK KKNKKNKK KKK
   221  223 A V  H  X>S+     0   0    0  282   45                A                   IILIIILLLLLI    LIV ILL IILVLLLI ILL
   222  224 A V  H ><5S+     0   0    0  283   19                V                   VIIIIIIIIIII    IIV III IIVVIVVI IVI
   223  225 A S  H 3<5S+     0   0   78  284   81                G                   YFFGGLYYYTFG    FGG GFE GGNGKNEG GEG
   224  226 A T  H 3<5S-     0   0   58  284   84                G                   eedvvedddlev    dve vel iiiegili ile
   225  227 A G  T <<5S+     0   0    6  284    3                G                   gggggggggggg    ggg ggg gggggggg ggs
   226  228 A S      < -     0   0    0  284   59                S                   SSCSSSCCCTCA    CAC ACT AATTTTTA ATV
   227  229 A D  S    S+     0   0    0  284    0                D                   DDDDDDDDDDDD    DDD DDD DDDDDDDD DDD
   228  230 A I  E    S- h   0 198A   0  284   31                F                   VVIIIIIIIIII    IIV IVI IIIIIIII III
   229  231 A I  E     -ah  30 199A   0  284   19                I                   VIIAAVIIIVIV    IVV AIV VVAIVAVA AVI
   230  232 A I  E     -a   31   0A   6  284    0                I                   IIIIIIIIIIII    III III IIIIIIII III
   231  233 A V  E     +a   32   0A   1  284   33                A                   VVVVVVVVVVVV    VVV VVV VVVVVVVV VVV
   232  234 A G    >   +     0   0   23  284    0                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
   233  235 A R  G >> S+     0   0  126  284    0                R                   RRRRRRRRRRRR    RRR RRR RRRRRRRR RRR
   234  236 A G  G 34 S+     0   0   18  284    0                G                   GGGGGGGGGGGG    GGG GGG GGGGGGGG GGG
   235  237 A L  G <4 S+     0   0    0  284   25                I                   IIIIIIIIIIII    III III IIIIIIII III
   236  238 A F  T <4 S+     0   0   24  284   34                Y                   IIVLIVVVVIVL    VLL IVL LLIYLILI ILI
   237  239 A A  S >< S+     0   0   22  284   59                S                   EERKKERRRQRK    RKA KRK KKTGETKK KKG
   238  240 A K  T 3  S-     0   0  176  165   62                .                   ............    ... ... ........ ...
   239  241 A G  T 3  S+     0   0   84  284   53                A                   AAAAAAAAAAAA    AAA AAA AAAAAAAA AAA
   240  242 A R    <   -     0   0   78  284   77                E                   DNENNDQQQAEG    AGN NQG SSAKAAGG GGA
   241  243 A D     >  -     0   0   91  284   27                D                   NDDDDDDDDDDD    DDD DDD DDDDDDDD DDD
   242  244 A A  H  > S+     0   0    8  284   53                R                   RRRPPRRRRPRP    RPR PRP PPPRPPPP PPP
   243  245 A K  H  > S+     0   0   92  283   82                V                   AAVYFAKKKPVE    KEV EKQ EEPRVPQE EQV
   244  246 A V  H  > S+     0   0   79  283   82                Q                   EEAEEKSSSTAG    AGR GAS GGAASASE EST
   245  247 A E  H  X S+     0   0   23  283   47                A                   EEEEEEEEEEEE    EEE EEE EEEAEEEE EEE
   246  248 A G  H  X S+     0   0    0  283   40                A                   AAAAAAAAAAAT    ATT AAA AAAAAAAA AAA
   247  249 A E  H  X S+     0   0   55  283   56                K                   EEEEEEEEEEEE    EEE EEE EEELEEEE EEE
   248  250 A R  H  X S+     0   0   78  283   26                Q                   RRRRRRRRRRRR    RRR RRR RRRERRRR RRR
   249  251 A Y  H  X S+     0   0    9  283    0                Y                   YYYYYYYYYYYY    YYY YYY YYYYYYYY YYY
   250  252 A R  H  X S+     0   0   37  283   33                Q                   RRRRRRRRRRRR    KRR RRR RRRRRRRR RRR
   251  253 A K  H  X S+     0   0   95  283   64                E                   KKKSSKKKKRKS    RST STR SSRKKRRS SRR
   252  254 A A  H  X S+     0   0   16  283   49                E                   EEAAAEAAAKAA    AAE AEK AAKQRKKA AKK
   253  255 A G  H  X S+     0   0    0  283   20                G                   AAAAAAAAAAAA    AAA AGA AAAGAAAA AAG
   254  256 A W  H  X S+     0   0   19  283    0                W                   WWWWWWWWWWWW    WWW WWW WWWWWWWW WWW
   255  257 A E  H  X S+     0   0   83  283   62                A                   AVAKKATTTKSK    TKR KKK KKKLKKKK KKE
   256  258 A A  H  X S+     0   0    1  283    1                A                   AAAAAAAAAAAG    AGA AAA AAAAAAAA AAA
   257  259 A Y  H  < S+     0   0   21  281    0                Y                   YYYYYYYYYYYY    YYY YYY YYYYYYYY YYY
   258  260 A L  H  < S+     0   0  113  277   62                E                   EEETTEEEELET    ETE TEL TTQRLQLT TLT
   259  261 A R  H  <        0   0  157  277   66                A                   EEEEEEEEEAEE    KEE EES EEDEGDSE ESA
   260  262 A R     <        0   0   89  273    4                R                   RRRRRRRRRRRR    RRR RRR RRRRRRRR RRR
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58  R     K      Q  QQS  RK   R   SS                                  K   
   263    4 C A        -     0   0   31  121   71  Q  QN M      A  VVS  QA   Q   KK                                  A   
   264    5 C T     >  -     0   0   47  219   38  SS STTTTTT  PS  SSS TSA   T   STP                                 T   
   265    6 C Y  H  > S+     0   0    0  253    0  YYYYYYYYYYYYYY YYYYYYYYYYYYFYYYYYY                                Y   
   266    7 C K  H  > S+     0   0  122  253   72  SSQAEAKTTTAAEG SGGTGESHAAAGSSSAASH                                A   
   267    8 C E  H  > S+     0   0   70  253   62  QTDAEQEAAAVVVD VDDQEQTAIVEQTVVQQAI                                S   
   268    9 C R  H  X S+     0   0    2  253    1  RRRRRRRRRRGRRR RRRRRRRRRRRRRRRRRRR                                R   
   269   10 C A  H  < S+     0   0   21  253   21  AAMAVASAAAAAGA AAAIAGAAAAAIAAAGGAA                                A   
   270   11 C A  H  < S+     0   0   47  253   71  EKTSQSKSSSSSRK SKKAKESQTSRQSSSQHAT                                A   
   271   12 C T  H  < S+     0   0   31  253   83  EFFKNRLKKKRRDA RAANQLVTNRQNNRRAAST                                T   
   272   13 C H     <  -     0   0   13  254   44  HCCHFHYHHHHHHH HHHHHHHHHHHHHHHHHHN                                A   
   273   14 C P  S    S+     0   0   45  257   60  STKSSTSPPPSSPA GPPSPKPPPSDTPSSQQPP             AAA                T   
   274   15 C S     >  -     0   0    0  257   59  SNNNNNNNNNNNNN NNNNHSSHNNNNNNNHHHH             GGG                H   
   275   16 C P  H  > S+     0   0   82  261   28  PSPAPPKAAAPPPP PPPPPPPPPPPPPPPPPPP            PPPP   P   P        P   
   276   17 C V  H  > S+     0   0    0  264   54  LTLATATLLLLLLL LLLAVVLVLLIALLLVVVV            LLLL   L   L        L   
   277   18 C A  H  > S+     0   0    0  264   29  MGAAAAAAAAAAAV AVVAAAAATAAAAAAAAAA            TAAA   A   A        N   
   278   19 C A  H  X S+     0   0   22  264   67  KKKKRKQKKKRRRR KRRKRKQKSRRKRKKRRKR            ASSS   S   S        A   
   279   20 C K  H  X S+     0   0   73  264   74  KKQQSARRRRQQRR RRRRRRRRKQKLKQQKKKK            YYYY   Y   Y        Y   
   280   21 C L  H  X S+     0   0    0  265    2  LLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLL            LLLL   L   L        L   
   281   22 C F  H  X S+     0   0    0  265   13  FLLLLLLFFFFFFF FFFLFFLFFFFLFFFFFFF            LLLL   L   L        F   
   282   23 C N  H  X S+     0   0   69  265   71  GEHEEEEEEEQQQE QEEFESKESQEEEQQEERA            RSSS   R   R        K   
   283   24 C I  H  X S+     0   0    2  265   41  ILLTITLIIIIIII IIILIILIIIITVIIIIIV            LLLL   L   L        L   
   284   25 C M  H  X>S+     0   0    0  266   52  AMIMMIMAAAAAAA AAAMAAMAAAAMAAAAAAA            IMII   V   V        M   
   285   26 C H  H  <5S+     0   0   75  266   50  EDSESEDEEEEEAE EEEDQTDEEEEEEEEEEDE            AAAA   S   S        D   
   286   27 C E  H  <5S+     0   0  112  266   83  TRERRRRAAAEEEQ EQQSASQTEEARADDSLSR            IAAA   I   I        L   
   287   28 C K  H  <5S-     0   0   40  266    0  KKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKK            KKKK   K   K        K   
   288   29 C Q  T  <5 +     0   0  109  266   48  KQKKKKQKKKKKQQ KQQQEKQKKKKKKKKKKRK            RQQQ   Q   Q        A   
   289   30 C T      < +     0   0    0  266   40  TTSSTSTTTTSSSS SSSTTSSSTSSSSSSSSSS            TTTT   T   T        S   
   290   31 C N        +     0   0    0  266    0  NNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNN            NNNN   N   N        N   
   291   32 C L  E     -s  740   0E   0  266   15  VLLLLLLVVVVVVV VVVLVLLLVVVLVVVLLLL            LLLL   L   L        L   
   292   33 C C  E     -st 741 577E   0  266   47  VAAACASTTTVVVV VVVSVVCITVVATVVVVII            CCCC   C   C        C   
   293   34 C A  E     -st 742 578E   0  265   57  LILVIVVVVVVVVV LVVIVIVIVVVVVVVVIII            LLLL   L   L        L   
   294   35 C S  E     - t   0 579E  14  266   11  SASSSSASSSSSSS SSSASSSSSSSSSSSSSSS            SSSS   S   S        S   
   295   36 C L        +     0   0    2  266   60  AAAVVVAAAAAAAA AAAAAAVAAAAVAAAAAAA            AAAA   A   A        A   
   296   37 C D        +     0   0   54  266    0  DDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDD            DDDD   D   D        D   
   297   38 C V        -     0   0    6  266   11  LVVVVVFVVVVVVV VVVVVLVFVVLVVVVLLFL            VVVV   V   V        V   
   298   39 C R  S    S+     0   0  150  266   65  TTTTTTTTTTTTTT TTTSTTTRTTTTTTTEETT            TEEE   E   E        A   
   299   40 C T     >  -     0   0   17  266   45  TTRKTKKTTTTTTT TTTTRDNTTTTKTTTDDDD            TTTT   T   T        T   
   300   41 C T  H  > S+     0   0   13  266   53  TSCAKSKTTTSSTT TTTKASKTSSTSTTTTTTT            TSSS   S   S        A   
   301   42 C K  H  > S+     0   0  139  266   68  KDAAAAQKKKKKQS KSSAGKAAAKKKKKKEEDK            QAAA   A   A        R   
   302   43 C E  H  > S+     0   0   77  266   31  EEEDSDEEEEEEEA EAAEESSEEEEDEEESSSS            AEEE   E   E        E   
   303   44 C L  H  X S+     0   0    5  266   12  LLIFLFVLLLLLLL LLLLLLFMLLLFLLLLLLL            LLLL   L   L        L   
   304   45 C L  H  X S+     0   0   40  266    4  LLILLLLLLLLLLL LLLLLLLLLLLLLLLLLLL            LLLL   I   L        L   
   305   46 C E  H  X S+     0   0  108  266   75  EKEARTDDDDDDDD DDDHDKRKDDEADDDKKKE            SQQQ   Q   Q        Y   
   306   47 C L  H  X S+     0   0   29  266   27  IILIIVFLLLLLLL LLLILCICLLLILLLCCCC            LLLL   L   L        F   
   307   48 C V  H  X S+     0   0    0  265   56  AAAIVVAAAAAAAA AAAAAAVAAAAIAAAAAAA            AAAA   A   A        A   
   308   49 C E  H  < S+     0   0   77  266   24  DAEQDDDDDDDDDE DEEDDDEYDDDDDDDDDDD            DEEE   E   E        D   
   309   50 C A  H  < S+     0   0   26  266   77  RSKAAAKRRRRRKR RRRTRDADRRHARRRGGgE            EEEE   D   D        K   
   310   51 C L  H >X S+     0   0    0  263   31  LLIVAVTLLLLLLL LLLLFLVILLLVLLL..lL            VVVV   V   V        I   
   311   52 C G  G >< S+     0   0    0  263    2  GGGAGGGGGGGGGG GGGGGGGGGGGGGGG..GG            GGGG   G   G        G   
   312   53 C P  G 34 S+     0   0   48  266   17  PPPPPPPPPPPPPP PPPPPPDPPPPPPPPPPPP            DDDD   D   D        P   
   313   54 C K  G <4 S+     0   0   30  266   73  YDEYSYYYYYYYYH YHHYYLHYYYYFYYYYYYF            SSSS   S   S        A   
   314   55 C I    <<  -     0   0    0  266   15  IIIVVIIIIIIIMM IMMIIIVIIIIVIIIIIII            IIII   I   I        I   
   315   56 C C  S    S+     0   0    0  265   43  ACCCCCCAAATTVV TVVCAACAATACATTAAAS            CCCC   C   C        V   
   316   57 C L  E     -tu 553 607E   0  265   31  VVVMVLIVVVVVVV VVVIVVMVVVVLVVVVVVV            LLLL   L   L        V   
   317   58 C L  E     -tu 554 608E   0  265   31  LLLIVTLIIILLLL LLLLLFIFLLLTILLFFFF            LLLL   L   L        L   
   318   59 C K  E     -tu 555 609E  22  265    1  KKKKKHKKKKKKKK KKKKKKKKKKKHKKKKKKK            KKKK   K   K        K   
   319   60 C T  E     - u   0 610E   2  264    2  TTTTA.TTTTTTTT TTTTTTTTTTTVTTTTTTT            TTTT   T   T        T   
   320   61 C H    >   +     0   0   26  264    1  HHHHS.HHHHHHHH HHHHHHHHHHHDHHHHHHH            HHHH   H   H        H   
   321   62 C V  G >   +     0   0    3  265   39  IIVVIVVIIIIIII IIIIIVIIIIIIIIIIIVI            ACCC   C   C        H   
   322   63 C D  G 3  S+     0   0   74  265    1  DDDDHDDDDDDDDD DDDDDDDDDDDIDDDDDDD            DDDD   D   D        D   
   323   64 C I  G <  S+     0   0   82  265   11  IIIIIIIIIIIIII IIIIILIMIIIEIIIVVII            IIII   I   I        M   
   324   65 C L    <   -     0   0   15  266   28  IILLVIILLLLLLI LIIVLVIILLVDLLLVVII            IVVV   V   V        V   
   325   66 C T  S    S+     0   0   88  266   64  SEEEEEESSSTTST TTTSDHESTTSFSTTRRHH            STTT   T   T        S   
   326   67 C D  S    S+     0   0   71  266   10  DDDDDDDDDDDDDD DDDDNDDDDDDDDDDDDDD            DDDD   D   D        G   
   327   68 C F        +     0   0   35  266    7  ffffFfffffllff lfffFfffllfQfllffff            fwww   w   w        w   
   328   69 C S     >> -     0   0   45  202   62  .kdpDss....... ...dS.dd...S.......            ....   .   .        e   
   329   70 C M  I  4>S+     0   0   44  203   88  .LFLQLF....... ...LL.LL...L.......            ....   .   .        H   
   330   71 C E  I  45S+     0   0  135  194   54  p......dddppsp ppp..e..ppk.pppdddd            dddd   d   d        .   
   331   72 C G  I  45S+     0   0   33  250   62  A...D..EEETTEQ SQQ.TD..STE.ESSAAKE            RRRR   R   R        G   
   332   73 C T  I  X5S+     0   0    2  252   41  T..IL..TTTTTTT TTT.VT.TTTT.TTTTTTT            TTTT   T   T        T   
   333   74 C V  I  > S+     0   0   37  266   72  GKEKRHEGGGSSGG SGGQAGKGSSGQGSSGGGG            QAAA   A   A        K   
   336   77 C L  H  X S+     0   0    3  266    0  LLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLL            LLLL   L   L        L   
   337   78 C K  H  X S+     0   0   68  265   79  TSTQQQKKKKKKQK KKKVKKVRQKKQNQQKKKK            RRRR   R   R        A   
   338   79 C A  H  X S+     0   0   60  266   62  QANAQQKAAASSSA TAAAETEASSSDAAATTES            DEEE   E   E        A   
   339   80 C L  H  X S+     0   0   13  266   12  LLLLLLLLLLLLLA LAALLLIILLLLLLLLLLL            IVVV   V   V        L   
   340   81 C S  H  X>S+     0   0   15  266   37  ASASSSAAAAAASA AAASAASAAASSAAAAAAA            AAAA   A   A        A   
   341   82 C A  H  <5S+     0   0   80  266   70  HDKLKKEQQQSSQQ TQQKVENRTSEIEKKKKAR            KAAA   K   K        R   
   342   83 C K  H  <5S+     0   0  134  266   19  RQKEKKKKKKKKKK KKKKKKRTKKKKKKKKKKK            RRRR   R   R        R   
   343   84 C Y  H  <5S-     0   0   51  266   36  HYQHHHHHHHHHHH HHHHHHKHHHHHHHHHHHH            KKKK   K   K        H   
   344   85 C N  T  <5 +     0   0   60  266   55  NDQDDDDNINRRNN RNNSNNQNNRNDNRRNNDD            RSSS   C   Y        G   
   345   86 C F      < -     0   0    0  266    0  FFFFFFFFFFFFFF FFFFFFFFFFFFFFFFFFF            FFFF   F   F        F   
   346   87 C L  E     -u  577   0E   6  266   11  LLLTLLLLLLLLLL LLLMLLMLLLLVLLLMMLL            LLLL   L   L        L   
   347   88 C L  E     -u  578   0E   0  266   12  LLIIIIIIIILLII LIIIIIIIILIIILLIIII            VIII   I   I        I   
   348   89 C F  E     -uv 579 638E   0  266    0  FFFFFFFFFFFFFF FFFFFFFFFFFFFFFFFFF            FFFF   F   F        F   
   349   90 C E  E     -u  580   0E   0  266    0  EEEEEEEEEEEEEE EEEEEEEEEEEEEEEEEEE            EEEE   E   E        E   
   350   91 C N  E     +     0   0E  30  266    0  DDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDD            DDDD   D   D        D   
   351   92 C R  E     -     0   0E  47  266    0  RRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRR            RRRR   R   R        R   
   352   93 C K  E     - v   0 640E  85  266    0  KKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKK            KKKK   K   K        K   
   353   94 C F  E     + v   0 641E   3  266    0  FFFFFFFFFFFFFF FFFFFLFFFFFFFFFLLFF            FFFF   F   F        F   
   354   95 C A        +     0   0   46  265   45  IAAA.AAIIIVVVV VVVAVVAVIVVAIVVVVVV            GAAA   A   A        G   
   355   96 C D        -     0   0   67  265    0  DDDD.DDDDDDDDD DDDDDDDDDDDDDDDDDDD            DDDD   D   D        D   
   356   97 C I    >>  +     0   0   79  265    1  IIII.IIIIIIIII IIIIIIIIIIIIIIIIIII            IIII   I   I        I   
   357   98 C G  H 3> S-     0   0   39  265    0  GGGG.GGGGGGGGG GGGGGGGGGGGGGGGGGGG            GGGG   G   G        G   
   358   99 C N  H 3> S+     0   0  113  265   28  NNHN.NKNNNSSNH SHHNNSNHNSNNNSSSNTS            EEEE   E   E        N   
   359  100 C T  H <> S+     0   0   75  265    2  TTTT.TTTTTTTTT TTTTTTTTTTTTTTTTTTT            TTTT   T   T        T   
   360  101 C V  H  X S+     0   0    0  265    5  VVVV.VVVVVVVVV VVVVVVVVVVVVVVVVVVA            VVVV   V   V        V   
   361  102 C K  H  X S+     0   0   23  265   59  QKKA.AQQQQQQQQ QQQKQQKIQQQAQQQQQQQ            QQQQ   Q   Q        E   
   362  103 C L  H  X S+     0   0   92  265   78  KYLL.LLKKKKKKM KMMLKKYGKKKLKKKKKKK            KKKK   K   K        L   
   363  104 C Q  H  < S+     0   0   76  265    0  QQQQ.QQQQQQQQQ QQQQQQQQQQQQQQQQQQQ            QQQQ   Q   Q        Q   
   364  105 C Y  H  < S+     0   0    0  266    0  YYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYY            YYYY   Y   Y        Y   
   365  106 C S  H  < S+     0   0   23  266   78  RGASSSSHHHHHHH HHHSHHSHHHHSHHHHHHH            TTTT   T   T        T   
   366  107 C A  S  X S+     0   0   34  266   52  GGKSRSSRRRGGGG GGGKGGSGGGGSGGGNNGG            GSSS   S   S        S   
   367  108 C G  T  4 S-     0   0   60  266    0  GGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG            GGGG   G   G        G   
   368  109 C V  T  4 S+     0   0  105  266   63  AIIVVVITTTSSAS SSSIAVIAASAVASSAAAA            PHHH   H   H        S   
   369  110 C Y  T  4 S-     0   0   49  266   65  LYYHHHYLLLLLLL LLLYLLYLLLLHLLLLLLL            LHHH   H   H        A   
   370  111 C R    ><  +     0   0   95  266   34  RHRKRKKRRRRRQR RRRHQRKRRRRKKRRRRRR            ARRR   R   R        R   
   371  112 C I  G >>  +     0   0    0  266    2  IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIII            IIII   I   I        I   
   372  113 C A  G 34 S+     0   0    0  266   52  YAAASASSSSSSSS SSSASSASSSSASSSSSSS            AAAA   A   A        I   
   373  114 C E  G <4 S+     0   0   81  266   60  EDDSSSEEEEEEQE EEEDSEEEEEENEEEEEEE            RLLL   L   L        E   
   374  115 C W  T <4 S+     0   0    3  266    0  WWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWW            WWWW   W   W        W   
   375  116 C A     <  -     0   0    0  266   30  AAASSSAAAAAAAA AAAAAASAAAASAAAAAAA            AAAA   A   A        A   
   376  117 C D  S    S+     0   0    8  266   44  HHDHHHDHHHHHHH HHHDDDDDHHHHHHHDDDD            EEEE   E   E        H   
   377  118 C I  E     +vw 609 666E   0  266    8  IIMIIIIIIIIIII IIIIILIIIILIIIIIIII            IIII   I   I        I   
   378  119 C T  E     - w   0 667E   0  266   42  IIITTTIIIIVVVV VVVTVVTVIVVTIVVVVVV            VTTT   T   T        V   
   379  120 C N  E     -vw 613 668E   1  266    2  NNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNN            NNNN   N   N        N   
   380  121 C A  E     -vw 614 669E   0  266   41  AAAAAAACCCCCAC CCCACLALCCAACCCLLVV            AAAA   A   A        V   
   381  122 C H    >   -     0   0   37  266   50  SHHHHHHSSSAATA AAAHTSHSAASHAAASSSS            HHHH   H   H        N   
   382  123 C G  G >  S+     0   0    5  265   79  ITSPIPPIIIMMMV MVVPMITIIMIPVMMIILL            IIVV   V   V        M   
   383  124 C V  G 3  S+     0   0   99  266   30  LVLVVVMLLLLLLL LLLLLLVLLLLVLLLLLLL            FLLL   L   L        V   
   384  125 C V  G <  S-     0   0   53  266   52  APPPPPPPPPAAPA AAAPPGPGPAAPPAASSGG            PPPP   P   P        P   
   385  126 C G    X   -     0   0   15  266    1  GGGGGGGGGGGGGG GGGGGGGGGGGGAGGGGGG            GGGG   G   G        G   
   386  127 C P  T >> S+     0   0   74  266   64  EAPPPPEEEEPPPS PSSEEDEEEPDPEPPDDDD            PPPP   P   P        K   
   387  128 C G  H 3> S+     0   0   26  266   25  GGGSGSGGGGGGGD GGGGGGGGGGGSGGGGGGG            AAAA   A   A        A   
   388  129 C I  H <> S+     0   0    0  266   24  IVMIVIIIIIIIII IIIVIIVIIIIIIIIIIVV            IIII   I   I        S   
   389  130 C V  H <> S+     0   0    2  266   13  IIIIIIIVVVVVIV VVVVVVIVVVVIVVVVVVV            VVVV   V   V        V   
   390  131 C S  H  X S+     0   0   72  266   72  QEASSTDEEEDDDD DDDHQESDEDESQDDDDDN            STTT   T   T        T   
   391  132 C G  H  X S+     0   0    6  266   30  AGGGGGGAAAAAAA AAAGAAGAAAAGAAAAAAA            SAAA   A   A        S   
   392  133 C L  H  X S+     0   0    0  266    0  LLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLL            LLLL   L   L        L   
   393  134 C K  H  X S+     0   0   54  266   67  DQSKASKAAAAAAA AAAKTSADAAASAAATTEG            KEEE   E   E        A   
   394  135 C Q  H  X S+     0   0   97  266   56  QTESRSKQQQQQQQ QQQEQQQQQQQSEQQQQQQ            DKKK   K   K        N   
   395  136 C A  H  X S+     0   0    1  266   60  TIIVAVITTTTTVV TIIVTTVTTTTVTTTTTVV            AAAA   A   A        A   
   396  137 C A  H  X S+     0   0    4  266   31  IGGGGGGAAAAAAS ASSGAIGITAGGAAAIVII            AAAA   A   A        A   
   397  138 C E  H  < S+     0   0  134  266   84  hLMLQLEsssssss ssslesIkkstLqssttst            seee   e   e        s   
   398  139 C E  H  < S+     0   0  125  202   30  e......dddssde qhhedd.tdse.dqqggee            eeee   e   e        e   
   399  140 C V  H  < S+     0   0   51  266   88  PSSpppPfffvvff tyyTffPffvHpfrrfftt            dddd   e   d        e   
   400  141 C T     <  -     0   0   35  193   67  .......gggeeap gaa.kp.qaeK.gaarrrr            hnnn   s   s        p   
   401  142 C K  S    S+     0   0  179  212   85  .RK....PPPAVAA AGGNDEKGNVG.SAAGGSG            DLLL   L   L        L   
   402  143 C E  S    S-     0   0   91  218   33  EDQ...QEEEeeHG EEEgQQGHQeE.EEEEEEQ            dddd   d   d        E   
   403  144 C P        -     0   0   33  183   56  ...gggG...gg.E G..t.....g.g.GG....            haaa   a   a        .   
   404  145 C R        -     0   0   20  264   15  RRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRR            ETTT   T   T        R   
   405  146 C G  E     -w  638   0E   0  266   17  GGGGGGGGGGAAGG AGGGAAGAGAGGGAAGGGA            IEEE   E   E        G   
   406  147 C L  E     -wx 639 699E   0  266    6  ILLLLLLLLLLLLL LLLLLFLLLLLLLLLFFLL            LLLL   L   L        L   
   407  148 C L  E     -wx 640 701E   0  266   11  LLLLLLFLLLLLLL LLLLLLLLLLLLLLLLLLL            EIII   V   V        L   
   408  149 C M  E     -wx 641 702E   0  266   38  ILLPLLLIIIIIII IIILIILLIIMLIIILLLL            RRRR   H   H        I   
   409  150 C L  E     + x   0 703E   3  266    2  LLLLLLLLLLLLLL LLLILLLLLLLLLLLLLLL            LLLL   L   L        L   
   410  151 C A        +     0   0    0  266    8  AAAAAAAAAAAAAA AAAAAAAAAAASAAAAAAA            gggg   g   g        A   
   411  152 C E  S    S-     0   0   24  266   18  EEEEEEEEEEEEEE EEEETEEEEEEEEEEEEEE            eeee   e   e        Q   
   412  153 C L        -     0   0   44  266    7  MMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM            MMMM   M   M        M   
   413  154 C S        +     0   0   78  266   31  TSSSSSSTTTTTTT TTTSTTSTTTTSTTTTTTT            SSSS   S   S        S   
   414  155 C C  S >  S-     0   0   79  266   22  SSSTSTSSSSSSSS SSSSSSSSSSTTSSSSSTT            SSSS   S   S        S   
   415  156 C K  T 3  S+     0   0  214  266   44  KAAAARKKKKKKKK QKKKKKQQKKRKKKKKKAA            AEEE   A   A        Q   
   416  157 C G  T 3  S+     0   0   68  265    2  GGQGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG            GGGG   G   G        G   
   417  158 C S    <   -     0   0   38  266   49  SNNSASCSSSSSSS SSSSSSTSSSTASSSSSSS            NHHH   H   H        N   
   418  159 C L        +     0   0  148  266    8  LLLLLLLLLLMMLM MLLLLLLLLMFLLMMLLLL            LLLL   L   L        F   
   419  160 C A        +     0   0    6  266   41  AAFATASAAAAAAA AAAAAAAAAAAAAAAAAAA            MMMM   M   M        M   
   420  161 C T    >   -     0   0   55  266   75  VYDRTTTTTTTTTT TTTTTTKGTTTVTTTTTVV            TTTT   T   T        N   
   421  162 C G  T 3> S+     0   0   20  266   28  GGSGGGEGGGGGGG GGGGGGDGGGGGGGGGGGE            GPPP   P   P        K   
   422  163 C E  H 3> S+     0   0   81  266   50  EENAETEQQQAAKE AEELEASEEAASEPPLSEK            AEEE   E   E        E   
   423  164 C Y  H <> S+     0   0   59  265    0  YYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYY            YYYY   Y   Y        Y   
   424  165 C T  H  > S+     0   0    3  266   18  TTTTTTVTTTTTTT TTTSTTTTTTTTTTTTTTT            TQQQ   Q   Q        T   
   425  166 C K  H  X S+     0   0   78  266   69  RQQEKDNTTTQQEK EKKDKKVEAQKQSEESSQE            EKKK   K   K        Q   
   426  167 C G  H  X S+     0   0   26  266   76  AKKDTEASSSLLLL LLLAVRERRLAEALLRQRR            QTTT   E   E        A   
   427  168 C T  H  X S+     0   0    2  266   58  STTAAASSSSSSSS SSSASCTCSSSASSSCCCC            CTTT   T   T        C   
   428  169 C V  H  X S+     0   0   16  266   12  VLLVVVIVVVVVVV VVVVVVVVVVIVVVVVVVV            VVVV   V   V        V   
   429  170 C D  H  < S+     0   0   78  266   45  EEARRRKDDDEEEE REEQEDQEEEERDQQDSDA            EQQQ   K   K        E   
   430  171 C I  H >< S+     0   0   21  266   63  IMMMLMMYYYAAMM AMMMCLMLYASMYAALLVV            IIII   I   I        A   
   431  172 C A  H >< S+     0   0    0  265    1  AAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAA            AAAA   A   A        A   
   432  173 C K  T 3< S+     0   0   53  266   33  RRKRNRKRRRRRRR RRRCRRRARRKRRRRRRrr            RRRR   R   R        R   
   433  174 C S  T <  S+     0   0   73  265   75  KIQAETKKKKRRKK KRRRKEKRKRKAKKKSRkn            ESSS   D   D        E   
   434  175 C D    <>  +     0   0   19  266   71  YYFRNHNYSYHHYH HHHHYHHYYHHHYHHHHGG            HHHH   H   H        H   
   435  176 C K  T  4 S+     0   0   81  266   48  PRARSRKKKKRRRA RAARSPRPKRSRPRRPPMI            KRRR   R   R        K   
   436  177 C D  T  4 S+     0   0   84  266   43  RDEDDEENNNAAGG GGGDRDDEGASDSGGGEga            DDDD   D   D        D   
   437  178 C F  T  4 S+     0   0   10  266    7  SFFFFFFFFFFFFF FFFFFSFSFFFFFFFSSag            FFFF   F   F        F   
   438  179 C V  E  <  +x  667   0E   1  266    5  VVVVVVVVVVVVVV VVVVVMVVVVVVVVVTTVV            VVVV   V   V        V   
   439  180 C I  E     -     0   0E   0  265   40  LIIIIIIMMMLLLM LMMFILIIMLIILLLFFMM            MMMM   M   M        I   
   440  181 C G  E     -xy 668 718E   0  266    0  GGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG            GGGG   G   G        G   
   441  182 C F  E     -xy 669 719E   0  266    0  FFFFYFFFFFFFFF FFFFFFFFFFFFFFFFFFF            FFFF   F   F        F   
   442  183 C I  E     +xy 670 720E  10  265   12  VIIIIIIVVVVVVV VVVIVVIVVVIIVVVVVVV            IIII   I   I        V   
   443  184 C A        -     0   0    0  265   31  ATAAAASSSSAAAA AAAGAASASASASAAAAAA            AAAA   A   A        S   
   444  185 C Q  S    S+     0   0   34  266   53  tTQqmqittttttt tttqstqTttnqttttttt            QQQQ   Q   Q        q   
   445  186 C R  S    S-     0   0  111  266   66  hHRkrpepppdddk gkkcernkkdtqaeeqrgr            rrrr   r   r        q   
   446  187 C D        -     0   0   41  192   77  p...vGi.....a. k...v.at...E.eeq.d.            llll   l   l        .   
   447  188 C M        -     0   0   20  204   82  D...QQL.....G. E...V.QT...N.EEDDP.            NNNN   N   N        .   
   448  189 C G        +     0   0   25  210   61  AQ..SDM.....K. G...P.SV...T.EEGAS.            SSSS   T   T        .   
   449  190 C G    > > +     0   0    6  236   63  ALKADVTSSSGGA. E...L.AGEG.V.EEGGLD            QEEE   E   E        .   
   450  191 C R  G > 5S+     0   0  123  254   81  PILESSPDDDDDEA GPP.EASEEDHDDEERPAE            PPPP   P   P        D   
   451  192 C D  G 3 5S+     0   0  160  266   42  NDSDEEGEEEEEDD EDDLNDQGSEMKNEEYDDD            GEEE   E   E        D   
   452  193 C E  G < 5S-     0   0  108  266   30  EQKEKEVEEEEEEE EEEDEEEGEEEDEEEEEEE            DDDD   D   D        D   
   453  194 C G  T < 5S+     0   0   55  266   45  DPDDDDGDDDDDDD DDDDDDDDDDDDDDDDDDD            NNNN   N   N        A   
   454  195 C Y      < -     0   0   50  266   25  FYPFFFYFFFFFFF FFFFFFFFFFFFFFFFFFF            FFFF   F   F        F   
   455  196 C D        -     0   0   39  116    5  ..G........... ...................            ....   .   .        .   
   456  197 C W        -     0   0   10  123    9  .FW........... ...................            ....   .   .        .   
   457  198 C L  E     -y  701   0E   0  266   29  VIILLLVVVVVVVV VVVIVVLVVVILVVVVVVV            LIII   I   I        V   
   458  199 C I  E     -y  702   0E   2  266   51  VNYVIVTVVVVVLL VLLYLVVTVVVIVVVVVIV            TTTT   T   T        H   
   459  200 C M  E     -yz 703 739E   0  266   26  FFLLLLNFFFFFFF FFFMFFLFFFFLFFFFFFF            MMMM   M   M        M   
   460  201 C T  E     - z   0 740E   0  266   13  TTTSTTNTTTTTTT TTTTTTSTTTTTTTTTTTT            TTTT   T   T        T   
   461  202 C P        +     0   0   28  266   31  TPPPPPDTTTTTTT TTTPTTPTTTTPTTTTTTT            PPPP   P   P        P   
   462  203 C G  S    S+     0   0   54  266    0  GGGGGGSGGGGGGG GGGGGGGGGGGGGGGGGGG            Gggg   g   g        g   
   463  204 C V              0   0   12  266   14  VIVVVVVVVVVVVV VVVVVVVVVVVVVVVIIVI            Vlll   l   l        l   
   464  205 C G              0   0   61  266   52  nnqggggnnnssnn nnngnngnnsngnnnnnnn            kppp   p   p        p   
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54  qtirrrrqqqqqqq qqqrqqrqqqqrqqqqqqq            tnnn   n   n        n   
   467  219 C T     >  -     0   0   79  264    8  TTTTTTTTTTTTTT TTTTTTSTTTTTTTTTTTT            STTT   T   T        T   
   468  220 C V  H  > S+     0   0   11  264   49  PPPPPPPPPPPPPP PPPPPPPPPPPPPPPPPPP            PPPP   P   P        P   
   469  221 C D  H  > S+     0   0   79  265   63  TYERRREAAAAAEE AEEQQAHRGTERQAAAAAE            RHHH   H   H        A   
   470  222 C D  H  > S+     0   0   59  265   63  TKQEEQNSSSSSSS SSSQSGQSSSAQSSSEEAA            QKKK   K   K        S   
   471  223 C V  H  X>S+     0   0    0  265   45  AAAVVVVAAAAAAA AAAVAAVAAAAVAAAAAAA            ILLL   L   L        I   
   472  224 C V  H ><5S+     0   0    0  265   19  MIIVIIIIIIVVIV VVVIVVIVVVIIIVVVVVI            VIII   I   I        I   
   473  225 C S  H 3<5S+     0   0   52  266   85  AVILFLLGGGEEAG GGGLEAYLGEKLGGGGGGR            YYYY   F   F        G   
   474  226 C T  H 3<5S-     0   0   59  266   80  GeqededRRRRRGR RRRdANeGRRReRRRRRGG            eddd   e   d        v   
   475  227 C G  T <<5S+     0   0    8  266    4  GgeggggGGGGGGG GGGhGGgGGGGgGGGGGGG            gggg   g   g        g   
   476  228 C S      < -     0   0    0  266   60  STTCCCSAAAAAAA AAACAAASAAACAAAAASS            SCCC   C   C        S   
   477  229 C D  S    S+     0   0    0  266    0  DDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDD            DDDD   D   D        D   
   478  230 C I  E     - z   0 720E   0  266   33  FVIVVVIFFFFFFF FFFVFFVFFFFVFFFFFFF            VIII   I   I        I   
   479  231 C I  E     -sz 552 721E   0  266   11  LIIIIIIIIIIIII IIIIIIIIIIIIIIIIIII            VIII   I   I        A   
   480  232 C I  E     -s  553   0E   7  266    0  IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIII            IIII   I   I        I   
   481  233 C V  E     +s  554   0E   2  266   36  AVVVVVVAAASSSS SSSVAAVAASSVASSAAAA            VVVV   V   V        V   
   482  234 C G    >   +     0   0   22  266    0  GGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG            GGGG   G   G        G   
   483  235 C R  T 3> S+     0   0  121  266    0  RRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRR            RRRR   R   R        R   
   484  236 C G  T 34 S+     0   0   21  266    0  GGGGGGNGGGGGGG GGGGGGGGGGGGGGGGGGG            GGGG   G   G        G   
   485  237 C L  T <4 S+     0   0    0  266   26  IIIVIIIIIIIIII IIIIIIIIIIIIIIIIIII            IIII   I   I        I   
   486  238 C F  T  4 S+     0   0   27  266   29  YYIYYYYYYYYYYY YYYYYYYLYYYYYYYYYYY            IVVV   V   V        I   
   487  239 C A  S >< S+     0   0   10  266   52  ANGgggAAAAAAAA AAAGAAgGKAAgTAAAASA            ERRR   R   R        K   
   488  240 C K  T 3  S-     0   0  178  164   62  ...ldeS....... ......s....l.......            ....   .   .        .   
   489  241 C G  T 3  S+     0   0   83  266   55  ASATNPGAAAAAAA AAASVSDAAATVAAAAAAS            AAAA   A   A        A   
   490  242 C R    <   -     0   0  111  266   76  AQKEESKPPPEEPP SPPKPEQTDESDPLSGGEE            DQQQ   E   E        N   
   491  243 C D     >  -     0   0   96  266   30  DNDKSTDDDDDDDD DDDNDDASDDDEDDDDDDD            NDDD   D   D        D   
   492  244 C A  H  > S+     0   0    8  266   56  PPPIIIIPPPPPPP PPPMPAIPPPPIPPPAARR            RRRR   R   R        P   
   493  245 C K  H  > S+     0   0   83  265   82  VEAARAVVVVLLVV VVVVVVIVVLIRVVVVVVV            AKKK   V   V        F   
   494  246 C V  H  > S+     0   0   81  265   81  SKMEKATQQQEEEE EEEEASSAEEQAEEEAAQQ            ESSS   A   A        E   
   495  247 C E  H  X S+     0   0   22  265   50  AMTQDKEAAAAAAA AAARSAQEAAAQAAAAAAA            EEEE   E   E        E   
   496  248 C G  H  X S+     0   0    0  265   42  VAAASATAAAVVAI VIIAAAAAVVAAAVVAAAA            AAAA   A   A        A   
   497  249 C E  H  X S+     0   0   67  265   58  KRKKEELQQQLLRK LKKKKEIIQLKKKQQKKKK            EEEE   E   E        E   
   498  250 C R  H  X S+     0   0  141  265   28  EQQRRRKQQQRRQQ RQQAAARRRRLRQRRRRQQ            RRRR   R   R        R   
   499  251 C Y  H  X S+     0   0   20  265    0  YYYYYYYYYYYYYY YYYFYYYYYYYYYYYYYYY            YYYY   Y   Y        Y   
   500  252 C R  H  X S+     0   0   41  265   36  QRRRRMKQQQRRQQ RQQKKRKRRRQMQRRRRQQ            RRRR   R   R        R   
   501  253 C K  H  X S+     0   0  101  265   61  KEEDKANKKKEESA EAAEEKQREENEQEEDDEA            KKKK   K   K        S   
   502  254 C A  H  X S+     0   0   28  265   48  ALNEEEAEEEEEAA EAAAEAAEEEEAQEEEEEE            EAAA   A   A        A   
   503  255 C G  H  X S+     0   0    0  265   15  GGAGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG            AAAA   A   A        A   
   504  256 C W  H  X S+     0   0   22  265    0  WWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWW            WWWW   W   W        W   
   505  257 C E  H  X S+     0   0   86  265   62  DDQKEAKEEEKKNN RSSSNEEEKKAEERRNKAA            ATTT   S   A        K   
   506  258 C A  H  X S+     0   0    2  265    2  AAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAA            AAAA   A   A        A   
   507  259 C Y  H  < S+     0   0   25  262    0  YYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYY            YYYY   Y   Y        Y   
   508  260 C L  H  < S+     0   0  108  258   55  LQLLEQMLLLLLLL LLLQLEILELEQLLLLLEV            EEEE   E   E        T   
   509  261 C R  H  < S+     0   0  136  258   68  RKRESETAAAEEQQ EKKQGNNDKETDAEEQQAA            EEEE   E   E        E   
   510  262 C R  S  < S-     0   0   31  254    5  RRSRRRRRRRRRRR RRRRRRRRRRRRRRRRRRR            RRRR   R   R        R   
   511  263 C C        -     0   0   48  210   53    CTC IVVVVVVI VIIIL  TVVIVVVVVVII            IVVV   I   I        V   
   512  264 C G        -     0   0   35  164   41    GA  SGGG   S  SS S  GG KSG  GGSG            A                       
   513  265 C Q              0   0  142  129   68    N    GGG   Q  RR K  Q  NA      P            K                       
   514  266 C Q              0   0  185   69   46    E    NNN   K     D  R  RQ                   K                       
## ALIGNMENTS  491 -  548
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1    3 A K              0   0   88  128   55   TK KT Q   TKK  KK K KKKKKQ   KK      KKK K     KKK   KK  
     2    4 A A        -     0   0   48  149   71   QA AT S   TAA  TT A MAATQK   AT      ATT T     TTT   SA  
     3    5 A T     >  -     0   0   57  246   38   ST TT T   TTT  TP T TTTTSS   TS      TSP T     PPS   TT  
     4    6 A Y  H  > S+     0   0    0  278    1   YF YY Y   YFF  FY Y YFFFFF   FF      FFF F     FFF   YF  
     5    7 A K  H  > S+     0   0  120  278   72   GA AR S   RAA  AA A AAAAAA   AE      AEG A     GGE   SA  
     6    8 A E  H  > S+     0   0  109  278   63   ES SA A   SSA  AQ S QSSAEE   SD      ADT A     TTD   TA  
     7    9 A R  H >X S+     0   0    6  278    0   RR RR R   RRR  RR R RRRRRR   RR      RRR R     RRR   RR  
     8   10 A A  H 3< S+     0   0    7  278   23   SA AA A   AAS  SA S AAASVV   AA      AGA S     AAG   AS  
     9   11 A A  H 3< S+     0   0   88  279   72   eE Qa E   nEE  EE QNKEEEEE   ES      QSQ E     QQS   EE  
    10   12 A T  H << S+     0   0  114  278   80   gT Sp R   pTT  TT TSTTTASS   TK      TNS A     SSN   TT  
    11   13 A H     <  -     0   0   22  279   56   NT AS A   SAA  AA ANAAATSS   AT      ATA T     AAT   VA  
    12   14 A P  S    S+     0   0   62  280   63   LT TV T   TTT  TQ ENTTTTTS   TK      TKG T     GGK   TT  
    13   15 A S     >  -     0   0    1  281   63   TH HG H   THH  HH HTHHHHHH   HH      HHH H     HHH   HH  
    14   16 A P  H  > S+     0   0   79  281   27   PP PP P   PPP  PP PPPPPPPP   PP      PPP P     PPP   PP  
    15   17 A V  H  > S+     0   0    0  283   52   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    16   18 A A  H  > S+     0   0    0  283   37   AT NA N   AST  TS NASSSTTT   ST      TTS T     SST   ST  
    17   19 A A  H  X S+     0   0   18  283   69   HT AS A   SRA  AS ATSRRSSS   RA      AAS S     SSA   AA  
    18   20 A K  H  X S+     0   0   72  283   81   YY YY Y   YHY  YY YYYHHYYY   HY      YYY Y     YYY   YY  
    19   21 A L  H  X S+     0   0    0  283    2   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    20   22 A F  H  X S+     0   0    0  283   14   LL FL F   LYF  FL FFLYYLFF   YL      FLL L     LLL   YF  
    21   23 A N  H  X S+     0   0   58  283   71   RR KS R   SKK  KR KRRKKRRR   KR      RRR R     RRR   KK  
    22   24 A I  H  X S+     0   0    3  283   39   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    23   25 A M  H  X>S+     0   0    0  284   48   IM MI M   IMM  MM MMMMMMMM   MM      MMM M     MMM   MM  
    24   26 A H  H ><5S+     0   0   74  284   50   HD DA D   SDD  DA DHADDDEE   DT      DTE D     EET   DD  
    25   27 A E  H 3<5S+     0   0  127  284   87   TL LA L   ILL  LL LIMLLLVV   LL      LLL L     LLL   LL  
    26   28 A K  H 3<5S-     0   0   39  284    0   KK KK K   KKK  KK KKKKKKKK   KK      KKK K     KKK   KK  
    27   29 A Q  T <<5 +     0   0  110  284   53   RA AH A   KAA  AR ARKAAAQQ   AQ      AQQ A     QQQ   AA  
    28   30 A T      < +     0   0    0  284   41   TS SS S   TSS  SS STSSSSSS   SS      SSS S     SSS   SS  
    29   31 A N        +     0   0    0  284    0   NN NN N   NNN  NN NNNNNNNN   NN      NNN N     NNN   NN  
    30   32 A L  E     -a  229   0A   0  284   14   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    31   33 A C  E     -ab 230  55A   0  284   42   CC CC C   CCC  CC CCCCCCCC   CC      CCC C     CCC   CC  
    32   34 A A  E     -ab 231  56A   0  283   58   VL LL L   LLL  LL LVLLLLLL   LV      LVL L     LLV   LL  
    33   35 A S  E     - b   0  57A  15  284    9   SS SS S   SSS  SS SSSSSSSS   SS      SSS S     SSS   SS  
    34   36 A L        +     0   0    3  284   60   AA AA A   AAA  AA AAAAAAAA   AA      AAA A     AAA   AA  
    35   37 A D        +     0   0   42  284    0   DD DD D   DDD  DD DDDDDDDD   DD      DDD D     DDD   DD  
    36   38 A V        -     0   0    8  284    9   VV VV V   VVV  VV VVVVVVVV   VV      VVV V     VVV   VV  
    37   39 A R  S    S+     0   0  162  284   66   TP AE T   DAP  PS ATTAAPEE   AS      SST P     TTS   AP  
    38   40 A T     >  -     0   0   42  284   42   TT TT N   TTT  TT TTTTTTHH   TT      TTT T     TTT   NT  
    39   41 A T  H  > S+     0   0    4  284   55   TA AS A   TAA  AT ATAAAAAA   AA      AAA A     AAA   AA  
    40   42 A K  H  > S+     0   0  115  284   69   TR RA R   ARR  RN RNNRRRRR   RG      RGR R     RRG   RR  
    41   43 A E  H  > S+     0   0   74  284   28   EE EE E   EEE  EQ EEQEEEDE   EE      EEE E     EEE   EE  
    42   44 A L  H  X S+     0   0    4  284   11   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    43   45 A L  H  X S+     0   0   40  284    4   LL LI L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    44   46 A E  H  X S+     0   0  112  284   81   KY YQ Y   QYY  YS YRSYYYAA   YR      HRY Y     YYR   HY  
    45   47 A L  H  X S+     0   0   19  284   26   VL FL L   LFL  LL AVLFFLLL   FL      LLL L     LLL   VL  
    46   48 A V  H  X S+     0   0    0  283   55   AA AA A   AAA  AA AAAAAAAA   AA      AAA A     AAA   AA  
    47   49 A E  H  < S+     0   0   79  284   22   ED DE D   EDD  DN DENDDDDD   DN      DDE D     EED   DD  
    48   50 A A  H  < S+     0   0   24  284   75   EK KD K   DKK  KA KENKKKKK   KA      KSK K     KKS   KK  
    49   51 A L  H >X S+     0   0    0  282   33   VV LV V   VII  IV LVIIIIVI   IV      VVA I     AAV   VI  
    50   52 A G  G >< S+     0   0    0  282    3   GG GG G   GGG  GG GGGGGGGG   GG      GGG G     GGG   GG  
    51   53 A P  G 34 S+     0   0   50  284   18   DP PD P   DPP  PP PDPPPPPP   PP      PPP P     PPP   PP  
    52   54 A K  G <4 S+     0   0   45  284   77   HS SS S   SSS  SS SHSSSSSS   SS      SSS S     SSS   SS  
    53   55 A I    <<  -     0   0    0  284   14   II II I   III  II IIIIIIII   II      III I     III   II  
    54   56 A C  S    S+     0   0    1  283   49   CV VC V   CVV  VV VCVVVVVV   VV      VVV V     VVV   VV  
    55   57 A L  E     -bc  31  85A   0  283   32   VV VL V   LVV  VV VIVVVVVV   VV      VVV V     VVV   VV  
    56   58 A L  E     -bc  32  86A   1  283   30   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    57   59 A K  E     -bc  33  87A  20  283    2   KK KK K   KKK  KK KKKKKKKK   KK      KKK K     KKK   KK  
    58   60 A T  E     - c   0  88A   2  281    3   TT TT T   TTT  TT TTTTTTTT   TT      TTT T     TTT   TT  
    59   61 A H    >>  +     0   0   18  281    2   HH HH H   HHH  HH HHHHHHHH   HH      HHH H     HHH   HH  
    60   62 A V  G >4  +     0   0    2  283   49   AH YC Y   CYY  YY YAYYYYYY   YY      HYY Y     YYY   YY  
    61   63 A D  G 34 S+     0   0   18  283    2   DD DD D   DDD  DD DDDDDDDD   DD      DDD D     DDD   DD  
    62   64 A I  G <4 S+     0   0   15  283   18   II MI L   IMM  ML MILMMMLL   ML      VLL M     LLL   MM  
    63   65 A L    <<  -     0   0   15  284   28   IV VV I   VVV  VV VVIVVVII   VI      VII V     III   VV  
    64   66 A T  S    S+     0   0   99  284   65   Ts sT s   Sas  sa sSsaastt   an      ans s     ssn   as  
    65   67 A D  S    S+     0   0   33  284    1   Dd dD d   Ddd  dd dDdddddd   dd      ddd d     ddd   ds  
    66   68 A F        +     0   0   29  284    6   FY FW Y   WFF  FY FFYFFFYY   FY      FYY F     YYY   FH  
    67   69 A S     >> -     0   0   39  279   61   GN HS N   SDH  HH HGSDDHHH   DS      NNS H     SSN   TP  
    68   70 A M  I  4>S+     0   0   38  283   97   Ep pD p   Dpp  pp pEpppppp   pp      ppp p     ppp   pE  
    69   71 A E  I  45S+     0   0  109  157   60   .t t. t   .tt  ts t.tttttt   tt      ttt t     ttt   tT  
    70   72 A G  I  45S+     0   0   16  283   60   RG GR G   RGG  GG GKGGGGGG   GG      GGG G     GGG   GG  
    71   73 A T  I  X5S+     0   0    2  283   43   TT TT T   STT  TT TTTTTTTT   TT      TTT T     TTT   TT  
    72   74 A V  I  > S+     0   0   37  284   73   GK KA K   AKQ  QR KGRKKKKK   KR      RRK K     KKR   RQ  
    75   77 A L  H  X S+     0   0    2  284    1   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    76   78 A K  H  X S+     0   0   64  283   80   NA AR A   KAA  AA ANAAAAAA   AN      ANA A     AAN   AA  
    77   79 A A  H  X S+     0   0   60  284   64   DA SE A   ESS  TR SEESSSAA   SR      QRA S     AAR   KS  
    78   80 A L  H  X S+     0   0   14  284   11   VL LI L   ILL  LL LIILLLLL   LL      LLL L     LLL   LL  
    79   81 A S  H  X>S+     0   0   14  284   35   AA AA A   AAA  AA AAAAAAAA   AA      AAA A     AAA   AA  
    80   82 A A  H  <5S+     0   0   81  284   70   RR RV R   RRR  RR RRRRRRRR   RR      RRR R     RRR   RR  
    81   83 A K  H  <5S+     0   0  142  284   20   RK RR K   RKK  KK RRRKKKKK   KR      KRR K     RRR   KK  
    82   84 A Y  H  <5S-     0   0   52  284   36   KH HK H   KHH  HH HKYHHHHH   HH      HHF H     FFH   HH  
    83   85 A N  T  <5 +     0   0   64  284   57   HG GS G   RGG  GG GKNGGGGG   GG      GGG G     GGG   GG  
    84   86 A F      < -     0   0    3  284    0   FF FF F   FFF  FF FFFFFFFF   FF      FFF F     FFF   FF  
    85   87 A L  E     -c   55   0A   8  284   10   VL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
    86   88 A L  E     -c   56   0A   0  284   12   VI II I   III  II IVIIIIII   II      III I     III   II  
    87   89 A F  E     -cd  57 116A   0  284    0   FF FF F   FFF  FF FFFFFFFF   FF      FFF F     FFF   FF  
    88   90 A E  E     -c   58   0A   0  284    0   EE EE E   EEE  EE EEEEEEEE   EE      EEE E     EEE   EE  
    89   91 A N  E     +     0   0A   4  284    0   DD DD D   DDD  DD DDDDDDDD   DD      DDD D     DDD   DD  
    90   92 A R  E     -     0   0A  40  284    0   RR RR R   RRR  RR RRRRRRRR   RR      RRR R     RRR   RR  
    91   93 A K  E     - d   0 118A  36  284    0   KK KK K   KKK  KK KKKKKKKK   KK      KKK K     KKK   KK  
    92   94 A F  E     + d   0 119A   4  284    0   FF FF F   FFF  FF FFLFFFFF   FF      FFF F     FFF   FF  
    93   95 A A        +     0   0    6  283   47   GG AA C   AGG  GG GFGGGGVV   GG      GGA G     AAG   GG  
    94   96 A D        -     0   0   13  283    0   DD DD D   DDD  DD DDDDDDDD   DD      DDD D     DDD   DD  
    95   97 A I    >>  +     0   0   57  283    1   II II I   III  II IIIIIIII   II      III I     III   II  
    96   98 A G  H 3> S-     0   0   37  283    0   GG GG G   GGG  GG GGGGGGGG   GG      GGG G     GGG   GG  
    97   99 A N  H 3> S+     0   0  113  283   28   NN NE K   ENH  HH NNNNNHSS   NN      NNK H     KKN   NH  
    98  100 A T  H <> S+     0   0   17  283    1   TT TT T   TTT  TT TTTTTTTT   TT      TTT T     TTT   TT  
    99  101 A V  H  X S+     0   0    0  283    3   VV VV V   VVV  VV VVVVVVVV   VV      VVV V     VVV   VV  
   100  102 A K  H  X S+     0   0   21  283   59   QQ EQ Q   QEE  EQ EQQEEEQQ   EQ      QQQ E     QQQ   EE  
   101  103 A L  H  X S+     0   0   63  283   75   QM LK M   KLL  LL LLLLLLKK   LL      LLM L     MML   LL  
   102  104 A Q  H  < S+     0   0   28  283    0   QQ QQ Q   QQQ  QQ QQQQQQQQ   QQ      QQQ Q     QQQ   QQ  
   103  105 A Y  H  < S+     0   0    0  284    0   YY YY Y   YYY  YY YYYYYYYY   YY      YYY Y     YYY   YY  
   104  106 A S  H  < S+     0   0   26  284   77   VV IT T   TTT  TT TSTTTTTT   TT      VTT T     TTT   TT  
   105  107 A A     X  +     0   0   38  284   52   GA GS A   SSG  GE GGESSSAA   SE      AEA S     AAE   QG  
   106  108 A G  T  4 S-     0   0   47  284    0   GG GG G   GGG  GG GGGGGGGG   GG      GGG G     GGG   GG  
   107  109 A V  T  4 S+     0   0   67  284   67   PT SH T   HAS  ST SPTAASTT   TT      STT S     TTT   AS  
   108  110 A Y  T  4 S-     0   0   37  284   72   LA AH A   HAA  AA ALAAAAAA   AA      AAA A     AAA   AA  
   109  111 A R    ><  -     0   0   93  284   34   QR RR R   RRR  RK RCRRRRRR   RK      RKR R     RRK   RR  
   110  112 A I  G >> S+     0   0    1  284    2   II II I   III  II IIIIIIII   II      III I     III   II  
   111  113 A A  G 34 S+     0   0    0  284   58   VI IA V   AII  II VVIIIIVV   II      III I     III   II  
   112  114 A E  G <4 S+     0   0   71  284   59   RE EL E   LED  DE EREEEDEE   EE      EEE D     EEE   ED  
   113  115 A W  T <4 S+     0   0    2  284    0   WW WW W   WWW  WW WWWWWWWW   WW      WWW W     WWW   WW  
   114  116 A A     <  -     0   0    0  284   29   AA AA A   AAA  AA AASAAAAA   AS      ASA A     AAS   AA  
   115  117 A D  S    S+     0   0   10  284   44   PH HE H   EHH  HH HPHHHHHH   HH      HHH H     HHH   HH  
   116  118 A I  E     +de  87 144A   0  284    8   II II I   III  II IIIIIIII   II      TII I     III   II  
   117  119 A T  E     - e   0 145A   0  284   42   VT VT T   TTV  VT IVITTVTT   TT      STT V     TTT   VV  
   118  120 A N  E     -de  91 146A   0  284    3   NN NN N   NNN  NN NNNNNNNN   NN      TNN N     NNN   NN  
   119  121 A A  E     -de  92 147A   0  284   46   CV VA M   AVV  VV VAVVVVAA   VV      SVI V     IIV   VV  
   120  122 A H        -     0   0    0  284   53   HN NH N   HNN  NN NSNNNNDD   NN      TNN N     NNN   NN  
   121  123 A G  S >  S+     0   0    0  283   80   IM MV I   VMM  MM MIMMMMII   MM      WMI M     IIM   MM  
   122  124 A V  T 3  S+     0   0    0  284   33   FV VL S   LVV  VV VHVVVVHH   VI      FIH V     HHI   VV  
   123  125 A V  T 3  S-     0   0    4  284   51   PP PP A   PPP  PP PSPPPPAA   PP      PPA P     AAP   PP  
   124  126 A G    X   -     0   0    0  284    1   GG GG G   GGG  GG GGGGGGGG   GG      AGG G     GGG   GG  
   125  127 A P  T >> S+     0   0   44  284   67   PK KP K   PKK  KK KPKKKKEE   KK      RKK K     KKK   KK  
   126  128 A G  H 3> S+     0   0   25  284   30   AA AA D   AAA  AA AAAAAAAA   AA      PAD A     DDA   AA  
   127  129 A I  H <> S+     0   0    0  284   36   VA SI A   ISS  SA SIVSSSMM   SS      PSS S     SSS   SS  
   128  130 A V  H <> S+     0   0    2  284   13   IV VV V   VVV  VV VIVVVVVV   VV      SVV V     VVV   VV  
   129  131 A S  H  X S+     0   0   71  284   73   TT TT T   TTA  AD TPSTTASS   AD      RDR A     RRD   TA  
   130  132 A G  H  X S+     0   0    7  284   35   AA SA A   ASS  SA SAASSSAA   SS      PSA S     AAS   SS  
   131  133 A L  H  X S+     0   0    0  284    1   LL LL L   LLL  LL LLLLLLMM   LL      SLL L     LLL   LL  
   132  134 A K  H  X S+     0   0   50  284   66   SA AE A   EAA  AS AAAAAAAA   AA      PAA A     AAA   AA  
   133  135 A Q  H  X S+     0   0   93  284   56   QE NK E   KHQ  QD NEQHHQQQ   HE      REE Q     EEE   NQ  
   134  136 A A  H  X S+     0   0    0  284   57   AA AA A   AAG  GA AAAAAGAA   AA      PAA G     AAA   AG  
   135  137 A A  H  X S+     0   0    6  284   28   AA AA A   AAA  AA AAAAAAAA   AA      RAA A     AAA   AA  
   136  138 A E  H  < S+     0   0  132  284   84   qa te a   dnk  kv kqennrqq   na      qaa r     aaa   ak  
   137  139 A E  H  < S+     0   0  129  222   34   ki ee e   qdf  ee ededdgee   dp      eeg g     gge   af  
   138  140 A V  H  < S+     0   0   49  284   90   ne Ed e   dep  Ee EEAeeiee   eg      eAi i     iiA   gp  
   139  141 A T     <  -     0   0   33  208   67   pp .n p   npe  .p .GPppepp   pe      pPp e     ppP   ee  
   140  142 A K  S    S+     0   0  181  232   87   PV AL S   LIA  AM ADMIIALL   IA      MLL A     LLL   PA  
   141  143 A E  S    S-     0   0   78  236   37   pD pd D   dEp  pD pDEEEpDD   Ep      EEE p     EEE   pp  
   142  144 A P        -     0   0   37  195   61   y. aa .   a.s  n. tP...n..   .e      ... n     ...   ns  
   143  145 A R        -     0   0   15  282   12   RR RS R   TRR  RR RERRRRRR   RR      RRR R     RRR   RR  
   144  146 A G  E     -e  116   0A   0  284   15   SG GE G   DGG  GG GAGGGGGG   GG      GGG G     GGG   GG  
   145  147 A L  E     -ef 117 177A   0  284    4   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
   146  148 A L  E     -ef 118 179A   0  284    8   LL LI L   LLL  LL LNLLLLLL   LL      LLL L     LLL   LL  
   147  149 A M  E     -ef 119 180A   0  284   38   II IR I   RII  II IQIIIIII   II      III I     III   II  
   148  150 A L  E     + f   0 181A   3  284    1   LL LL L   LLL  LL LLLLLLLL   LL      LLL L     LLL   LL  
   149  151 A A        +     0   0    0  284    7   AA Ag A   gAA  AA AgAAAAAA   AA      AAA A     AAA   AA  
   150  152 A E  S    S-     0   0   27  283   23   QQ Qe Q   eQQ  QQ QqQQQQQQ   QQ      QQQ Q     QQQ   QQ  
   151  153 A L        -     0   0   23  283    7   MM MM M   MMM  MM MMMMMMMM   MM      MMM M     MMM   MM  
   152  154 A S        +     0   0   75  283   27   SS SS S   SSS  SS SSSSSSSS   SS      SSS S     SSS   SS  
   153  155 A C  S >  S-     0   0   28  284   20   SS SS S   SSS  SS SSSSSSSS   SS      SSS S     SSS   SS  
   154  156 A K  T 3  S+     0   0  188  284   47   AA AE K   EQQ  QQ AAEQQEKK   QA      AAK E     KKA   AQ  
   155  157 A G  T 3  S+     0   0   44  283    1   NG GG G   GGG  GG GNGGGGGG   GG      GGG G     GGG   GG  
   156  158 A S    <   -     0   0   36  284   53   NN NH C   HNN  NN NNNNNNCC   NN      NNC N     CCN   NN  
   157  159 A L        +     0   0   20  284   10   FF FL L   LFF  FF FYFFFFLL   FF      FFL F     LLF   FF  
   158  160 A A        +     0   0   18  284   49   FM MM M   MMM  MM MFMMMMMM   MM      MMM M     MMM   MM  
   159  161 A T     >  -     0   0   66  284   73   TN NT T   TNN  NT NTTNNTDD   NT      NTT T     TTT   NN  
   160  162 A G  H  > S+     0   0   48  284   37   PK KP P   PKK  KK RPRKKGGG   KR      QRP G     PPR   AK  
   161  163 A E  H  > S+     0   0  123  284   48   EE ED D   EEE  EE EEEEEEKK   ED      EDD E     DDD   EE  
   162  164 A Y  H  > S+     0   0    9  283    0   YY YY Y   YYY  YY YYYYYYYY   YY      YYY Y     YYY   YY  
   163  165 A T  H  X S+     0   0    3  284   16   TT TQ T   QTT  TT TTTTTTTT   TT      TTT T     TTT   TT  
   164  166 A K  H  X S+     0   0  112  284   70   AQ QQ Q   KQQ  QD EANQQQWW   QN      QDA Q     AAD   QQ  
   165  167 A G  H  X S+     0   0   13  284   74   AA AK A   EAA  AA ADAAAAEE   AA      AAA A     AAA   AA  
   166  168 A T  H  X S+     0   0    0  284   59   CC CT C   TCC  CC CCCCCCCC   CC      CCC C     CCC   CS  
   167  169 A V  H  X S+     0   0   15  284   12   LV VV V   VVV  VV VLVVVVVV   VV      VVV V     VVV   VV  
   168  170 A D  H  X S+     0   0   84  284   43   KE EE E   KEE  EE EKAEEEKK   EE      EEE E     EEE   EE  
   169  171 A I  H >< S+     0   0    9  284   69   HA AI A   IAA  AS AHAAAAAA   AS      ASA A     AAS   AA  
   170  172 A A  H >< S+     0   0    0  283    1   AA AA A   AAA  AA AAAAAAAA   AA      AAA A     AAA   AA  
   171  173 A K  H 3< S+     0   0   51  284   31   RR RR R   RRR  RR RRRRRRRR   RR      RRR R     RRR   RR  
   172  174 A S  T << S+     0   0   75  283   74   EE EN E   NEE  EE EEDEEEKK   EE      EEE E     EEE   EE  
   173  175 A D    <>  +     0   0   26  284   68   NN HH H   HHH  HH HNHHHHNN   HH      NHN H     NNH   HH  
   174  176 A K  T  4 S+     0   0   75  284   44   SK KR K   SKK  KK KKQKKKKK   KK      RKR K     RRK   KK  
   175  177 A D  T  4 S+     0   0   90  284   44   EG DD D   END  DG EDNNNDGD   SQ      NER D     RRE   DD  
   176  178 A F  T  4 S+     0   0    8  284    5   FF FF F   FFF  FF FFFFFFFF   FY      FYF F     FFY   FF  
   177  179 A V  E  <  +f  145   0A   1  284    4   VV VV V   VVV  VV VVVVVVVV   VV      VVV V     VVV   VV  
   178  180 A I  E     -     0   0A   0  283   40   MM MM M   MMM  MM MMMMMMMM   MM      MMM M     MMM   MM  
   179  181 A G  E     -fg 146 196A   0  284    0   GG GG G   GGG  GG GGGGGGGG   GG      GGG G     GGG   GG  
   180  182 A F  E     -fg 147 197A   0  284    0   FF FF Y   FFF  FF FFFFFFYY   FF      YFF F     FFF   FF  
   181  183 A I  E     +fg 148 198A  10  283   12   IV VI V   IVI  II VIIVVIVV   VI      VIV I     VVI   VI  
   182  184 A A        -     0   0    0  283   33   AS SA A   ASS  SS SASSSSAA   SS      SSA S     AAS   SS  
   183  185 A Q  S    S+     0   0   34  284   49   Qq qQ Q   Qqq  Qq qqqqqQqq   qQ      qqQ q     QQq   qq  
   184  186 A R  S    S-     0   0  108  284   68   kp pr e   rpp  ek ppsppets   pe      ppe p     eep   pp  
   185  187 A D        -     0   0   38  204   79   m. .l l   l..  l. .....lee   .l      ..l .     ll.   ..  
   186  188 A M        -     0   0   22  215   84   N. .N N   N..  N. .....NEE   .N      ..N .     NN.   ..  
   187  189 A G        +     0   0   24  220   62   E. .T S   T..  T. .....TEE   .T      ..S .     SS.   ..  
   188  190 A G    > > +     0   0   12  245   65   K. .E E   E..  E. .....QAA   .E      ..E .     EE.   ..  
   189  191 A R  G > 5S+     0   0  123  260   82   P. .P A   P..  A. .....AQQ   .A      ..A .     AA.   ..  
   190  192 A D  G 3 5S+     0   0  175  284   41   ED DD G   NED  DG EEDEEDAA   ED      DDD D     DDD   DD  
   191  193 A E  G < 5S-     0   0  111  284   28   DD DD E   DDD  DD DDDDDDDD   DD      DDD D     DDD   DD  
   192  194 A G  T < 5S+     0   0   49  284   45   NA KN D   NDA  AA QNMDDDNN   DD      ADD D     DDD   DA  
   193  195 A Y      < -     0   0   42  284   24   FF FF F   FFF  FF FFFFFFFF   FF      FFF F     FFF   FF  
   194  196 A D        -     0   0   38  116    1   .. .. .   ...  .. ........   ..      ... .     ...   ..  
   195  197 A W        -     0   0   12  124    7   .. .. .   ...  .. ........   ..      ... .     ...   ..  
   196  198 A L  E     -g  179   0A   0  284   28   II II I   III  VI IILIIIII   II      IIL I     LLI   II  
   197  199 A I  E     -g  180   0A   1  284   59   TH HT H   THH  HT HTSHHHHH   HS      HST H     TTS   HH  
   198  200 A M  E     -gh 181 228A   0  284   23   MM MM M   MMM  MM MMMMMMMM   MM      MMM M     MMM   MM  
   199  201 A T  E     - h   0 229A   0  284   11   TT TT T   TTT  TT TTTTTTTT   TT      TTT T     TTT   TT  
   200  202 A P        +     0   0   31  284   27   PP PP P   PPP  PP PPPPPPPP   PP      PPP P     PPP   PP  
   201  203 A G  S    S+     0   0   33  284    0   GG GG G   GGG  GG GGGGGGGG   GG      GGG G     GGG   GG  
   202  204 A V  E     +i  216   0B   8  284   31   VC CC C   CCC  CC CVCCCCCC   CC      CCC C     CCC   CC  
   203  205 A G  E     -i  217   0B   3  283   56   QQ QQ K   QQQ  QQ QQQQQQKK   QQ      QQK Q     KKQ   QQ  
   204  206 A L        -     0   0   35  283    8   LL LL L   LLL  LL MLLLLLLL   LL      LLL L     LLL   LL  
   205  207 A D        -     0   0   97  283   62   QP PP P   PPP  PP PQPPPPPP   PP      PPP P     PPP   PP  
   206  208 A D    >   -     0   0   41  283   76   AP PP P   PPP  PS PAPPPPPP   PP      PPP P     PPP   PP  
   207  209 A K  T 3  S+     0   0  216  283   49   GE eP e   PEE  ED eGEEEEPP   EE      EEq E     qqE   EE  
   208  210 A G  T 3  S+     0   0   77  258   14   GG e. e   .G.  .. eG.GG.GG   GN      GNe .     eeN   H.  
   209  211 A D    <>  +     0   0   42  265    9   DD D. E   .AD  D. DD.AADEE   AD      EDE D     EED   ED  
   210  212 A A  T  4 S+     0   0   76  266   64   GE Q. E   .DE  E. QGDDDEEE   DE      EEE E     EEE   EE  
   211  213 A L  T >4 S+     0   0   87  267   44   LE N. N   .ED  DF NKEEEDAA   EE      EDN D     NND   DD  
   212  214 A G  G >4 S+     0   0    9  281   17   GN GG G   GNQ  QE GGDNNQPP   NA      NAG Q     GGA   AQ  
   213  215 A Q  G 3< S+     0   0   89  282   19   Qs tq h   qeq  qd aQeeeqqq   ee      gep q     ppe   eq  
   214  216 A Q  G <  S+     0   0  148  282    3   Qq qq q   qqq  qq qQqqqqqq   qq      qqq q     qqq   qq  
   215  217 A Y  S <  S-     0   0  109  282    0   YY YY Y   YYY  YY YYYYYYYY   YY      YYY Y     YYY   YY  
   216  218 A R  E     -i  202   0B  69  282   57   NN NN N   NNN  NN NNNNNNNN   NN      NNN N     NNN   NN  
   217  219 A T  E  >  -i  203   0B  45  282    7   TT TT T   TTT  TT TTTTTTTT   TT      TTT T     TTT   TT  
   218  220 A V  H  > S+     0   0    0  282   47   PP PP P   PPP  PP PPPPPAPP   PP      PPP P     PPP   PP  
   219  221 A D  H  > S+     0   0   71  282   63   RQ QR S   HQH  HQ QDSQQHDD   QG      QSA H     AAS   EH  
   220  222 A D  H  > S+     0   0   67  282   64   KK KK K   KKK  KK KKKKKKNN   KK      KKK K     KKK   KK  
   221  223 A V  H  X>S+     0   0    0  282   45   VL IL L   LIL  IL IVIIIILL   IL      LLL I     LLL   LL  
   222  224 A V  H ><5S+     0   0    0  283   19   VV II I   III  II IIIIIIVV   IV      VVI I     IIV   II  
   223  225 A S  H 3<5S+     0   0   78  284   81   GE GL T   YGG  GG GGNGGGNN   GG      GGG G     GGG   GG  
   224  226 A T  H 3<5S-     0   0   58  284   84   el vd l   eii  lt iqliiiii   iL      lLL i     LLL   vi  
   225  227 A G  T <<5S+     0   0    6  284    3   gg gg g   ggg  gg gggggggg   gG      gGG g     GGG   gg  
   226  228 A S      < -     0   0    0  284   59   ST AC T   CAS  SN AANAASTT   AC      TCT S     TTC   AS  
   227  229 A D  S    S+     0   0    0  284    0   DD DD D   DDD  DD DDDDDDDD   DD      DDD D     DDD   DD  
   228  230 A I  E    S- h   0 198A   0  284   31   II IV I   III  II IVIIIIII   II      III I     III   II  
   229  231 A I  E     -ah  30 199A   0  284   19   IV VI V   IAA  AV VIIAAAAA   AV      VVV A     VVV   VA  
   230  232 A I  E     -a   31   0A   6  284    0   II II I   III  II IIIIIIII   II      III I     III   II  
   231  233 A V  E     +a   32   0A   1  284   33   VV VV V   VVV  VV VVVVVVVV   VV      VVV V     VVV   VV  
   232  234 A G    >   +     0   0   23  284    0   GG GG G   GGG  GG GGGGGGGG   GG      GGG G     GGG   GG  
   233  235 A R  G >> S+     0   0  126  284    0   RR RR R   RRR  RR RRRRRRRR   RR      RRR R     RRR   RR  
   234  236 A G  G 34 S+     0   0   18  284    0   GG GG G   GGG  GG GGGGGGGG   GG      GGG G     GGG   GG  
   235  237 A L  G <4 S+     0   0    0  284   25   II II I   III  II IIIIIIII   II      III I     III   II  
   236  238 A F  T <4 S+     0   0   24  284   34   IL LV I   VIL  LI LIIIILII   II      LII L     III   LL  
   237  239 A A  S >< S+     0   0   22  284   59   AK KR K   RKK  KK KaKKKKTT   KR      KRK K     KKR   KK  
   238  240 A K  T 3  S-     0   0  176  165   62   .. .. .   ...  .. .p......   ..      ... .     ...   ..  
   239  241 A G  T 3  S+     0   0   84  284   53   AA AA A   AAA  AA APAAAAAA   AA      AAA A     AAA   AA  
   240  242 A R    <   -     0   0   78  284   77   AG GH G   QSS  SD GGDSSSAS   SG      GED S     DDE   GS  
   241  243 A D     >  -     0   0   91  284   27   DD DD D   DDD  DD DENDDDDD   DD      DDD D     DDD   DD  
   242  244 A A  H  > S+     0   0    8  284   53   RP PR P   RPP  PP PRPPPPPP   PP      PPP P     PPP   LP  
   243  245 A K  H  > S+     0   0   92  283   82   RQ EK P   KEV  VV EMVEEVPP   EE      QKQ V     QQK   QV  
   244  246 A V  H  > S+     0   0   79  283   82   AS GS S   SEE  ER GKSEEEAA   EW      SWS E     SSW   HE  
   245  247 A E  H  X S+     0   0   23  283   47   AE EE E   EEE  EE ELEEEEEE   EE      EEE E     EEE   EE  
   246  248 A G  H  X S+     0   0    0  283   40   AA TA A   AAA  AA AAAAAAAA   AA      AAA A     AAA   AA  
   247  249 A E  H  X S+     0   0   55  283   56   LE EE E   EEE  EE EVEEEEEE   EE      EEE E     EEE   EE  
   248  250 A R  H  X S+     0   0   78  283   26   ER RR R   RRR  RR RERRRRRR   RR      RRR R     RRR   RR  
   249  251 A Y  H  X S+     0   0    9  283    0   YY YY Y   YYY  YY YYYYYYYY   YY      YYY Y     YYY   YY  
   250  252 A R  H  X S+     0   0   37  283   33   RR RR R   KRR  RR RRRRRRRR   RR      RRR R     RRR   RR  
   251  253 A K  H  X S+     0   0   95  283   64   KR SQ R   KSS  SK SRSSSSRR   SR      TRR S     RRR   SS  
   252  254 A A  H  X S+     0   0   16  283   49   QK AA K   AAA  AK AQKAAAKK   AK      RKK A     KKK   AA  
   253  255 A G  H  X S+     0   0    0  283   20   GA AA A   AAA  AA AGAAAAAA   AA      AAA A     AAA   AA  
   254  256 A W  H  X S+     0   0   19  283    0   WW WW W   WWW  WW WWWWWWWW   WW      WWW W     WWW   WW  
   255  257 A E  H  X S+     0   0   83  283   62   EK KA K   AKK  KQ KEKKKKKK   KE      KES K     SSE   KK  
   256  258 A A  H  X S+     0   0    1  283    1   AA GA A   AAA  AA AAAAAAAA   AA      AAA A     AAA   AA  
   257  259 A Y  H  < S+     0   0   21  281    0   YY YY Y   YYY  YY YYYYYYYY   YY      YYY Y     YYY   YY  
   258  260 A L  H  < S+     0   0  113  277   62   RL TE L   ETT  TE TKETTTQQ   TQ      LQQ T     QQQ   TT  
   259  261 A R  H  <        0   0  157  277   66   ES EE A   EEE  EE EQEEEEDD   EE      SEE E     EEE   EE  
   260  262 A R     <        0   0   89  273    4   RR RR R   RRR  RR RRRRRRRR   RR      RRR R     RRR   RR  
   261      ! !              0   0    0   0     0  
   262    3 C K              0   0   40  100   58  Q  T     KT   TK           KTT  KKTKK    K KKKKK   KTK  KQ
   263    4 C A        -     0   0   31  121   71  T  S    QAS   QA           ATQ  AATQA    Q AATAA   MQA  AS
   264    5 C T     >  -     0   0   47  219   38  P  T    PTT   TT           TTT  TTTSTT   S TTPTT   TST  TT
   265    6 C Y  H  > S+     0   0    0  253    0  Y  Y    YYY   FF           YYY  FFYFFY   F FFYFF   YYF  YY
   266    7 C K  H  > S+     0   0  122  253   72  E  R    SAR   AA           ARR  AARAAN   A AAAAA   AGA  AS
   267    8 C E  H  > S+     0   0   70  253   62  E  A    EST   EE           SAE  SSSESE   E RSQSS   QES  SA
   268    9 C R  H  X S+     0   0    2  253    1  R  R    RRR   RR           RRR  RRRRRR   R RRRRR   RRR  RR
   269   10 C A  H  < S+     0   0   21  253   21  Q  A    AAA   AA           AAA  SAAVAS   V AAAAA   ASA  AA
   270   11 C A  H  < S+     0   0   47  253   71  S  G    KQS   EA           QAF  EENEEE   E EEEEE   KEE  QE
   271   12 C T  H  < S+     0   0   31  253   83  A  L    TSH   KT           SLL  TSLSTL   S STTTT   TQT  SR
   272   13 C H     <  -     0   0   13  254   44  H  P    AAP   AA           APP  AAPSAS   S AVAVA   AGT  AA
   273   14 C P  S    S+     0   0   45  257   60  P  t    TTs   TA           Tsg  TSsTTn   T GSQST   TnT  TT
   274   15 C S     >  -     0   0    0  257   59  .  g    HHn   HH           Hgs  HHtHHt   H HHHHH   HtH  HH
   275   16 C P  H  > S+     0   0   82  261   28  .  P    PPP   PP  P        PPP  PPPPPP   P PPPPP   PPP  PP
   276   17 C V  H  > S+     0   0    0  264   54  L  L    LLL   LL  L        LLL  LLLLLL   L LLLLL   LLL  LL
   277   18 C A  H  > S+     0   0    0  264   29  S  A    SNA   TN  A        NAA  NTATSA   T TSSST   SAT  NN
   278   19 C A  H  X S+     0   0   22  264   67  A  S    RAA   RA  A        ASA  RASSRS   S ARSRT   SHT  AA
   279   20 C K  H  X S+     0   0   73  264   74  Y  Y    YYY   YY  Y        YYY  HYYYHY   Y YHYHY   YYY  YY
   280   21 C L  H  X S+     0   0    0  265    2  L  L  L LLL   LL  L        LLL  LLLLLL   L LLLLL   LLL  LL
   281   22 C F  H  X S+     0   0    0  265   13  Y  L  L FFL   FF  L        FLL  FLLFYL   F LYLYL   LLL  FF
   282   23 C N  H  X S+     0   0   69  265   71  R  S  R RKR   RK  R        KSR  KRSRKR   R RKRKR   RRR  KR
   283   24 C I  H  X S+     0   0    2  265   41  L  L  L LLL   LL  L        LLL  LLLLLL   L LLLLL   LLL  LL
   284   25 C M  H  X>S+     0   0    0  266   52  M  V  I MMI   MM  I        MII  MMIMMA   M MMMMM   MIM  MM
   285   26 C H  H  <5S+     0   0   75  266   50  V  A  A DDS   ED  A        DAA  DDSEDH   E DDADD   AHD  DD
   286   27 C E  H  <5S+     0   0  112  266   83  V  V  I LLI   LL  I        LAI  LLIVLL   V LLLLL   MTL  LL
   287   28 C K  H  <5S-     0   0   40  266    0  K  K  K KKK   KK  K        KKK  KKKKKK   K KKKKK   KKK  KK
   288   29 C Q  T  <5 +     0   0  109  266   48  E  Q  R AAQ   QA  R        AHR  AAKQAR   Q AARAA   KRA  AA
   289   30 C T      < +     0   0    0  266   40  S  T  T SST   SS  T        SST  SSTSST   S SSSSS   STS  SS
   290   31 C N        +     0   0    0  266    0  N  N  N NNN   NN  N        NNN  NNNNNN   N NNNNN   NNN  NN
   291   32 C L  E     -s  740   0E   0  266   15  L  L  L LLL   LL  L        LLL  LLLLLL   L LLLLL   LLL  LL
   292   33 C C  E     -st 741 577E   0  266   47  C  C  C CCC   CC  C        CCC  CCCCCC   C CCCCC   CCC  CC
   293   34 C A  E     -st 742 578E   0  265   57  L  L  L LLL   LL  L        LLL  LLLLLV   L LLLLL   LVL  LL
   294   35 C S  E     - t   0 579E  14  266   11  S  S  S SSS   SS  S        SSS  SSSSSS   S SSSSS   SSS  SS
   295   36 C L        +     0   0    2  266   60  A  A  A AAA   AA  A        AAA  AAAAAA   A AAAAA   AAA  AA
   296   37 C D        +     0   0   54  266    0  D  D  D DDD   DD  D        DDD  DDDDDD   D DDDDD   DDD  DD
   297   38 C V        -     0   0    6  266   11  V  V  V VVV   VV  V        VVV  VVVVVV   V VVVVV   VVV  VV
   298   39 C R  S    S+     0   0  150  266   65  S  E  T TAE   TA  T        AES  APDEAT   E AASAP   TTP  AT
   299   40 C T     >  -     0   0   17  266   45  S  T  T TTT   TT  T        TTT  TTTHTT   H TTTTT   TTT  TN
   300   41 C T  H  > S+     0   0   13  266   53  A  S  T AAS   AA  T        AST  AATAAT   A AATAA   ATA  AA
   301   42 C K  H  > S+     0   0  139  266   68  R  A  Q RRA   RH  A        RAA  RRARRA   R RRNRR   NTR  RR
   302   43 C E  H  > S+     0   0   77  266   31  T  E  A EEE   GE  R        EEE  EEEDEE   D EEQEE   QEE  EE
   303   44 C L  H  X S+     0   0    5  266   12  L  L  L LLL   LL  L        LLL  LLLLLL   L LLLLL   LLL  LL
   304   45 C L  H  X S+     0   0   40  266    4  L  L  L LLL   LL  L        LIL  LLLLLL   L LLLLL   LLL  LL
   305   46 C E  H  X S+     0   0  108  266   75  R  Q  S AYA   AY  A        YQA  YHQAYS   A YYSYY   SKY  YY
   306   47 C L  H  X S+     0   0   29  266   27  L  I  L LFL   IF  L        FLV  FLLLFI   L LFLFL   LVL  FL
   307   48 C V  H  X S+     0   0    0  265   56  A  A  A AAA   AA  A        AAA  AAAAAA   A AAAAA   AAA  AA
   308   49 C E  H  < S+     0   0   77  266   24  N  E  E DDE   DD  E        DEE  DDEDDE   D DDNDD   NED  DD
   309   50 C A  H  < S+     0   0   26  266   77  S  E  E RKD   KR  E        KDE  KKDEKD   E KKAKK   NEK  KK
   310   51 C L  H >X S+     0   0    0  263   31  I  V  V VLV   VI  V        LVV  IIVVIV   V VIVIV   IVV  LV
   311   52 C G  G >< S+     0   0    0  263    2  G  G  G GGG   GG  G        GGG  GGGGGG   G GGGGG   GGG  GG
   312   53 C P  G 34 S+     0   0   48  266   17  P  D  D PPD   PP  D        PDD  PPDPPE   P PPPPP   PDP  PP
   313   54 C K  G <4 S+     0   0   30  266   73  S  Y  S SSS   YA  S        SSS  SSSSSH   S SSSSS   SHS  SS
   314   55 C I    <<  -     0   0    0  266   15  I  I  I III   II  I        III  IIIIII   I IIIII   III  II
   315   56 C C  S    S+     0   0    0  265   43  V  C  C VVC   VV  C        VCC  VVCVVC   V VVVVV   VCV  VV
   316   57 C L  E     -tu 553 607E   0  265   31  V  L  L VVV   VV  L        VLV  VVLVVV   V VVVVV   VVV  VV
   317   58 C L  E     -tu 554 608E   0  265   31  L  L  L LLL   LL  L        LLL  LLLLLL   L LLLLL   LLL  LL
   318   59 C K  E     -tu 555 609E  22  265    1  K  K  K KKK   KK  K        KKK  KKKKKK   K KKKKK   KKK  KK
   319   60 C T  E     - u   0 610E   2  264    2  T  T  T TTT   TT  T        TTT  TTTTTT   T TTTTT   TTT  TT
   320   61 C H    >   +     0   0   26  264    1  H  H  H HHH   HH  H        HHH  HHHHHH   H HHHHH   HHH  HH
   321   62 C V  G >   +     0   0    3  265   39  Y  C  A YYC   YH  A        YCA  HHCYYA   Y HYYYH   YAH  YY
   322   63 C D  G 3  S+     0   0   74  265    1  D  D  D DDD   DD  D        DDD  DDDDDD   D DDDDD   DDD  DD
   323   64 C I  G <  S+     0   0   82  265   11  I  I  I LMI   LM  I        MII  MIILMI   L IMLMI   LII  ML
   324   65 C L    <   -     0   0   15  266   28  V  V  I IVV   IV  V        VVI  VVVIVI   I VVVVV   IIV  VI
   325   66 C T  S    S+     0   0   88  266   64  S  T  S SST   SS  S        STN  SASTAS   T AAAAA   STS  SS
   326   67 C D  S    S+     0   0   71  266   10  D  D  D GGD   GG  D        GDD  GGDGGD   G GGNGG   NDG  GG
   327   68 C F        +     0   0   35  266    7  w  w  f www   ww  f        wwf  wwwwwf   w wwwww   wfw  ww
   328   69 C S     >> -     0   0   45  202   62  d  .  . pp.   pe  .        p..  pp.pp.   p ppppp   p.p  pp
   329   70 C M  I  4>S+     0   0   44  203   88  v  .  . QQ.   QR  .        Q..  KQ.HR.   H QRTRQ   Q.Q  QQ
   330   71 C E  I  45S+     0   0  135  194   54  t  d  d TTd   T.  d        Tdd  TTdTTe   T TTSTT   TeT  TT
   331   72 C G  I  45S+     0   0   33  250   62  G  R  R GGR   GG  R        GRR  GGRGGR   G GGGGG   GRG  GG
   332   73 C T  I  X5S+     0   0    2  252   41  T  T  T TTT   TT  T        TTT  TTSTTT   T TTTTT   TTT  TT
   333   74 C V  I  > S+     0   0   37  266   72  Q  A  Q KKA   KK  G        KAG  RRAKKG   K KKRKK   RGK  KK
   336   77 C L  H  X S+     0   0    3  266    0  L  L  L LLL   LL  L        LLL  LLLLLL   L LLLLL   LLL  LL
   337   78 C K  H  X S+     0   0   68  265   79  A  R  R AAK   AA  R        ARR  AAKAAN   A AAAAG   ANA  AA
   338   79 C A  H  X S+     0   0   60  266   62  A  E  D ASE   AA  D        SED  AAEASE   A ASRSA   EDA  SA
   339   80 C L  H  X S+     0   0   13  266   12  L  I  I LLI   LL  I        LII  LIILLI   L ILLLL   IVL  LL
   340   81 C S  H  X>S+     0   0   15  266   37  A  A  A AAA   AA  A        AAA  AAAAAS   A AAAAA   AAA  AA
   341   82 C A  H  <5S+     0   0   80  266   70  A  Q  K RRR   RR  K        RVR  RRRRRR   R RRRRR   RRR  RR
   342   83 C K  H  <5S+     0   0  134  266   19  K  R  R KRR   KR  R        RRR  KKRKKR   K KKKKK   RRK  RK
   343   84 C Y  H  <5S-     0   0   51  266   36  H  K  K HHK   HH  K        HKK  HHKHHK   H HHHHH   YKH  HH
   344   85 C N  T  <5 +     0   0   60  266   55  G  R  K GGW   GG  R        GSR  GGRGGK   G GGGGG   NHG  GG
   345   86 C F      < -     0   0    0  266    0  F  F  F FFF   FF  F        FFF  FFFFFF   F FFFFF   FFF  FF
   346   87 C L  E     -u  577   0E   6  266   11  L  L  L LLI   LL  L        LLL  LLLLLL   L LLLLL   LVL  LL
   347   88 C L  E     -u  578   0E   0  266   12  I  I  V III   II  V        III  IIIIIV   I IIIII   IVI  II
   348   89 C F  E     -uv 579 638E   0  266    0  F  F  F FFF   FF  F        FFF  FFFFFF   F FFFFF   FFF  FF
   349   90 C E  E     -u  580   0E   0  266    0  E  E  E EEE   EE  E        EEE  EEEEEE   E EEEEE   EEE  EE
   350   91 C N  E     +     0   0E  30  266    0  D  D  D DDD   DD  D        DDD  DDDDDD   D DDDDD   DDD  DD
   351   92 C R  E     -     0   0E  47  266    0  R  R  R RRR   RR  R        RRR  RRRRRR   R RRRRR   RRR  RR
   352   93 C K  E     - v   0 640E  85  266    0  K  K  K KKK   KK  K        KKK  KKKKKK   K KKKKK   KKK  KK
   353   94 C F  E     + v   0 641E   3  266    0  F  F  F FFF   FF  F        FFF  FFFFFF   F FFFFF   LFF  FF
   354   95 C A        +     0   0   46  265   45  S  A  G VAA   VG  G        AAG  GGAVGG   V GGGGG   GGG  AC
   355   96 C D        -     0   0   67  265    0  D  D  D DDD   DD  E        DDD  DDDDDD   D DDDDD   DDD  DD
   356   97 C I    >>  +     0   0   79  265    1  I  I  I III   II  I        III  IIIIII   I IIIII   III  II
   357   98 C G  H 3> S-     0   0   39  265    0  G  G  G GGG   GG  G        GGG  GGGGGG   G GGGGG   GGG  GG
   358   99 C N  H 3> S+     0   0  113  265   28  S  E  E KNE   KN  E        NEE  NNESNN   S NNHNN   NNN  NK
   359  100 C T  H <> S+     0   0   75  265    2  T  T  T TTT   TT  I        TTT  TTTTTT   T TTTTT   TTT  TT
   360  101 C V  H  X S+     0   0    0  265    5  V  V  V VVV   VV  I        VVV  VVVVVV   V VVVVV   VVV  VV
   361  102 C K  H  X S+     0   0   23  265   59  Q  Q  Q QEQ   QE  Q        EQQ  EQQQEQ   Q QEQEQ   QQQ  EQ
   362  103 C L  H  X S+     0   0   92  265   78  K  K  K MLK   ML  K        LKK  LMKKLQ   K MLLLM   LQM  LM
   363  104 C Q  H  < S+     0   0   76  265    0  Q  Q  Q QQQ   QQ  Q        QQQ  QQQQQQ   Q QQQQQ   QQQ  QQ
   364  105 C Y  H  < S+     0   0    0  266    0  Y  Y  Y YYY   YY  Y        YYY  YYYYYY   Y YYYYY   YYY  YY
   365  106 C S  H  < S+     0   0   23  266   78  T  T  T TIT   TT  T        ITT  TVTTTV   T VTTTV   TVV  IT
   366  107 C A  S  X S+     0   0   34  266   52  D  S  G AGS   AS  G        GSA  SASASG   A ASESA   EGA  GA
   367  108 C G  T  4 S-     0   0   60  266    0  G  G  G GGG   GG  G        GGG  GGGGGG   G GGGGG   GGG  GG
   368  109 C V  T  4 S+     0   0  105  266   63  P  H  P TSY   TS  P        SHP  ASHTAP   T SATAS   TPT  ST
   369  110 C Y  T  4 S-     0   0   49  266   65  G  Y  L AAH   AA  L        AHL  AAHAAL   A AAAAA   ALA  AA
   370  111 C R    ><  +     0   0   95  266   34  K  R  A RRR   RR  A        RRR  RRRRRT   R RRKRR   RQR  RR
   371  112 C I  G >>  +     0   0    0  266    2  A  I  I III   II  I        III  IIIIII   I IIIII   III  II
   372  113 C A  G 34 S+     0   0    0  266   52  V  A  A IIA   II  A        IAS  IIAVIV   V IIIIV   IVI  IV
   373  114 C E  G <4 S+     0   0   81  266   60  E  L  R EES   DE  R        ELL  EELEER   E EEEEE   ERE  EE
   374  115 C W  T <4 S+     0   0    3  266    0  W  W  W WWW   WW  W        WWW  WWWWWW   W WWWWW   WWW  WW
   375  116 C A     <  -     0   0    0  266   30  A  A  A AAA   AA  A        AAA  AAAAAA   A AAAAA   SAA  AA
   376  117 C D  S    S+     0   0    8  266   44  H  E  E HHE   HH  E        HED  HHEHHP   H HHHHH   HPH  HH
   377  118 C I  E     +vw 609 666E   0  266    8  I  I  I IIL   II  I        III  IIIIII   I IIIII   III  II
   378  119 C T  E     - w   0 667E   0  266   42  T  T  T TVT   TV  T        VTT  VTTTTV   T TVTVI   IVT  VT
   379  120 C N  E     -vw 613 668E   1  266    2  N  N  N NNN   NN  S        NNN  NNNNNN   N NNNNN   NNN  NN
   380  121 C A  E     -vw 614 669E   0  266   41  A  A  A AVA   AV  A        VAA  VVAAVC   A VVVVV   VCV  VM
   381  122 C H    >   -     0   0   37  266   50  H  H  H NNH   NN  H        NHH  NNHDNH   D NNNNN   NHN  NN
   382  123 C G  G >  S+     0   0    5  265   79  I  V  I IML   IM  I        MVI  MMVIMI   I MMMMM   MIM  MI
   383  124 C V  G 3  S+     0   0   99  266   30  L  L  F DVL   DV  F        VLF  VVLHVF   H VVVVV   VFV  VS
   384  125 C V  G <  S-     0   0   53  266   52  P  P  P APP   AP  P        PPP  PPPAPP   A PPPPP   PPP  PA
   385  126 C G    X   -     0   0   15  266    1  G  G  G GGG   GG  G        GGG  GGGGGG   G GGGGG   GGG  GG
   386  127 C P  T >> S+     0   0   74  266   64  A  P  P KKP   KK  P        KPP  KKPEKP   E KKKKK   KPK  KK
   387  128 C G  H 3> S+     0   0   26  266   25  A  A  A DAA   DA  A        AAA  AAAAAA   A AAAAA   AAA  AD
   388  129 C I  H <> S+     0   0    0  266   24  I  I  I MSI   MS  V        SII  SAIMSI   M ASASA   VVA  SA
   389  130 C V  H <> S+     0   0    2  266   13  V  V  V VVV   VV  L        VVV  VVVVVI   V VVVVV   VIV  VV
   390  131 C S  H  X S+     0   0   72  266   72  S  T  S RTT   RT  T        TTR  TTTSTT   S TTDTT   STT  TT
   391  132 C G  H  X S+     0   0    6  266   30  A  A  S ASA   AS  S        SAA  SAAASA   A ASASS   AAA  SA
   392  133 C L  H  X S+     0   0    0  266    0  L  L  L MLL   LL  L        LLL  LLLMLL   M LLLLL   LLL  LL
   393  134 C K  H  X S+     0   0   54  266   67  A  E  K AAH   AA  K        AEK  SAEAAS   A AASAA   ASA  AA
   394  135 C Q  H  X S+     0   0   97  266   56  D  K  E ENK   EN  E        NKE  NEKQHQ   Q EHDHE   QQE  NE
   395  136 C A  H  X S+     0   0    1  266   60  A  A  A AAA   AA  A        AAA  AAAAAA   A AAAAA   AAA  AA
   396  137 C A  H  X S+     0   0    4  266   31  A  A  S AAA   AA  A        AAA  AAAAAA   A AAAAA   AAA  AA
   397  138 C E  H  < S+     0   0  134  266   84  s  e  s ata   as  a        tea  aadqnq   q anvna   eqa  ta
   398  139 C E  H  < S+     0   0  125  202   30  e  e  i eee   ee  q        eed  eeqeed   e eeeee   eke  ee
   399  140 C V  H  < S+     0   0   51  266   88  A  n  i PAe   Ae  s        Adg  AedAAs   A eAAAe   Ane  Ee
   400  141 C T     <  -     0   0   35  193   67  P  n  g P.n   Pp  i        .nd  PpnPPg   P pPPPp   Ppp  Ap
   401  142 C K  S    S+     0   0  179  212   85  L  L  H M.V   AL  E        .LR  IMLLID   L MIMIM   MPV  PS
   402  143 C E  S    S-     0   0   91  218   33  D  d  H DpD   DE  D        pdD  EDdDED   D DEDED   EpD  MD
   403  144 C P        -     0   0   33  183   56  .  a  D .a.   ..  .        aa.  ..a..P   . .....   .y.  A.
   404  145 C R        -     0   0   20  264   15  R  A  D RR.   RR  E        RS.  RRTRRE   R RRRRR   RRR  RR
   405  146 C G  E     -w  638   0E   0  266   17  G  E  A GGK   GG  G        GEG  GGDGGT   G GGGGG   GSG  GG
   406  147 C L  E     -wx 639 699E   0  266    6  L  L  H LLA   LL  H        LLM  LLLLLL   L LLLLL   LLL  LL
   407  148 C L  E     -wx 640 701E   0  266   11  L  L  E LLT   LL  H        LIL  LLLLLD   L LLLLL   LLL  LL
   408  149 C M  E     -wx 641 702E   0  266   38  L  R  I LIM   LI  D        IRE  IIRIIH   I IIIII   III  II
   409  150 C L  E     + x   0 703E   3  266    2  L  L  L LLL   LL  D        LLR  LLLLLL   L LLLLL   LLL  LL
   410  151 C A        +     0   0    0  266    8  A  g  e AAa   AA  a        Agl  AAgAAg   A AAAAA   AAA  AA
   411  152 C E  S    S-     0   0   24  266   18  Q  e  e QQe   QQ  l        Qee  QQeQQq   Q QQQQQ   QQQ  QQ
   412  153 C L        -     0   0   44  266    7  M  M  M MMM   MM  L        MMM  MMMMMM   M MMMMM   MMM  MM
   413  154 C S        +     0   0   78  266   31  S  S  S SSS   SS  A        SSS  SSSSSS   S SSSSS   SSS  SS
   414  155 C C  S >  S-     0   0   79  266   22  S  S  S SSS   SS  E        SSS  SSSSSS   S SSSSS   SSS  SS
   415  156 C K  T 3  S+     0   0  214  266   44  A  A  A KAE   KE  M        AEE  QAEKQA   K AEQEA   EAA  AK
   416  157 C G  T 3  S+     0   0   68  265    2  G  G  G GGG   GG  G        GGG  GGGGGN   G GGGGG   GNG  GG
   417  158 C S    <   -     0   0   38  266   49  N  H  N CNH   CN  N        NHN  NNHCNN   C NNNNN   NNN  NC
   418  159 C L        +     0   0  148  266    8  L  L  L LFL   LF  L        FLL  FFLLFF   L FFFFF   FFF  FL
   419  160 C A        +     0   0    6  266   41  L  M  L MMM   MM  L        MML  MMMMMF   M MMMMM   MFM  MM
   420  161 C T    >   -     0   0   55  266   75  D  T  T TNT   TN  A        NTT  NNTDNT   D NNTNN   TTN  NT
   421  162 C G  T 3> S+     0   0   20  266   28  E  P  G KKP   RK  G        KPG  KKPGKP   G KKKKK   RPK  KP
   422  163 C E  H 3> S+     0   0   81  266   50  A  E  A DEE   EE  S        EDS  EEEKEE   K EEEEE   EEE  ED
   423  164 C Y  H <> S+     0   0   59  265    0  Y  Y  Y YYY   YY  Y        YYY  YYYYYY   Y YYYYY   YYY  YY
   424  165 C T  H  > S+     0   0    3  266   18  A  Q  T TTT   TT  T        TQT  TTQTTT   T TTTTT   TTT  TT
   425  166 C K  H  X S+     0   0   78  266   69  K  K  E QQQ   QQ  Q        QQE  QQKWQT   W QQDQQ   NAQ  QQ
   426  167 C G  H  X S+     0   0   26  266   76  A  E  K AAK   AA  Q        AKQ  AAEEAA   E AAAAA   AAA  AA
   427  168 C T  H  X S+     0   0    2  266   58  C  T  C CCT   CC  C        CTC  CCTCCC   C CCCCC   CCC  CC
   428  169 C V  H  X S+     0   0   16  266   12  V  V  V VVV   VV  V        VVV  VVVVVL   V VVVVV   VLV  VV
   429  170 C D  H  < S+     0   0   78  266   45  E  E  E EEE   EE  E        EEA  EEKKEH   K EEEEE   AKE  EE
   430  171 C I  H >< S+     0   0   21  266   63  I  I  V AAV   AA  I        AII  AAIAAH   A AASAA   AHA  AA
   431  172 C A  H >< S+     0   0    0  265    1  A  A  A AAA   AA  A        AAA  AAAAAA   A AAAAA   AAA  AA
   432  173 C K  T 3< S+     0   0   53  266   33  R  R  R RRR   RR  R        RRR  RRRRRR   R RRRRR   RRR  RR
   433  174 C S  T <  S+     0   0   73  265   75  N  K  E EEN   DE  Q        ENE  EENKEE   K EEEEE   DEE  EE
   434  175 C D    <>  +     0   0   19  266   71  N  N  H HHN   HH  H        HHH  HNHNHN   N NHHHH   HNN  HH
   435  176 C K  T  4 S+     0   0   81  266   48  K  R  K KKR   RK  K        KRR  KKSKKK   K KKKKK   QSK  KK
   436  177 C D  T  4 S+     0   0   84  266   43  D  E  D DDE   DD  E        DDE  SNEGND   G DSGSS   NEG  DD
   437  178 C F  T  4 S+     0   0   10  266    7  F  F  F FFF   FF  F        FFF  FFFFFF   F FFFFF   FFF  FF
   438  179 C V  E  <  +x  667   0E   1  266    5  V  V  V VVV   VV  V        VVV  VVVVVV   V VVVVV   VVV  VV
   439  180 C I  E     -     0   0E   0  265   40  M  M  M MMM   MM  M        MMM  IMMMMM   M MMMMM   MMM  MM
   440  181 C G  E     -xy 668 718E   0  266    0  G  G  G GGG   GG  G        GGG  GGGGGG   G GGGGG   GGG  GG
   441  182 C F  E     -xy 669 719E   0  266    0  F  F  F YFF   FF  F        FFF  FFFYFF   Y FFFFF   FFF  FY
   442  183 C I  E     +xy 670 720E  10  265   12  I  I  I VVI   VV  I        VII  VVIVVI   V VIIIV   IIV  VV
   443  184 C A        -     0   0    0  265   31  A  A  A ASA   SS  A        SAA  SSAASA   A SSSSS   SAS  SA
   444  185 C Q  S    S+     0   0   34  266   53  q  Q  Q qQQ   Qq  Q        QQQ  qqQqqQ   q qqqqq   qQq  qQ
   445  186 C R  S    S-     0   0  111  266   66  q  r  r per   eq  r        err  pprtpk   t ppkqp   skp  pe
   446  187 C D        -     0   0   41  192   77  .  l  l .ll   l.  l        lll  ..le.m   e .....   .m.  .l
   447  188 C M        -     0   0   20  204   82  N  N  N .NN   N.  N        NNN  ..NE.N   E .....   .N.  .N
   448  189 C G        +     0   0   25  210   61  T  T  S .TT   S.  S        TTA  ..TE.E   E .....   .E.  .S
   449  190 C G    > > +     0   0    6  236   63  A  E  A .ET   A.  E        EEE  ..EA.G   A .....   .K.  .E
   450  191 C R  G > 5S+     0   0  123  254   81  A  P  P .LP   DD  P        LPA  ..PQ.S   Q ...P.   .P.  .A
   451  192 C D  G 3 5S+     0   0  160  266   42  D  D  G DDD   DD  G        DDG  DDNAEE   A EDGDE   DED  DG
   452  193 C E  G < 5S-     0   0  108  266   30  D  D  D DDD   DD  D        DDD  DDDDDD   D DDDDD   DDD  DE
   453  194 C G  T < 5S+     0   0   55  266   45  Q  N  N NEN   AV  N        ENN  ASNNDN   N SDADA   MNA  KD
   454  195 C Y      < -     0   0   50  266   25  F  F  F FFF   FF  F        FFF  FFFFFF   F FFFFF   FFF  FF
   455  196 C D        -     0   0   39  116    5  .  .  . ...   ..  .        ...  ......   . .....   ...  ..
   456  197 C W        -     0   0   10  123    9  .  .  . ...   ..  .        ...  ......   . .....   ...  ..
   457  198 C L  E     -y  701   0E   0  266   29  I  I  L III   IV  L        IIV  IIIIII   I IIIII   LII  II
   458  199 C I  E     -y  702   0E   2  266   51  T  T  T HHT   HH  T        HTT  HHTHHT   H HHTHH   STH  HH
   459  200 C M  E     -yz 703 739E   0  266   26  M  M  M MMM   MM  M        MMM  MMMMMM   M MMMMM   MMM  MM
   460  201 C T  E     - z   0 740E   0  266   13  T  T  T TTT   TT  T        TTT  TTTTTT   T TTTTT   TTT  TT
   461  202 C P        +     0   0   28  266   31  P  P  P PPP   PP  P        PPP  PPPPPP   P PPPPP   PPP  PP
   462  203 C G  S    S+     0   0   54  266    0  g  g  G ggg   gg  G        ggg  gggggG   g ggggg   gGg  gg
   463  204 C V              0   0   12  266   14  l  l  V lll   ll  V        lll  lllllV   l lllll   lVl  ll
   464  205 C G              0   0   61  266   52  p  p  k ppp   pp  k        ppp  pppppq   p ppppp   pqp  pp
   465      ! !              0   0    0    0    0  
   466  218 C R              0   0  104  264   54  n  n  t nnn   nn  n        nnn  nnnnnn   n nnnnn   nnn  nn
   467  219 C T     >  -     0   0   79  264    8  T  T  S TTT   TT  N        TTT  TTTTTT   T TTTTT   TTT  TT
   468  220 C V  H  > S+     0   0   11  264   49  P  P  P PPP   PP  P        PPP  PPPPPP   P PPPPP   PPP  PP
   469  221 C D  H  > S+     0   0   79  265   63  Q  H  R AQR   DA  R        QRR  QEHDQA   D QQQQQ   SRQ  QS
   470  222 C D  H  > S+     0   0   59  265   63  K  K  Q KKK   KS  Q        KKR  KKKNKK   N KKKKK   KKK  KK
   471  223 C V  H  X>S+     0   0    0  265   45  L  L  I LIL   LI  I        ILV  ILLLIV   L LILIL   IVL  IL
   472  224 C V  H ><5S+     0   0    0  265   19  I  I  I III   II  I        IIV  IIIVIV   V VIIIV   IVV  II
   473  225 C S  H 3<5S+     0   0   52  266   85  G  F  F TGF   KG  L        GLG  GEYNGG   N EGGGE   NGE  GT
   474  226 C T  H 3<5S-     0   0   59  266   80  e  d  e lve   gv  e        vde  vleiie   i litil   lel  vl
   475  227 C G  T <<5S+     0   0    8  266    4  s  g  g ggg   gg  g        ggg  gggggg   g ggggg   ggg  gg
   476  228 C S      < -     0   0    0  266   60  V  C  S TAC   TS  S        ACC  ATCTAT   T TANAT   NST  AT
   477  229 C D  S    S+     0   0    0  266    0  D  D  D DDD   DD  D        DDD  DDDDDD   D DDDDD   DDD  DD
   478  230 C I  E     - z   0 720E   0  266   33  I  I  V IIV   II  I        IVV  IIIIII   I IIIII   III  II
   479  231 C I  E     -sz 552 721E   0  266   11  I  I  I VVI   VA  V        VIV  AVIAAI   A VAVAV   IIV  VV
   480  232 C I  E     -s  553   0E   7  266    0  I  I  I III   II  I        III  IIIIII   I IIIII   III  II
   481  233 C V  E     +s  554   0E   2  266   36  V  V  V VVV   VV  V        VVV  VVVVVV   V VVVVV   VVV  VV
   482  234 C G    >   +     0   0   22  266    0  G  G  G GGG   GG  G        GGG  GGGGGG   G GGGGG   GGG  GG
   483  235 C R  T 3> S+     0   0  121  266    0  R  R  R RRR   RR  R        RRR  RRRRRR   R RRRRR   RRR  RR
   484  236 C G  T 34 S+     0   0   21  266    0  G  G  G GGG   GG  G        GGG  GGGGGG   G GGGGG   GGG  GG
   485  237 C L  T <4 S+     0   0    0  266   26  I  I  I III   II  I        III  IIIIII   I IIIII   III  II
   486  238 C F  T  4 S+     0   0   27  266   29  I  V  I ILV   LL  V        LVL  ILVIIY   I LIIIL   IIL  LI
   487  239 C A  S >< S+     0   0   10  266   52  G  R  E QKR   EK  E        KRA  KKRTKG   T KKKKK   KAK  KK
   488  240 C K  T 3  S-     0   0  178  164   62  .  .  . ...   ..  .        ...  ......   . .....   ...  ..
   489  241 C G  T 3  S+     0   0   83  266   55  A  A  A AAA   AA  A        AAA  AAAAAA   A AAAAA   AAA  AA
   490  242 C R    <   -     0   0  111  266   76  A  A  N AGQ   AN  D        GHN  NGQASK   A GGDGG   DAG  GG
   491  243 C D     >  -     0   0   96  266   30  D  D  D DDD   DD  D        DDD  DDDDDD   D DDDDD   NDD  DD
   492  244 C A  H  > S+     0   0    8  266   56  P  R  R PPR   PP  R        PRR  PPRPPR   P PPPPP   PRP  PP
   493  245 C K  H  > S+     0   0   83  265   82  V  K  A PEK   VY  A        EKV  EQKPER   P QEVEQ   VRQ  EP
   494  246 C V  H  > S+     0   0   81  265   81  T  A  E TGA   SE  K        GSR  GSSAEA   A SERES   SAS  GS
   495  247 C E  H  X S+     0   0   22  265   50  E  E  E EEE   EE  E        EEE  EEEEEA   E EEEEE   EAE  EE
   496  248 C G  H  X S+     0   0    0  265   42  A  A  A ATA   AA  A        TAT  AAAAAA   A AAAAA   AAA  TA
   497  249 C E  H  X S+     0   0   67  265   58  E  E  E EEE   EE  E        EEE  EEEEEL   E EEEEE   ELE  EE
   498  250 C R  H  X S+     0   0  141  265   28  R  R  R RRR   RR  R        RRR  RRRRRE   R RRRRR   RER  RR
   499  251 C Y  H  X S+     0   0   20  265    0  Y  Y  Y YYY   YY  Y        YYY  YYYYYY   Y YYYYY   YYY  YY
   500  252 C R  H  X S+     0   0   41  265   36  R  K  R RRR   RR  R        RRR  RRKRRR   R RRRRR   RRR  RR
   501  253 C K  H  X S+     0   0  101  265   61  R  R  K RST   KS  K        SQT  SRKRSK   R RSKSR   SKR  SR
   502  254 C A  H  X S+     0   0   28  265   48  K  A  E KAE   RA  E        AAE  AKAKAQ   K KAKAK   KQK  AK
   503  255 C G  H  X S+     0   0    0  265   15  G  A  A AAG   AA  A        AAA  AAAAAG   A AAAAA   AGA  AA
   504  256 C W  H  X S+     0   0   22  265    0  W  W  W WWW   WW  W        WWW  WWWWWW   W WWWWW   WWW  WW
   505  257 C E  H  X S+     0   0   86  265   62  E  T  V KKK   KK  A        KAR  KKAKKL   K KKQKK   KEK  KK
   506  258 C A  H  X S+     0   0    2  265    2  A  A  A AGA   AA  A        GAA  AAAAAA   A AAAAA   AAA  GA
   507  259 C Y  H  < S+     0   0   25  262    0  Y  Y  Y YYY   YY  Y        YYY  YYYYYY   Y YYYYY   YYY  YY
   508  260 C L  H  < S+     0   0  108  258   55  T  E  E LTE   LT  E        TEE  TLEQTR   Q LTETL   ERL  TL
   509  261 C R  H  < S+     0   0  136  258   68  A  K  E AEE   GE  E        EEE  ESEDEE   D SEEES   EES  EA
   510  262 C R  S  < S-     0   0   31  254    5  R  R  R RRR   RR  R        RRR  RRRRRR   R RRRRR   RRR  RR
   511  263 C C        -     0   0   48  210   53  I  I  I  VV   LV  I        VVI  VVI CV     VVIVV   I V  VI
   512  264 C G        -     0   0   35  164   41  G  G  A   G   G   A         QG   AQ D      A A A   A A    
   513  265 C Q              0   0  142  129   68     K  K       K   K         K     Q R                     
   514  266 C Q              0   0  185   69   46     Q  K       D                     E                     
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1    3 A   0   0   0   0   0   0   0   0   0   0   5  23   0   0   5  53   9   0   4   1   128    0    0   1.354     45  0.44
    2    4 A   4   3   0   1   0   0   0   0  40   2   7   9   0   0   0   7  21   5   1   0   149    0    0   1.854     61  0.28
    3    5 A   0   0   0   0   0   0   0   0   0   7  24  68   0   0   0   0   0   0   1   0   246    0    0   0.852     28  0.61
    4    6 A   0   0   0   0  12   0  88   0   0   0   0   0   0   0   0   0   0   0   0   0   278    0    0   0.364     12  0.98
    5    7 A   1   2   1   0   0   0   0   9  27   0  19  13   0   0   5   9   2  10   0   1   278    0    0   2.096     69  0.28
    6    8 A   4   0   0   0   0   0   0   0  17   0  10   6   0   0   0   1  14  40   0   6   278    0    0   1.741     58  0.37
    7    9 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   278    0    0   0.024      0  0.99
    8   10 A   2   0   3   0   0   0   0   3  85   0   7   0   0   0   0   0   0   0   0   0   278    0    0   0.663     22  0.76
    9   11 A   0   2   0   0   0   0   0   1  23   1  19   2   0   0   2  12  10  20   3   3   279    1   15   2.071     69  0.28
   10   12 A   4   3   1   0   1   0   0   1  12   4  13  23   0   3   7  17   4   0   8   1   278    0    0   2.320     77  0.20
   11   13 A   1   0   0   0   1   0   2   0  10   0   5   4   2  69   0   0   2   1   1   0   279    0    0   1.260     42  0.44
   12   14 A   0   1   0   0   0   0   0   3   8  43  10  20   0   0   2   6   3   1   2   1   280    0    0   1.793     59  0.36
   13   15 A   1   0   0   0   0   0   0   2   0   0  40   2   0  17   0   0   0   0  38   0   281    0    0   1.266     42  0.36
   14   16 A   0   0   0   0   0   0   0   0  11  80   0   0   0   0   0   5   1   2   0   0   281    0    0   0.778     25  0.73
   15   17 A  36  43   1   0   0   0   0   0  11   0   0   5   3   0   0   0   0   0   0   0   283    0    0   1.312     43  0.47
   16   18 A   5   0   0   0   0   0   0   1  75   0   6  10   0   0   0   0   0   0   4   0   283    0    0   0.944     31  0.63
   17   19 A   1   0   0   0   0   0   0   0  20   0  14   2   0   0  28  25   9   0   0   0   283    0    0   1.690     56  0.30
   18   20 A   0   2   0   0   0   0  18   0   5   0   4   0   0   3  32  30   4   1   0   1   283    0    0   1.718     57  0.18
   19   21 A   1  97   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.154      5  0.97
   20   22 A   0  47   0   0  50   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.844     28  0.86
   21   23 A   0   1   0   0   0   0   0   1   4   0   5   5   0   3  19  10  10  25  15   2   283    0    0   2.109     70  0.28
   22   24 A   6  53  31   0   0   0   0   0   0   0   0   8   2   0   0   0   0   0   0   0   283    0    0   1.171     39  0.60
   23   25 A   2   0  12  67   0   0   0   0  19   0   0   0   1   0   0   0   0   0   0   0   284    0    0   0.966     32  0.51
   24   26 A   2   0   0   0   0   0   0   0   8   0   3   2   0  14   0   0   1  47   0  21   284    0    0   1.571     52  0.49
   25   27 A   2  13   3   0   0   0   0   0  11   0  10   4   0   0  19   1   6  28   0   2   284    0    0   2.044     68  0.13
   26   28 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   284    0    0   0.023      0  0.99
   27   29 A   0   0   0   0   0   0   0   0  10   0   1   0   0   1   7  48  32   2   0   0   284    0    0   1.280     42  0.46
   28   30 A   0   0   0   0   0   0   0   0   0   0  47  53   0   0   0   0   0   0   0   0   284    0    0   0.712     23  0.58
   29   31 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   284    0    0   0.000      0  1.00
   30   32 A  17  83   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.454     15  0.85
   31   33 A   7   0   0   0   0   0   0   0   5   0   8  11  69   0   0   0   0   0   0   0   284    0    0   1.060     35  0.57
   32   34 A  40  21   2   0   0   0   0   0  37   0   0   0   0   0   0   0   0   0   0   0   283    0    0   1.173     39  0.42
   33   35 A   0   0   0   0   0   0   0   0   6   0  93   0   0   0   0   0   0   0   0   0   284    0    0   0.259      8  0.90
   34   36 A  29  20   8   0   0   0   0   0  42   0   0   0   0   0   0   0   0   0   0   0   284    0    0   1.275     42  0.39
   35   37 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   284    0    0   0.000      0  1.00
   36   38 A  92   5   1   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.387     12  0.91
   37   39 A   1   0   0   0   0   0   0   0   6   5   5  49   0   1  21   2   1   5   2   2   284    0    0   1.674     55  0.33
   38   40 A   0   0   0   0   0   0   0   0   0   0   8  71   0   2   1  11   1   1   3   2   284    0    0   1.085     36  0.57
   39   41 A   0   0   0   0   0   0   0   0  18   0  15  55   0   0   0  11   0   0   0   0   284    0    0   1.237     41  0.44
   40   42 A   0   0   0   0   0   0   0   1  23   0  10   1   0   0  16  33   4   6   2   3   284    0    0   1.847     61  0.30
   41   43 A   0   0   0   0   0   0   0   2   3   0   3   1   0   0   0   4   3  73   0  11   284    0    0   1.041     34  0.71
   42   44 A   3  75   3   0  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.740     24  0.88
   43   45 A   1  95   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.229      7  0.95
   44   46 A   0   0   0   0   0   0  10   0  11   0  14   3   0   4   9   6   4  18   1  20   284    0    0   2.175     72  0.18
   45   47 A   6  68  19   0   5   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   284    0    0   0.999     33  0.74
   46   48 A  28   6  14   0   0   0   0   0  51   0   0   0   1   0   0   0   0   0   0   0   283    0    0   1.204     40  0.44
   47   49 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2   0   1  25   2  68   284    0    0   0.906     30  0.77
   48   50 A   5   1   2   0   0   0   0   1  20   0   3   8   0   1  17  31   4   5   1   3   284    2    2   2.070     69  0.24
   49   51 A  30  54  11   0   0   0   0   0   3   0   0   1   0   0   0   0   0   0   0   0   282    0    0   1.136     37  0.66
   50   52 A   0   0   0   0   0   0   0  98   2   0   0   0   0   0   0   0   0   0   0   0   282    0    0   0.136      4  0.96
   51   53 A   0   0   0   0   0   0   0   0   1  90   0   0   0   0   0   0   0   0   0   6   284    0    0   0.425     14  0.82
   52   54 A   1   1   0   0   9   0  45   0   1   0  21   0   0  10   0   8   0   1   2   1   284    0    0   1.665     55  0.22
   53   55 A  16   0  79   3   0   0   0   0   1   0   0   0   1   0   0   0   0   0   0   0   284    1    0   0.672     22  0.86
   54   56 A  18   0   0   0   0   0   0   0  13   0   0   2  66   0   0   0   0   0   0   0   283    0    0   0.954     31  0.50
   55   57 A  42  46   2   9   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   283    0    0   1.094     36  0.68
   56   58 A  26  51  19   0   2   0   0   0   1   0   0   1   0   0   0   0   0   0   0   0   283    0    0   1.191     39  0.69
   57   59 A   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0  99   0   0   0   0   283    2    2   0.059      1  0.98
   58   60 A   0   0   0   0   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   281    0    0   0.118      3  0.97
   59   61 A   0   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   1   281    0    0   0.066      2  0.98
   60   62 A  23   0  54   1   0   0  12   0   2   0   0   0   5   3   0   0   0   0   0   0   283    0    0   1.310     43  0.51
   61   63 A   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  99   283    0    0   0.065      2  0.98
   62   64 A   3   6  82   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.692     23  0.81
   63   65 A  28  36  36   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   1.131     37  0.71
   64   66 A   0   0   0   0   0   0   0   0   5   0  30  20   0   1   1   0   0  21   2  18   284    0   43   1.717     57  0.35
   65   67 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  99   284    0    0   0.070      2  0.98
   66   68 A   0   3   0   0  86   3   6   0   0   0   0   0   0   0   0   0   0   0   0   0   284    5    0   0.592     19  0.93
   67   69 A   0   0   0   0   0   0   0   3   0   0  50  14   0   6   0   0   0   2   5  19   279    1    0   1.487     49  0.39
   68   70 A   1   3   5  12   5   0  19   0   3  23   3   2   0   0   1   1   7   4   1   9   283  127   41   2.360     78  0.02
   69   71 A   0   0   1   0   0   0   0   0   3   1   1  24   0   1   1   1   0  59   0   8   157    0    0   1.236     41  0.40
   70   72 A   0   1   0   0   0   0   0  43   3   0   8   6   0   1   6   2   2  13   4  12   283    0    0   1.867     62  0.40
   71   73 A   2  16   1   1   3   0   0   0   0   0   0  76   0   0   0   0   0   0   0   0   283    0    0   0.825     27  0.57
   72   74 A  32   3  42   0   0   0   0  15   6   0   0   3   0   0   0   0   0   0   0   0   284    0    0   1.383     46  0.47
   73   75 A   9   8   1   0   1   0   0   0  17   0   1   8   0   2   2  18   9  13   3   7   284    0    0   2.333     77  0.17
   74   76 A   0   0   0   0   0   0   0  18   4  37   4   1   0   1   7  16  10   3   0   0   284    0    0   1.849     61  0.26
   75   77 A   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    1    0   0.047      1  0.99
   76   78 A   9  11   2   0   0   0   0   0  14   0   1   3   0   0   5  33  14   2   6   0   283    0    0   1.996     66  0.20
   77   79 A   2   0   0   0   0   0   0   1  33   0  10   2   0   0   2   6   7  34   0   3   284    0    0   1.758     58  0.36
   78   80 A   2  90   5   1   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.453     15  0.89
   79   81 A   0   0   0   0   0   0   0   0  64   0  34   0   0   0   0   1   0   0   0   0   284    0    0   0.738     24  0.64
   80   82 A   2   1   0   0   0   0   0   0  15   0   1   1   0   1  20  30  12  11   0   4   284    0    0   1.924     64  0.30
   81   83 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  14  81   3   2   0   0   284    0    0   0.645     21  0.80
   82   84 A   0   2   0   0   3   0  12   0   0   0   0   0   0  77   0   6   0   0   0   0   284    0    0   0.797     26  0.64
   83   85 A   0   0   0   0   0   0   0  16   0   0   2   0   0   0   5   9   3   0  44  19   284    0    0   1.649     55  0.42
   84   86 A   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.000      0  1.00
   85   87 A   5  74   0  19   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.754     25  0.90
   86   88 A   3  13  83   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.561     18  0.88
   87   89 A   0   0   0   0  99   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.074      2  1.00
   88   90 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   284    0    0   0.000      0  1.00
   89   91 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   284    0    0   0.023      0  1.00
   90   92 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   284    0    0   0.000      0  1.00
   91   93 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   284    0    0   0.000      0  1.00
   92   94 A   0   1   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    1    0   0.074      2  0.99
   93   95 A  10   0  11   0   0   0   0  12  66   0   0   0   0   0   0   0   0   0   0   0   283    0    0   1.053     35  0.52
   94   96 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   283    0    1   0.023      0  1.00
   95   97 A   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.047      1  0.99
   96   98 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.000      0  1.00
   97   99 A   0   0   0   0   0   0   0   0   0   0   8   1   0   4   0   3   0   5  80   0   283    0    0   0.779     26  0.71
   98  100 A   0   0   1   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   283    0    0   0.042      1  0.99
   99  101 A  98   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.121      4  0.96
  100  102 A   1   0   0   0   0   0   0   0   8   0   4   0   0   0   2  45  33   8   0   0   283    0    0   1.393     46  0.40
  101  103 A   0  46   0   6   0   0   1   0   5   0   4   0   0   8   0  25   1   0   3   0   283    0    0   1.561     52  0.25
  102  104 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   283    0    0   0.000      0  1.00
  103  105 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.023      0  1.00
  104  106 A   3   0   3   0   0   0   0   2   8   0  33  24   0  18   1   5   1   1   0   0   284    0    0   1.845     61  0.22
  105  107 A   0   0   0   0   0   0   0  35  16   0  35   0   0   0   2   3   1   2   6   1   284    0    0   1.523     50  0.47
  106  108 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.000      0  1.00
  107  109 A  46   1  10   0   0   0   0   0  13   3  10  14   0   3   0   0   0   0   0   0   284    0    0   1.613     53  0.33
  108  110 A   0  21   0   0   5   0  45   0  14   0   0   0   0  14   0   0   0   0   0   0   284    0    0   1.420     47  0.28
  109  111 A   0   0   0   0   0   0   0   0   1   0   0   0   0   2  51  40   4   0   0   0   284    0    0   1.042     34  0.66
  110  112 A   1   0  98   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   284    0    0   0.124      4  0.98
  111  113 A   8   0  12   0   0   0   0   0  53   0  27   0   0   0   0   0   0   0   0   0   284    0    0   1.161     38  0.41
  112  114 A   0   3   0   0   0   0   0   0   0   0  22   1   0   0   3   6   8  49   1   6   284    0    0   1.575     52  0.41
  113  115 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.000      0  1.00
  114  116 A   0   0   0   0   0   0   0   0  73   0  27   0   0   0   0   0   0   0   0   0   284    0    0   0.584     19  0.70
  115  117 A   0   0   0   0   0   0   0   0   0   1   0   0   0  48   0   0   1   4   0  45   284    0    0   0.974     32  0.56
  116  118 A   0   7  92   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.324     10  0.92
  117  119 A  16   0  14   0   0   0   0   0   0   0   1  70   0   0   0   0   0   0   0   0   284    0    0   0.851     28  0.57
  118  120 A   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0  98   0   284    0    0   0.105      3  0.97
  119  121 A  12   1   1   0   0   0   0   0  69   0   0   0  17   0   0   0   0   0   0   0   284    0    0   0.940     31  0.53
  120  122 A   0   0   0   0   0   0   0   0   5   0  12   2   0  67   0   0   0   0  13   1   284    1    0   1.078     35  0.47
  121  123 A  10   3  16  14   0   0   0  37   2   7   5   6   0   0   0   0   0   0   0   0   283    0    0   1.865     62  0.19
  122  124 A  63  25   5   0   2   0   0   0   0   0   0   0   0   3   0   0   0   0   0   1   284    0    0   1.045     34  0.66
  123  125 A   8   0   1   0   0   0   0   1   8  55   1  26   0   0   0   0   0   0   0   0   284    0    0   1.224     40  0.48
  124  126 A   0   0   0   0   0   0   0  99   1   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.089      2  0.98
  125  127 A   0   0   0   0   0   0   0   0  11  37   8   1   0   0   1  15   1  23   1   3   284    0    0   1.692     56  0.33
  126  128 A   0   0   0   0   0   0   0  71  18   0   7   0   0   0   1   0   0   0   0   2   284    0    0   0.881     29  0.70
  127  129 A  13   0  71   2   0   0   0   1   2   0  10   0   0   0   0   0   0   0   0   0   284    0    0   0.971     32  0.64
  128  130 A  74   2  23   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.671     22  0.87
  129  131 A   0   0   0   0   0   0   0   0  10   0  20  21   0   2   5  10   8  14   1  10   284    0    0   2.092     69  0.27
  130  132 A   0   0   0   0   0   0   0  61  29   0  10   0   0   0   0   0   0   0   0   0   284    0    0   0.906     30  0.65
  131  133 A   0  98   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.112      3  0.98
  132  134 A   0   0   0   0   0   0   0   2  40   0   6   2   0   0   2  41   1   5   0   0   284    0    0   1.424     47  0.34
  133  135 A   0   0   0   0   0   0   0   0   4   0   9   1   0   2   1   8  42  27   4   1   284    0    0   1.635     54  0.44
  134  136 A  21   0   5   0   0   0   0  11  48   0   0  15   0   0   0   0   0   0   0   0   284    0    0   1.393     46  0.42
  135  137 A   0   0   2   0   0   0   0  23  72   0   2   1   0   0   0   0   0   0   0   0   284    0    0   0.790     26  0.71
  136  138 A   1  17   1   0   0   0   0   0   7   0  16   5   0   0   2   9  17  18   3   3   284   62  115   2.174     72  0.16
  137  139 A   0   1   1   0   1   0   0   5   1   0   1   0   0   1   0   1   2  65   0  20   222    0    0   1.203     40  0.65
  138  140 A  14   0   2   0  14   0   1   1   5  21   2  19   0   0   1   1   0  11   2   2   284   76  102   2.196     73  0.10
  139  141 A   0   0   0   0   0   0   0  16   4  16   7  42   0   0   1   1   0   4   4   1   208    0    0   1.772     59  0.32
  140  142 A   2   9   3   3   0   0   0   3   9   7  14   2   0   0   2  19   7   3   7  10   232    0    0   2.468     82  0.13
  141  143 A   0   0   0   0   0   0   0   6   0   7   1   0   0   1   0   1   4  66   0  13   236   88   32   1.225     40  0.62
  142  144 A   0   2   0   0   0   0   1  27   7  53   2   2   0   0   0   0   0   3   4   1   195    0    0   1.377     45  0.39
  143  145 A   0   0   0   0   0   0   0   0   1   0   0   2   0   0  94   0   0   1   1   0   282    0    0   0.312     10  0.88
  144  146 A   0   0   0   0   0   0   0  88   8   0   0   0   0   0   0   0   0   2   0   0   284    0    0   0.524     17  0.85
  145  147 A   0  96   1   0   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.212      7  0.96
  146  148 A   1  93   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.338     11  0.91
  147  149 A   1  26  30  38   0   0   0   0   0   0   0   0   0   1   2   0   0   0   0   0   284    0    0   1.325     44  0.61
  148  150 A   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.047      1  0.99
  149  151 A   0   0   0   0   0   0   0   4  95   0   1   0   0   0   0   0   0   0   0   0   284    1   15   0.257      8  0.93
  150  152 A   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0  18  79   1   0   283    0    0   0.632     21  0.77
  151  153 A   0  37   0  62   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.683     22  0.93
  152  154 A   0   0   0   0   0   0   0   0   0   0  81  18   0   0   0   0   0   0   0   0   283    0    0   0.500     16  0.72
  153  155 A   0   0   0   0   0   0   0   0   1   0  83   7   8   0   0   0   0   0   0   0   284    0    0   0.646     21  0.79
  154  156 A   1   0   0   0   0   0   0   0  15   0   0   0   0   0   1  69   6   6   0   0   284    0    0   1.036     34  0.52
  155  157 A   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   1   0   283    0    0   0.059      1  0.98
  156  158 A   0   0   0   0   0   0   0   0  10   0  59   4   4   3   0   0   0   0  20   0   284    0    0   1.231     41  0.47
  157  159 A   0  81   4   2  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.684     22  0.90
  158  160 A   0   2   0  18   1   0   0   0  70   0   1   6   0   0   0   0   0   0   0   0   284    0    0   0.961     32  0.50
  159  161 A   3   0   0   0   1   0  11   0   0   0   1  48   0  11   2   8   3   0   8   2   284    0    0   1.781     59  0.26
  160  162 A   0   0   0   0   0   0   0  80   0   6   1   0   0   0   2   8   0   1   0   1   284    0    0   0.829     27  0.63
  161  163 A   0   1   1   0   0   0   0   0   8   1  10   2   0   0   0   4   6  60   0   7   284    0    0   1.484     49  0.52
  162  164 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.023      0  0.99
  163  165 A   0   0   0   0   0   0   0   0   1   0   5  90   0   0   0   1   3   0   0   0   284    0    0   0.431     14  0.83
  164  166 A   1   0   0   0   0   1   0   0   6   0   6  10   0   0   5  24  22  17   4   4   284    0    0   2.059     68  0.30
  165  167 A   0   5   0   0   0   0   0  17  27   0   4   3   0   0   3  18   6  12   0   4   284    0    0   2.051     68  0.26
  166  168 A   1   0   0   0   0   0   0   0   9   0  22  46  20   0   0   0   0   0   1   0   284    0    0   1.353     45  0.40
  167  169 A  87   4   6   1   0   0   1   0   0   0   0   0   0   0   1   0   0   0   0   0   284    0    0   0.555     18  0.88
  168  170 A   0   0   0   0   0   0   0   0   2   0   0   0   0   1   6   4   7  49   1  27   284    0    0   1.478     49  0.57
  169  171 A   1   5  42  23   0   1   8   0  17   0   2   0   1   1   0   0   0   1   0   0   284    0    0   1.655     55  0.30
  170  172 A   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.047      1  0.99
  171  173 A   0   0   0   0   0   0   0   0   0   0   0   0   0   1  58  37   1   1   1   0   284    1   12   0.942     31  0.69
  172  174 A   0   2   1   0   0   0   0   1   5   0  26   9   0   0  11  19   1  19   2   4   283    0    0   2.035     67  0.25
  173  175 A   0   0   0   0   1   0  14   3   0   0   0   1   0  29   1   0   0   1  14  36   284    0    0   1.602     53  0.32
  174  176 A   0   0   0   0   0   0   0   0   2   7   6   2   0   0  19  61   1   0   1   0   284    0    0   1.278     42  0.56
  175  177 A   0   0   0   0   0   0   0  10   1   0   5   1   0   0   2   2   1  25   7  45   284    0    3   1.593     53  0.55
  176  178 A   0   0   0   0  96   1   1   0   0   0   1   0   0   0   0   0   0   0   0   0   284    0    0   0.237      7  0.95
  177  179 A  96   0   2   0   0   0   0   0   0   0   0   1   1   0   0   0   0   0   0   0   284    0    0   0.235      7  0.95
  178  180 A   6   8  43  33   8   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   283    0    0   1.393     46  0.59
  179  181 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.023      0  1.00
  180  182 A   0   0   0   0  97   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   284    1    0   0.128      4  1.00
  181  183 A  30   0  70   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.611     20  0.87
  182  184 A   0   0   0   0   0   0   0   2  71   0  26   0   1   0   0   0   0   0   0   0   283    0    0   0.736     24  0.66
  183  185 A   0   0   1   6   0   0   0   1   0   0   1  16   0   0   1   0  73   0   1   0   284    0  132   0.913     30  0.51
  184  186 A   1   0   0   0   0   0   0   2   2  14   1   1   0   4  39  13   2  10   8   1   284   80   72   1.951     65  0.32
  185  187 A   1  13   0   5   0   0   2   4   3   2   5   1   0   0   3   2   2  12   0  44   204    1    0   1.968     65  0.21
  186  188 A   5   2   0  44   3   0   0   0   6   2   2   2   0   0   2   0   1   6  18   4   215    1    0   1.963     65  0.15
  187  189 A   1   1   0   0   0   0   0  49   5   7   8   7   0   0   0   1   4   8   2   5   220    0    0   1.859     62  0.38
  188  190 A   4   2   0   0   0   0   2  47  11   1  10   3   0   1   0   2   2  11   1   2   245    0    0   1.875     62  0.35
  189  191 A   1   3   1   0   0   0   2   4   8  10   3   3   0   4  25   3   7  12   0  13   260    0    0   2.363     78  0.18
  190  192 A   0   1   0   0   0   0   0   7   4   2   1   1   0   1   0   1   1  25   3  51   284    0    0   1.544     51  0.59
  191  193 A   0   0   0   0   0   0   0   2   2   2   1   1   0   0   1   0   1  64   0  26   284    0    0   1.093     36  0.71
  192  194 A   0   0   0   0   0   0   0  38   4   1   1   0   0   0   0   0   2   4   8  41   284    0    0   1.434     47  0.54
  193  195 A   0   0   0   0  75   0  16   0   1   0   0   0   0   0   1   1   0   3   0   2   284  168    6   0.917     30  0.75
  194  196 A   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0  99   116    0    0   0.050      1  0.98
  195  197 A   0   2   0   0   6  91   1   0   0   0   0   0   0   0   0   0   0   0   0   0   124    0    0   0.376     12  0.93
  196  198 A  25  43  32   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   1.075     35  0.71
  197  199 A  28   4  43   0   0   0   1   0   0   0   1   9   0  13   0   0   0   0   0   0   284    0    0   1.469     49  0.41
  198  200 A   0  15   0  65  19   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.899     29  0.77
  199  201 A   0   0   0   0   0   0   0   0   1   0   6  93   0   0   0   0   0   0   0   0   284    0    0   0.294      9  0.89
  200  202 A   0   0   0   0   0   0   0   0   0  82   0  18   0   0   0   0   0   0   0   0   284    0    0   0.476     15  0.73
  201  203 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.000      0  1.00
  202  204 A  79   0   2   0   0   0   0   0   0   0   0   0  18   0   0   0   0   0   0   0   284    1    0   0.604     20  0.68
  203  205 A   0   0   0   0   0   0   0  57   0   0   1   0   0   0   0   5  17   0  18   0   283    0    0   1.187     39  0.44
  204  206 A   0  92   4   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.396     13  0.91
  205  207 A   1   0   0   0   0   0   0   1   7  19  13   0   0   0   0   0   2   4   0  52   283    0    0   1.460     48  0.38
  206  208 A  12   0   1   0   0   0   0   0   6  18  20   2   0   0   0   1   1   4   0  36   283    0    0   1.771     59  0.24
  207  209 A   0   0   0   0   0   0   0   3   1   5   4   4   0   0   1  68   2  10   0   0   283   25   11   1.268     42  0.51
  208  210 A   0   0   0   0   0   0   0  90   1   0   2   0   0   0   0   0   0   3   2   1   258    0    0   0.492     16  0.85
  209  211 A   0   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0   0   5   0  92   265    0    0   0.352     11  0.91
  210  212 A   0   0   0   0   0   0   0  24  33   0   9   0   0   0   0  15   5   9   1   4   266    0    0   1.786     59  0.35
  211  213 A   1  70   0  12   0   0   0   0   1   0   0   0   0   0   0   0   0   6   4   3   267    0    0   1.130     37  0.56
  212  214 A   0   0   0   0   0   0   0  89   1   1   0   0   0   0   0   1   2   0   5   1   281    0    0   0.529     17  0.82
  213  215 A   0   0   0   0   0   0   0   2   1   1   1   1   0   1   0   0  88   5   0   0   282    0   57   0.604     20  0.80
  214  216 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  98   0   1   0   282    0    0   0.129      4  0.96
  215  217 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   282    0    0   0.024      0  1.00
  216  218 A   0   0   1   0   0   0   0   0   0   0   0   1   0   0  58   1  18   0  21   0   282    0    0   1.130     37  0.42
  217  219 A   0   0   0   0   0   0   0   0   0   0   4  95   0   0   0   0   0   0   0   0   282    0    0   0.247      8  0.92
  218  220 A  37   0   0   0   0   0   0   0   0  62   0   0   0   0   0   0   0   0   0   0   282    0    0   0.682     22  0.52
  219  221 A   0   0   0   0   0   0   1   2   8   0   4   1   0   7  10   2  13  12   2  37   282    0    0   1.971     65  0.36
  220  222 A   0   0   0   0   0   0   0   0   1   0  17   2   0   0   0  18   9  33   2  16   282    0    0   1.798     60  0.36
  221  223 A  60  11   8   0   0   0   0   0  21   0   0   0   0   0   0   0   0   0   0   0   282    0    0   1.087     36  0.55
  222  224 A  48   0  46   2   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.951     31  0.80
  223  225 A   4   7   0   0   2   0   5  27   5   0  29   2   0   0   5   3   2   5   2   1   284    0    0   2.145     71  0.18
  224  226 A   2   5   6   0   0   0   0   7   2   0   0  30   0   0  17   1   2  17   2   7   284    0  114   2.086     69  0.15
  225  227 A   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   1   0   284    0    0   0.135      4  0.96
  226  228 A   0   0   0   0   0   0   0   1  27   0  28  25  18   0   0   0   0   0   1   0   284    0    0   1.490     49  0.40
  227  229 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   284    0    0   0.000      0  1.00
  228  230 A  29   2  51   0  18   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   1.086     36  0.69
  229  231 A   9   1  83   0   0   0   0   0   6   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.599     20  0.80
  230  232 A   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.000      0  1.00
  231  233 A  82   0   0   0   0   0   0   0  10   0   8   0   0   0   0   0   0   0   0   0   284    0    0   0.602     20  0.67
  232  234 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.000      0  1.00
  233  235 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   284    0    0   0.000      0  1.00
  234  236 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.023      0  0.99
  235  237 A   5  37  58   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   284    0    0   0.833     27  0.75
  236  238 A   4   7  11   0  35   0  43   0   0   0   0   1   0   0   0   0   0   0   0   0   284    0    0   1.335     44  0.66
  237  239 A   0   0   0   0   0   0   0  44  31   0   1   2   0   0   4  13   1   2   0   1   284  119   43   1.435     47  0.41
  238  240 A   0   4   0   0   0   0   0   4   5   3   3   0   0   0   0  62   6   1   5   7   165    0    0   1.455     48  0.37
  239  241 A   5   0   0   0   1   0   1  38  40   4   1   3   0   0   1   0   0   1   2   2   284    0    0   1.554     51  0.46
  240  242 A   0   0   0   0   0   0   0   6   8  11   7   0   0   0  39   2   4  13   2   8   284    0    0   1.965     65  0.22
  241  243 A   1   0   0   0   0   0   0   0   7   0   0   0   0   0   1   3   2   5   4  77   284    0    0   0.956     31  0.72
  242  244 A   8   1  10   1   0   0   0   0  10  64   1   0   0   0   6   0   0   0   0   0   284    0    0   1.227     40  0.46
  243  245 A  33   4   2   0   1   0   0   0   7   2   3   4   0   0   7  14   4  14   3   1   283    0    0   2.201     73  0.17
  244  246 A  28   1   1   0   0   1   0   3  16   0   7   2   0   1   2   7   6  23   0   1   283    0    0   2.059     68  0.17
  245  247 A   0   0   0   1   0   0   0   0  19   0   1   0   0   0   2   0  14  61   0   0   283    0    0   1.158     38  0.53
  246  248 A   5   0   2   0   0   0   0  34  53   0   2   2   1   0   0   0   0   0   0   0   283    0    0   1.148     38  0.59
  247  249 A   0   4   1   0   0   0   0   0   2   0   0   0   0   0   5  28   9  49   0   1   283    0    0   1.440     48  0.44
  248  250 A   0   0   0   0   0   0   0   0   1   0   0   0   0   0  83   1  11   2   0   0   283    0    0   0.660     22  0.74
  249  251 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.023      0  1.00
  250  252 A   0   0   0   2   0   0   0   0   0   0   0   0   0   0  69   8  22   0   0   0   283    0    0   0.857     28  0.66
  251  253 A   0   0   0   0   0   0   0   0   4   0   9   2   0   0   7  37  11  16   2  11   283    0    0   1.879     62  0.36
  252  254 A   0   1   0   0   0   0   0   0  65   0   1   0   0   0   1   7   5  20   0   0   283    0    0   1.069     35  0.50
  253  255 A   0   0   0   0   0   0   0  80  20   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.543     18  0.79
  254  256 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.000      0  1.00
  255  257 A   1   0   0   0   0   0   0   0   6   0   5   2   0   0   2  24   2  28  13  16   283    0    0   1.876     62  0.38
  256  258 A   0   0   0   0   0   0   0   1  99   0   0   0   0   0   0   0   0   0   0   0   283    0    0   0.082      2  0.98
  257  259 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   281    0    0   0.024      0  0.99
  258  260 A   0  63   1   2   0   0   0   0   0   0   0  10   0   0   1   1   9  13   0   0   277    0    0   1.216     40  0.37
  259  261 A   0   0   0   0   0   0   0   1  12   0   4   1   0   1  11  29   3  30   4   4   277    0    0   1.848     61  0.33
  260  262 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  95   5   0   0   0   0   273    0    0   0.213      7  0.95
  261          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  262    3 C   0   0   0   0   0   0   0   0   0   0   6  22   0   0   7  49  10   0   5   1   100    0    0   1.464     48  0.41
  263    4 C   5   3   0   2   0   0   0   0  42   2   3   4   0   0   0   8  22   6   2   0   121    0    0   1.803     60  0.29
  264    5 C   0   0   0   0   0   0   0   0   1   6  23  69   0   0   0   0   0   0   1   0   219    0    0   0.855     28  0.62
  265    6 C   0   0   0   0   6   0  94   0   0   0   0   0   0   0   0   0   0   0   0   0   253    0    0   0.236      7  0.99
  266    7 C   1   2   0   0   0   0   0   9  24   0  21  15   0   1   3  10   3   9   0   1   253    0    0   2.098     70  0.28
  267    8 C   4   0   1   0   0   0   0   0  15   0   9   5   0   0   0   1  16  43   0   6   253    0    0   1.717     57  0.38
  268    9 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   253    0    0   0.026      0  0.99
  269   10 C   1   0   3   0   0   0   0   2  87   0   5   0   0   0   0   0   0   0   0   0   253    0    0   0.615     20  0.78
  270   11 C   0   1   0   0   0   0   0   1  25   1  19   3   0   0   2  13   9  18   3   4   253    0    0   2.076     69  0.28
  271   12 C   4   6   1   0   2   0   0   0  12   0  11  21   0   3   8  18   4   0   8   2   253    0    0   2.298     76  0.17
  272   13 C   1   0   0   0   1   0   2   0   6   2   2   2   3  77   0   0   2   0   1   0   254    0    0   1.057     35  0.56
  273   14 C   0   0   0   0   0   0   0   3   8  48  12  14   0   0   2   6   4   0   2   1   257    1    7   1.720     57  0.39
  274   15 C   1   0   0   0   0   0   0   2   0   0  42   2   0  11   0   0   0   0  42   0   257    0    0   1.180     39  0.40
  275   16 C   0   0   0   0   0   0   0   0  12  79   0   0   0   0   0   5   1   2   0   0   261    0    0   0.795     26  0.71
  276   17 C  40  38   2   0   0   0   0   0  12   0   0   5   3   0   0   0   0   0   0   0   264    0    0   1.346     44  0.45
  277   18 C   5   0   0   0   0   0   0   1  81   0   4   6   0   0   0   0   0   0   3   0   264    0    0   0.789     26  0.70
  278   19 C   1   0   0   0   0   0   0   0  17   0  13   2   0   0  29  28  10   0   0   0   264    0    0   1.672     55  0.33
  279   20 C   0   2   0   0   0   0  12   0   5   0   5   0   0   2  35  33   5   2   0   1   264    0    0   1.679     56  0.26
  280   21 C   1  97   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.163      5  0.97
  281   22 C   0  47   0   0  51   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.805     26  0.86
  282   23 C   0   1   0   0   0   0   0   1   4   0   5   6   0   4  16   7  10  27  16   2   265    0    0   2.123     70  0.28
  283   24 C   7  49  33   0   0   0   0   0   0   0   0   9   2   0   0   0   0   0   0   0   265    0    0   1.214     40  0.58
  284   25 C   2   0  13  63   0   0   0   0  21   0   0   0   2   0   0   0   0   0   0   0   266    0    0   1.017     33  0.47
  285   26 C   2   0   0   0   0   0   0   0   9   0   3   2   0  15   0   0   1  50   0  17   266    0    0   1.552     51  0.49
  286   27 C   2   7   3   0   0   0   0   0  12   0  11   4   0   0  21   1   7  30   0   2   266    0    0   2.009     67  0.17
  287   28 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   266    0    0   0.025      0  0.99
  288   29 C   0   0   0   0   0   0   0   0   6   0   1   0   0   1   8  52  32   2   0   0   266    0    0   1.209     40  0.51
  289   30 C   0   0   0   0   0   0   0   0   0   0  43  56   0   0   0   0   0   0   0   0   266    0    0   0.707     23  0.59
  290   31 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   266    0    0   0.000      0  1.00
  291   32 C  18  82   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.472     15  0.84
  292   33 C   8   0   1   0   0   0   0   0   6   0   9  11  65   0   0   0   0   0   0   0   266    0    0   1.157     38  0.53
  293   34 C  41  16   3   0   0   0   0   0  39   0   0   0   0   0   0   0   0   0   0   0   265    0    0   1.160     38  0.42
  294   35 C   0   0   0   0   0   0   0   0   7   0  92   0   0   0   0   0   0   0   1   0   266    0    0   0.291      9  0.89
  295   36 C  31  21   9   0   0   0   0   0  38   0   0   0   1   0   0   0   0   0   0   0   266    0    0   1.315     43  0.39
  296   37 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   266    0    0   0.000      0  1.00
  297   38 C  90   5   1   0   2   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.452     15  0.88
  298   39 C   1   0   0   0   0   0   0   0   5   3   3  51   0   2  23   3   2   5   2   2   266    0    0   1.607     53  0.34
  299   40 C   0   0   0   0   0   0   0   0   0   0   9  69   0   2   2  12   1   1   3   2   266    0    0   1.137     37  0.55
  300   41 C   0   0   0   0   0   0   0   0  11   0  16  59   0   0   0  12   0   0   0   0   266    0    0   1.201     40  0.47
  301   42 C   0   0   0   0   0   0   0   0  25   0  10   2   0   0  11  36   5   6   2   3   266    0    0   1.788     59  0.32
  302   43 C   0   0   0   0   0   0   0   2   3   0   4   1   0   0   0   4   3  71   0  11   266    0    0   1.106     36  0.68
  303   44 C   3  72   3   0  21   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.804     26  0.87
  304   45 C   1  95   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.229      7  0.95
  305   46 C   0   0   0   0   0   0   5   0  11   0  15   3   0   3   8   6   5  20   1  22   266    0    0   2.133     71  0.25
  306   47 C   5  68  20   0   5   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   266    0    0   0.987     32  0.72
  307   48 C  30   6  16   0   0   0   0   0  47   0   0   0   2   0   0   0   0   0   0   0   265    0    0   1.241     41  0.43
  308   49 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   3   0   1  26   2  67   266    0    0   0.943     31  0.76
  309   50 C   5   1   2   0   0   0   0   1  21   0   2   8   0   1  18  26   5   5   1   3   266    3    2   2.121     70  0.22
  310   51 C  30  57  10   0   0   0   0   0   2   0   0   1   0   0   0   0   0   0   0   0   263    0    0   1.058     35  0.69
  311   52 C   0   0   0   0   0   0   0  98   2   0   0   0   0   0   0   0   0   0   0   0   263    0    0   0.119      3  0.97
  312   53 C   0   0   0   0   0   0   0   0   2  91   0   0   0   0   0   0   0   0   0   6   266    0    0   0.412     13  0.82
  313   54 C   0   2   0   0  10   0  48   0   2   0  14   0   0  10   0   9   0   2   2   1   266    0    0   1.651     55  0.27
  314   55 C  17   0  78   3   0   0   0   0   1   0   0   0   2   0   0   0   0   0   0   0   266    1    0   0.707     23  0.84
  315   56 C  12   0   0   0   0   0   0   0  15   0   0   2  71   0   0   0   0   0   0   0   265    0    0   0.883     29  0.56
  316   57 C  38  49   2  10   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   265    0    0   1.072     35  0.69
  317   58 C  28  47  21   0   3   0   0   0   1   0   0   1   0   0   0   0   0   0   0   0   265    0    0   1.230     41  0.68
  318   59 C   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0  99   0   0   0   0   265    1    1   0.044      1  0.98
  319   60 C   0   0   0   0   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   264    0    0   0.100      3  0.97
  320   61 C   0   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   264    0    0   0.050      1  0.98
  321   62 C  25   0  58   1   0   0   5   0   2   0   0   0   5   3   0   0   0   0   0   0   265    0    0   1.197     39  0.60
  322   63 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  99   265    0    0   0.050      1  0.98
  323   64 C   3   4  89   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.502     16  0.88
  324   65 C  24  39  36   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   1.100     36  0.71
  325   66 C   0   0   0   0   0   0   0   0   4   0  28  21   0   1   1   0   0  23   2  19   266    0    0   1.685     56  0.35
  326   67 C   0   0   0   0   0   0   0   7   0   0   0   0   0   0   0   0   0   0   1  92   266    0    0   0.333     11  0.89
  327   68 C   0   3   0   0  85  11   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266   64   37   0.532     17  0.93
  328   69 C   0   0   0   0   0   0   0   0   0   9  47  16   0   0   0   0   0   3   0  23   202    1    0   1.369     45  0.37
  329   70 C   4   8   8  17   8   0  26   0   3   4   3   1   0   2   4   1   9   1   0   0   203   72    2   2.332     77  0.12
  330   71 C   0   0   0   0   0   0   0   0   4   8   1  10   0   0   0   2   4  52   2  18   194    0    0   1.527     50  0.45
  331   72 C   0   0   0   0   0   0   0  40   3   0   8   6   0   1   6   2   2  15   4  13   250    0    0   1.893     63  0.38
  332   73 C   1  15   1   1   3   0   0   0   0   0   0  78   0   0   0   0   0   0   0   0   252    0    0   0.767     25  0.58
  333   74 C  35   3  45   0   0   0   0   8   6   0   0   3   0   0   0   0   0   0   0   0   266    0    0   1.330     44  0.56
  334   75 C  10   9   2   0   1   0   0   0  11   0   2   8   0   2   2  20  10  14   4   7   266    0    0   2.363     78  0.17
  335   76 C   0   0   0   0   0   0   0  19   4  39   5   1   0   1   5  13   9   3   0   0   266    0    0   1.823     60  0.27
  336   77 C   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    1    0   0.049      1  0.99
  337   78 C   9  12   2   0   0   0   0   0   8   0   1   4   0   0   6  36  15   2   5   0   265    0    0   1.997     66  0.21
  338   79 C   2   0   0   0   0   0   0   1  34   0   7   2   0   0   2   6   7  36   1   3   266    0    0   1.722     57  0.38
  339   80 C   2  89   6   1   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.476     15  0.88
  340   81 C   0   0   0   0   0   0   0   0  62   0  36   0   0   0   0   1   0   0   0   0   266    0    0   0.757     25  0.63
  341   82 C   2   2   0   0   0   0   0   0  17   0   2   1   0   1  14  33  12  12   0   4   266    0    0   1.934     64  0.30
  342   83 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0  11  83   3   2   0   0   266    0    0   0.636     21  0.80
  343   84 C   0   2   0   0   2   0  12   0   0   0   0   0   0  77   0   6   0   0   0   0   266    0    0   0.810     27  0.64
  344   85 C   0   0   0   0   0   0   0   9   0   0   2   0   0   0   5   9   4   0  47  21   266    0    0   1.623     54  0.45
  345   86 C   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.000      0  1.00
  346   87 C   6  73   0  21   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.784     26  0.89
  347   88 C   3  14  83   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.574     19  0.87
  348   89 C   0   0   0   0  98   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.078      2  1.00
  349   90 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   266    0    0   0.000      0  1.00
  350   91 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   266    0    0   0.025      0  1.00
  351   92 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   266    0    0   0.000      0  1.00
  352   93 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   266    0    0   0.000      0  1.00
  353   94 C   0   2   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    1    0   0.078      2  0.99
  354   95 C  10   0  12   0   0   0   0   7  71   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.955     31  0.55
  355   96 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   265    0    1   0.025      0  1.00
  356   97 C   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.050      1  0.99
  357   98 C   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.000      0  1.00
  358   99 C   0   0   0   0   0   0   0   0   0   0   8   1   0   3   0   2   0   5  81   0   265    0    0   0.750     25  0.72
  359  100 C   0   0   1   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   265    0    0   0.062      2  0.98
  360  101 C  97   0   0   0   0   0   0   0   2   0   1   0   0   0   0   0   0   0   0   0   265    0    0   0.163      5  0.94
  361  102 C   1   0   0   0   0   0   0   0   9   0   4   0   0   0   2  48  32   4   0   0   265    0    0   1.350     45  0.41
  362  103 C   0  44   0   4   0   0   1   0   5   0   5   0   0   9   0  27   2   0   3   0   265    0    0   1.604     53  0.22
  363  104 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   265    0    0   0.000      0  1.00
  364  105 C   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.025      0  1.00
  365  106 C   3   0   2   0   0   0   0   2   9   0  35  18   0  20   2   6   1   2   0   0   266    0    0   1.856     61  0.21
  366  107 C   0   0   0   0   0   0   0  35  15   0  35   0   0   0   2   4   0   1   6   1   266    0    0   1.501     50  0.47
  367  108 C   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.000      0  1.00
  368  109 C  49   1  11   0   0   0   0   0  14   3   7  12   0   3   0   0   0   0   0   0   266    0    0   1.567     52  0.36
  369  110 C   0  23   0   0   6   0  48   0   8   0   0   0   0  15   0   0   0   0   0   0   266    0    0   1.353     45  0.35
  370  111 C   0   0   0   0   0   0   0   0   1   0   0   0   0   3  49  42   5   0   0   0   266    0    0   1.042     34  0.66
  371  112 C   1   0  98   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   266    0    0   0.131      4  0.97
  372  113 C   7   0   6   0   0   0   0   0  58   0  29   0   0   0   0   0   0   0   0   0   266    0    0   1.050     35  0.48
  373  114 C   0   3   0   0   0   0   0   0   0   0  24   2   0   0   3   6   9  47   1   5   266    0    0   1.597     53  0.39
  374  115 C   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.000      0  1.00
  375  116 C   0   0   0   0   0   0   0   0  72   0  28   0   0   0   0   0   0   0   0   0   266    0    0   0.591     19  0.70
  376  117 C   0   0   0   0   0   0   0   0   0   1   1   0   0  43   0   0   2   5   0  50   266    0    0   0.987     32  0.55
  377  118 C   0   8  91   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.349     11  0.91
  378  119 C  14   0  15   0   0   0   0   0   0   0   0  71   0   0   0   0   0   0   0   0   266    0    0   0.826     27  0.57
  379  120 C   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0  98   0   266    0    0   0.094      3  0.97
  380  121 C   7   2   0   0   0   0   0   0  73   0   0   0  18   0   0   0   0   0   0   0   266    0    0   0.812     27  0.58
  381  122 C   0   0   0   0   0   0   0   0   6   0  13   2   0  72   0   0   0   0   7   1   266    1    0   0.954     31  0.49
  382  123 C  11   4  15   9   0   0   0  40   2   8   5   6   0   0   0   0   0   0   0   0   265    0    0   1.839     61  0.21
  383  124 C  63  28   4   0   2   0   0   0   0   0   0   0   0   1   0   0   0   0   0   1   266    0    0   0.980     32  0.70
  384  125 C   8   0   1   0   0   0   0   2   7  53   1  28   0   0   0   0   0   0   0   0   266    0    0   1.244     41  0.47
  385  126 C   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.074      2  0.98
  386  127 C   0   0   0   0   0   0   0   0  12  40   8   1   0   0   0   9   1  24   1   4   266    0    0   1.653     55  0.36
  387  128 C   0   0   0   0   0   0   0  78  12   0   8   0   0   0   1   0   0   0   0   2   266    0    0   0.749     24  0.75
  388  129 C  15   0  77   2   0   0   0   1   2   0   3   0   0   0   0   0   0   0   0   0   266    0    0   0.818     27  0.76
  389  130 C  73   2  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.676     22  0.87
  390  131 C   0   0   0   0   0   0   0   0   8   0  20  20   0   3   3  10   8  16   1  10   266    0    0   2.074     69  0.27
  391  132 C   0   0   0   0   0   0   0  66  29   0   5   0   0   0   0   0   0   0   0   0   266    0    0   0.780     26  0.69
  392  133 C   0  99   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.062      2  1.00
  393  134 C   0   0   0   0   0   0   0   3  35   0   7   2   0   0   3  44   1   5   0   1   266    0    0   1.468     48  0.32
  394  135 C   0   0   0   0   0   0   0   0   4   0  10   1   0   1   1   9  43  27   2   2   266    0    0   1.587     52  0.44
  395  136 C  23   0   5   0   0   0   0  10  45   0   0  17   0   0   0   0   0   0   0   0   266    0    0   1.405     46  0.40
  396  137 C   0   0   3   0   0   0   0  25  69   0   2   1   0   0   0   0   0   0   0   0   266    0    0   0.830     27  0.69
  397  138 C   1  19   1   1   0   0   0   0   5   0  17   5   0   0   1   8  17  19   2   3   266   64   95   2.133     71  0.16
  398  139 C   0   1   1   0   0   0   0   3   0   0   1   1   0   1   0   1   2  70   0  17   202    0    0   1.085     36  0.70
  399  140 C  15   0   1   0  14   0   1   0   8  23   3  21   0   0   1   1   0   4   2   4   266   73   81   2.135     71  0.12
  400  141 C   0   0   1   0   0   0   0  18   5  12   6  46   1   1   2   1   1   2   5   2   193    0    0   1.773     59  0.32
  401  142 C   2   7   2   3   0   0   0   4   4   8  16   0   0   0   2  22   8   3   8  11   212    0    0   2.425     80  0.15
  402  143 C   0   0   0   0   0   0   0   7   0   1   1   0   0   2   0   1   6  67   0  14   218   82   19   1.202     40  0.66
  403  144 C   0   0   0   0   0   0   1  28   7  56   1   1   0   1   0   0   0   3   2   2   183    0    0   1.216     40  0.44
  404  145 C   0   0   0   0   0   0   0   0   1   0   0   3   0   0  93   0   0   1   1   0   264    0    0   0.389     12  0.84
  405  146 C   0   0   0   0   0   0   0  86   8   0   0   0   0   0   0   0   0   3   0   0   266    0    0   0.575     19  0.83
  406  147 C   0  95   1   0   1   0   0   0   1   0   0   0   0   1   0   0   0   0   0   0   266    0    0   0.268      8  0.94
  407  148 C   1  92   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   266    0    0   0.393     13  0.89
  408  149 C   1  29  25  41   0   0   0   0   0   0   0   0   0   1   3   0   0   0   0   0   266    0    0   1.337     44  0.62
  409  150 C   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.074      2  0.97
  410  151 C   0   0   0   0   0   0   0   4  94   0   1   0   0   0   0   0   0   0   0   0   266    0   17   0.295      9  0.91
  411  152 C   0   1   0   0   0   0   0   0   0   0   0   2   0   0   0   0  11  85   2   0   266    0    0   0.540     18  0.81
  412  153 C   0  40   0  59   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.697     23  0.93
  413  154 C   0   0   0   0   0   0   0   0   0   0  79  20   0   0   0   0   0   0   0   0   266    0    0   0.552     18  0.69
  414  155 C   0   0   0   0   0   0   0   0   2   0  81   8   9   0   0   0   0   0   0   0   266    0    0   0.686     22  0.77
  415  156 C   2   0   0   0   0   0   0   0  14   0   0   0   0   0   1  72   5   6   0   0   266    0    0   0.975     32  0.56
  416  157 C   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   1   0   265    0    0   0.069      2  0.98
  417  158 C   0   0   0   0   0   0   0   0  10   0  64   5   3   3   0   0   0   0  15   0   266    0    0   1.151     38  0.51
  418  159 C   0  86   4   3   8   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.567     18  0.92
  419  160 C   0   2   0  11   2   0   0   0  76   0   2   7   0   0   0   0   0   0   0   0   266    0    0   0.878     29  0.58
  420  161 C   3   0   0   0   1   0  12   1   0   0   1  48   0  12   3   9   3   0   5   2   266    0    0   1.796     59  0.25
  421  162 C   0   0   0   0   0   0   0  85   0   5   1   0   0   0   1   6   0   2   0   1   266    0    0   0.677     22  0.72
  422  163 C   0   1   1   0   0   0   0   0   9   1  10   2   0   0   0   4   7  59   0   6   266    0    0   1.520     50  0.50
  423  164 C   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.025      0  0.99
  424  165 C   0   0   0   0   0   0   0   0   1   0   5  90   0   0   0   1   3   0   0   0   266    0    0   0.453     15  0.82
  425  166 C   1   0   0   0   0   1   0   0   5   0   6  11   0   0   5  26  20  19   3   3   266    0    0   2.034     67  0.31
  426  167 C   0   6   0   0   0   0   0  18  21   0   5   3   0   0   4  20   6  12   0   4   266    0    0   2.103     70  0.24
  427  168 C   2   0   0   0   0   0   0   0  10   0  23  49  15   0   0   0   0   0   2   0   266    0    0   1.326     44  0.41
  428  169 C  86   5   6   1   0   0   1   0   0   0   0   0   0   0   1   0   0   0   0   0   266    0    0   0.582     19  0.87
  429  170 C   0   0   0   0   0   0   0   0   3   0   0   0   1   1   7   3   8  46   2  29   266    0    0   1.539     51  0.54
  430  171 C   2   6  44  24   0   1   8   0  11   0   1   0   1   1   0   0   0   1   0   0   266    0    0   1.610     53  0.36
  431  172 C   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.050      1  0.98
  432  173 C   0   0   0   0   0   0   0   0   1   0   0   0   0   1  54  40   2   1   1   0   266    1   13   0.987     32  0.66
  433  174 C   0   2   1   0   0   0   0   1   5   0  28   9   0   0  12  19   2  14   3   5   265    0    0   2.069     69  0.24
  434  175 C   0   0   0   0   1   0  15   3   0   0   0   1   0  26   1   0   0   1  12  38   266    0    0   1.630     54  0.28
  435  176 C   0   0   0   0   0   0   0   0   2   8   6   2   0   0  18  59   1   0   1   0   266    0    0   1.357     45  0.52
  436  177 C   0   0   0   0   0   0   0  10   2   0   5   1   0   0   2   2   1  26   6  45   266    0    4   1.572     52  0.56
  437  178 C   0   0   0   0  96   1   0   0   0   0   2   0   0   0   0   0   0   0   0   0   266    0    0   0.229      7  0.92
  438  179 C  95   0   2   0   0   0   0   0   0   0   0   1   1   0   0   0   0   0   0   0   266    0    0   0.248      8  0.95
  439  180 C   6   9  48  27   8   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   265    0    0   1.401     46  0.60
  440  181 C   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.025      0  1.00
  441  182 C   0   0   0   0  98   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   266    1    0   0.093      3  1.00
  442  183 C  28   0  72   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.592     19  0.88
  443  184 C   0   0   0   0   0   0   0   2  74   0  22   0   2   0   0   0   0   0   0   0   265    0    0   0.712     23  0.69
  444  185 C   0   0   1   7   0   0   0   1   0   0   2  18   0   0   1   0  70   0   1   0   266    0  123   0.963     32  0.47
  445  186 C   2   0   0   0   0   0   0   3   2  10   1   1   0   5  42  14   4   7   9   2   266   74   65   1.947     64  0.34
  446  187 C   2   9   1   5   0   0   2   4   4   2   6   2   0   0   3   3   2  11   0  46   192    0    0   1.971     65  0.23
  447  188 C   6   2   0  47   3   0   0   0   7   2   1   2   0   0   2   0   1   5  14   4   204    2    0   1.921     64  0.17
  448  189 C   1   2   0   0   0   0   0  52   6   8   6   5   0   0   0   1   4   8   1   5   210    0    0   1.817     60  0.38
  449  190 C   4   3   0   0   0   0   3  50  10   1  10   4   0   1   0   3   1   9   1   3   236    0    0   1.822     60  0.36
  450  191 C   0   3   1   0   0   0   2   4   6  11   3   4   0   4  26   3   6  14   0  14   254    0    0   2.303     76  0.19
  451  192 C   0   1   0   0   0   0   0   8   3   2   2   1   0   1   0   1   1  26   3  50   266    0    0   1.572     52  0.58
  452  193 C   1   0   0   0   0   0   0   2   2   2   1   1   0   0   1   1   1  68   0  19   266    0    0   1.112     37  0.70
  453  194 C   0   0   0   0   0   0   0  41   3   1   2   0   0   0   1   0   1   3   8  41   266    0    0   1.394     46  0.54
  454  195 C   0   0   0   0  73   1  18   0   0   0   0   0   0   0   1   1   0   3   0   2   266  150    6   0.957     31  0.75
  455  196 C   1   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0  97   116    0    0   0.137      4  0.94
  456  197 C   0   2   1   0   5  92   0   0   0   0   0   0   0   0   0   0   0   0   0   0   123    0    0   0.355     11  0.91
  457  198 C  27  45  27   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   1.091     36  0.71
  458  199 C  30   4  46   0   0   0   2   0   0   0   0   9   0   8   0   0   0   0   0   0   266    0    0   1.392     46  0.48
  459  200 C   0  17   0  61  21   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.989     33  0.73
  460  201 C   0   0   0   0   0   0   0   0   1   0   7  91   0   0   0   0   0   0   0   0   266    0    0   0.357     11  0.87
  461  202 C   0   0   0   0   0   0   0   0   0  79   0  20   0   0   0   0   0   0   0   0   266    0    0   0.552     18  0.69
  462  203 C   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   266    0   31   0.025      0  0.99
  463  204 C  84  12   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.535     17  0.86
  464  205 C   0   0   0   0   0   0   0  61   0  12   2   0   0   0   0   2   2   0  20   0   266    2  263   1.157     38  0.48
  465          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  466  218 C   0   0   1   0   0   0   0   0   0   0   0   1   0   0  62   1  20   0  14   0   264    0    0   1.098     36  0.46
  467  219 C   0   0   0   0   0   0   0   0   0   0   4  95   0   0   0   0   0   0   0   0   264    0    0   0.260      8  0.92
  468  220 C  40   0   0   0   0   0   0   0   0  60   0   0   0   0   0   0   0   0   0   0   264    0    0   0.672     22  0.51
  469  221 C   0   0   0   0   0   0   1   2   8   0   4   1   0   6  11   3  11  14   2  38   265    0    0   1.944     64  0.37
  470  222 C   0   0   0   0   0   0   0   0   2   0  18   3   0   0   0  12  10  35   2  17   265    0    0   1.783     59  0.37
  471  223 C  63   8   6   0   0   0   0   0  24   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.990     33  0.55
  472  224 C  49   1  44   3   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.958     31  0.80
  473  225 C   4   8   1   0   3   0   5  21   5   0  31   2   0   0   6   3   2   5   2   1   266    0    0   2.198     73  0.15
  474  226 C   2   3   3   0   0   0   0   9   2   0   0  32   0   0  18   1   3  18   2   8   266    0  100   2.006     66  0.19
  475  227 C   0   0   0   0   0   0   0  97   0   0   0   0   0   0   0   0   0   1   1   0   266    0    0   0.162      5  0.96
  476  228 C   0   0   0   0   0   0   0   2  26   0  29  24  18   0   0   0   0   0   1   0   266    0    0   1.496     49  0.40
  477  229 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   266    0    0   0.000      0  1.00
  478  230 C  31   2  47   0  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   1.116     37  0.66
  479  231 C   6   1  90   1   0   0   0   0   3   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.437     14  0.88
  480  232 C   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.000      0  1.00
  481  233 C  80   0   0   0   0   0   0   0  11   0   9   0   0   0   0   0   0   0   0   0   266    0    0   0.644     21  0.63
  482  234 C   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.000      0  1.00
  483  235 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   266    0    0   0.000      0  1.00
  484  236 C   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.025      0  0.99
  485  237 C   5  40  55   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   266    0    0   0.851     28  0.74
  486  238 C   4   4   7   0  37   0  46   0   0   0   0   1   0   0   0   0   0   0   0   0   266    0    0   1.248     41  0.70
  487  239 C   0   0   0   0   0   0   0  48  33   0   1   2   0   0   3   8   1   2   0   2   266  102   42   1.348     44  0.48
  488  240 C   0   4   0   0   0   0   0   4   5   2   3   0   0   0   0  63   6   1   5   7   164    0    0   1.441     48  0.38
  489  241 C   5   0   0   0   1   0   1  41  36   4   2   3   0   0   1   0   0   2   3   2   266    0    0   1.597     53  0.44
  490  242 C   0   0   0   0   0   0   0   5   8  11   3   0   0   0  41   3   4  13   2   8   266    0    0   1.925     64  0.23
  491  243 C   1   0   0   0   0   0   0   0   7   0   1   0   0   0   1   3   2   5   4  76   266    0    0   1.012     33  0.70
  492  244 C   8   1  10   1   0   0   0   0  10  62   1   0   0   0   6   0   0   0   0   0   266    0    0   1.265     42  0.44
  493  245 C  34   4   3   0   1   0   0   0   8   2   3   4   0   0   7  14   3  13   3   2   265    0    0   2.175     72  0.17
  494  246 C  30   1   2   0   0   0   0   2  16   0   6   2   0   1   2   7   7  22   0   1   265    0    0   2.019     67  0.18
  495  247 C   0   0   0   1   0   0   0   0  21   0   1   1   0   0   2   0  15  58   0   0   265    0    0   1.201     40  0.50
  496  248 C   5   0   2   0   0   0   0  37  50   0   3   2   2   0   0   0   0   0   0   0   265    0    0   1.182     39  0.57
  497  249 C   0   4   2   0   0   0   0   0   3   0   0   0   0   0   5  30   9  45   0   1   265    0    0   1.481     49  0.41
  498  250 C   0   0   0   0   0   0   0   0   2   0   0   0   0   0  82   1  13   2   0   0   265    0    0   0.692     23  0.72
  499  251 C   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.025      0  1.00
  500  252 C   0   0   0   2   0   0   0   0   0   0   0   0   0   0  66   8  23   0   0   0   265    0    0   0.893     29  0.64
  501  253 C   0   0   0   0   0   0   0   0   5   0   5   2   0   0   5  40  11  17   2  12   265    0    0   1.811     60  0.39
  502  254 C   0   1   0   0   0   0   0   0  65   0   1   0   0   0   1   4   5  23   0   0   265    0    0   1.047     34  0.52
  503  255 C   0   0   0   0   0   0   0  86  14   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.446     14  0.84
  504  256 C   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.000      0  1.00
  505  257 C   1   0   0   0   0   0   0   0   7   0   5   2   0   0   2  21   3  29  14  17   265    0    0   1.900     63  0.38
  506  258 C   0   0   0   0   0   0   0   1  98   0   0   0   0   0   0   0   0   0   0   0   265    0    0   0.087      2  0.98
  507  259 C   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   262    0    0   0.025      0  0.99
  508  260 C   0  68   2   2   0   0   0   0   0   0   0   6   0   0   1   1   6  14   0   0   258    0    0   1.115     37  0.44
  509  261 C   0   0   0   0   0   0   0   2  14   0   3   1   0   1  12  31   3  25   5   4   258    0    0   1.872     62  0.32
  510  262 C   0   0   0   0   0   0   0   0   0   0   0   0   0   0  94   6   0   0   0   0   254    0    0   0.250      8  0.94
  511  263 C  43   3  19   0   0   0   0   0   0   0   0  12  21   0   0   0   0   0   0   0   210    0    0   1.466     48  0.46
  512  264 C   0   0   0   0   0   0   0  61  13   1  13   0   1   0   0   1   2   0   7   1   164    0    0   1.263     42  0.58
  513  265 C   1   0   0   0   0   0   0   9  10   2   2   0   0   0  10  13  42   2  10   0   129    0    0   1.790     59  0.32
  514  266 C   0   0   0   0   0   0   0   0   0   0   0   0   0   3   4  13  61   4  12   3    69    0    0   1.296     43  0.53
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
    20   465   206    12 gLDDKGDALGQQYr
    21   465   206    12 gLDDKGDALGQQYr
    22   465   206    12 gLDDKGDALGQQYr
    23   465   206    12 gLDDKGDALGQQYr
    24   465   206    12 gLDDKGDALGQQYr
    25   465   206    12 gLDDKGDALGQQYr
    26   465   206    12 gLDDKGDALGQQYr
    27   465   206    12 gLDDKGDALGQQYr
    28   465   206    12 gLDDKGDALGQQYr
    29   465   206    12 gLDDKGDALGQQYr
    30   465   206    12 gLDDKGDALGQQYr
    31   465   206    12 gLDDKGDALGQQYr
    32   465   206    12 gLDDKGDALGQQYr
    34   465   206    12 gLDDKGDALGQQYr
    35   465   206    12 gLDDKGDALGQQYr
    36   465   206    12 gLDDKGDALGQQYr
    37   465   206    12 gLDDKGDALGQQYr
    39   443   182    12 gLDDKGDALGQQYr
    40   465   206    12 gLDDKGDALGQQYr
    41   465   206    12 gLDDKGDALGQQYr
    42   465   206    12 gLDDKGDALGQQYr
    57   463   206    12 gLDDKGDALGQQYr
    60   463   206    12 gLDDKGDSLGQQYr
    61   463   206    12 gLDDKGDSLGQQYr
    62   137   141     3 nDVNg
    66   463   206    12 gLDDKGDSLGQQYr
    67   464   206    12 gLDDKGDALGQQYr
    68   463   206    12 gLDDKGDALGQQYr
    69   464   206    12 gLDDKGDALGQQYr
    70   464   206    12 gLEDKSDALGQQYr
    71   462   206    12 gLDDKGDSLGQQYr
    72   463   206    12 gLDDKGDALGQQYr
    74   463   206    12 gLDDKGDALGQQYr
    75   463   206    12 gLDDKGDALGQQYr
    77   463   206    12 gLDDKGDSLGQQYr
    80   465   206    12 gLDDKGDALGQQYr
    81   463   206    12 gLDDKGDALGQQYr
    84   463   206    12 gLDDKGDALGQQYr
    85   464   206    12 gLDDKGDALGQQYr
    88   464   206    12 gLDDKGDALGQQYr
    91   398   141     3 nDVNg
    91   463   209    12 gLDDKGDALGQQYr
    96   464   206    12 gLDDKGDALGQQYr
   104   463   207    12 gLDDKGDSLGQQYr
   111   409   152    19 aVTKVMLWDNNTELWMKLLPe
   112   463   206    12 gLDDKGDGLGQQYr
   117   137   143     2 tTTn
   120   462   207    12 gLDDKGDALGQQYr
   121   463   207    12 gLDDKGDSLGQQYr
   126   462   207    12 gLDDKGDALGQQYr
   128   463   206    12 gLDDKGDGLGQQYr
   130   463   206    12 gLDDKGDGLGQQYr
   131   137   143     2 tTTn
   138   463   206    12 nLDEKGDSLGQQYr
   140   137   143     2 tTTd
   141   462   207    12 gLDDKGDGLGQQYr
   142   463   207    12 gLDDKGDGLGQQYr
   145   462   205    12 gLDDTGDALGQQYr
   146   463   205    12 gLDDKGDSLGQQYr
   147   462   205    12 gLDDTGDALGQQYr
   151   455   206    12 gLDDKGDSLGQQYr
   152   463   205    12 gLDDKGDSLGQQYr
   153   462   205    12 gLDDTGDALGQQYr
   154   463   207    12 gLDDTGDALGQQYr
   155   148   152    19 aVTKVMLWDNNTELWMKLLPe
   156   463   207    12 gLDDKGDSLGQQYr
   157   463   205    12 gLDDKGDALGQQYr
   158   463   207    12 gLDDKGDGLGQQYr
   159   463   207    12 gLDDKGDGLGQQYr
   160   463   210    12 gLDDKGDALGQQYr
   161   463   207    12 gLDDKGDGLGQQYr
   162   463   203    12 gLDDKGDALGQQYr
   163   223   227     1 gAg
   164   463   205    12 gLDDKGDALGQQYr
   165   465   207    12 gLDDKGDGLGQQYr
   166   465   207    12 gLDDKGDSLGQQYr
   167   465   207    12 gLDDKGDALGQQYr
   169   465   207    12 gLDDKGDALGQQYr
   170   465   207    12 gLDDKGDGLGQQYr
   171   463   207    12 gLDDKGDGLGQQYr
   172   463   207    12 gLDDKGDGLGQQYr
   173   464   206    12 gLDDTGDALGQQYr
   174   465   208    12 gLDDKGDKLGQQYr
   175   464   207    12 gLDDKGDSLGQQYr
   177   465   207    12 gLDDKGDALGQQYr
   178   398   143     2 tTTn
   178   463   210    12 gLDDKGDGLGQQYr
   179   465   207    12 gLDDKGDALGQQYr
   180   464   204    12 gLDDKGDALGQQYr
   182   465   207    12 gLDEKGDGLGQQYr
   183   465   207    12 gLDEKGDGLGQQYr
   184   464   204    12 gLDDKGDALGQQYr
   185   462   206    12 gLDDKGDALGQQYr
   186   398   143     2 tTTn
   186   463   210    12 gLDDKGDGLGQQYr
   187   398   143     2 tTTd
   187   463   210    12 gLDDKGDGLGQQYr
   188   464   204    12 gLDDKGDALGQQYr
   189   465   207    12 gLDDKGDALGQQYr
   190   465   207    12 gLDEKGDGLGQQYr
   191   465   207    12 gLDEKGDGLGQQYr
   192   463   205    12 gLDDKGDSLGQQYr
   194   465   207    12 gLDEKGDGLGQQYr
   195   465   207    12 gLDDKGDNLGQQYr
   196   463   207    12 gLDDKGDNLGQQYr
   197   465   207    12 gLDDKGDNLGQQYr
   198   463   206    12 gLDDKGDALGQQYr
   198   472   227     1 gAg
   199   148   153     1 aEl
   200   136   144     3 yVAEh
   200   139   150     1 gTd
   201   463   205    12 gLDDKGDGLGQQYr
   202   463   205    12 gLDDKGDGLGQQYr
   203   463   209    12 gLDDKGDGLGQQYr
   204   451   204    10 dDKGDGLGQQYr
   205   409   153     1 aEl
   205   463   208    12 gLDDKGDSLGQQYr
   206   137   144     7 nEYVESEKa
   206   139   153     3 kGGEc
   206   142   159     1 nLd
   206   185   203     3 nRMEe
   206   194   215     1 yEd
   207   397   144     3 yVAEh
   207   400   150     1 gTd
   207   461   212    12 gLDDKGDGLGQQYr
   208   217   224     1 eSq
   209   136   137     7 eETVSEQKk
   209   138   146     3 eDVSd
   209   141   152     1 eNs
   209   149   161    15 vPSPNEKLARGLLMLAe
   210   398   144     7 nEYVESEKa
   210   400   153     3 kGGEc
   210   403   159     1 nLd
   210   446   203     3 nRMEe
   210   455   215     1 yEd
   210   465   226    12 gLDDKGDGLGQQYr
   211   457   203    12 gLDVKGDGLGQQYr
   211   466   224     1 eSq
   212    69    73     1 tAd
   213   177   180     1 qEk
   213   228   232     5 gSQSTVd
   214   166   174     1 rDa
   214   179   188     2 gRVd
   214   188   199     1 kEd
   214   219   231     1 dSg
   214   232   245     3 gVQGg
   215   166   174     1 rDa
   215   179   188     2 gRVd
   215   188   199     1 kEd
   215   219   231     1 dSg
   215   232   245     3 gVQGg
   216   137   143     1 pLg
   217   135   142     1 pLg
   217   177   185     1 qHk
   217   216   225     1 eSg
   218   135   140     1 pLg
   218   217   223     1 eSg
   219   397   137     7 eETVSEQKk
   219   399   146     3 eDVSd
   219   402   152     1 eNs
   219   410   161    15 vPSPNEKLARGLLMLAe
   219   462   228    12 gLDDKGDALGQQYr
   220   123   134     1 pLn
   220   217   229     5 gNEHSVd
   221   137   142     1 pLn
   221   167   173     1 kAd
   221   179   186     1 mSr
   221   180   188     2 rVDe
   221   220   230     1 eSg
   221   233   244    13 gALMTDEGKADKRAa
   222   217   226     1 eSg
   222   230   240     3 kNSDd
   223   177   184     6 gRRVDADa
   223   178   191     3 aANPd
   223   216   232     1 qCg
   223   229   246     5 gAGEGSe
   224   137   139     4 ePVVQk
   224   182   188     1 qSr
   224   183   190     3 rEATk
   224   192   202     1 sRd
   225   135   143     1 pLg
   225   165   174     1 rEa
   225   177   187     1 qEr
   225   216   227     1 eAg
   225   229   241     3 gVQGg
   226   135   140     1 pLg
   226   177   183     1 qHk
   226   216   223     1 eSg
   227   136   142     1 pLg
   227   217   224     1 nCg
   228   135   140     1 pLg
   228   177   183     1 qHk
   228   216   223     1 eSg
   229   135   140     1 pLg
   229   177   183     1 qHk
   229   216   223     1 eSg
   230   180   184     1 qSr
   231   135   140     1 pLg
   231   177   183     1 qHk
   231   216   223     1 eSg
   232   136   142     1 pLg
   232   178   185     6 mHRMDGIg
   232   179   192     3 gAQAg
   232   217   233     1 eSg
   232   230   247     2 gKGs
   233   178   185     1 qHr
   233   216   224     1 kSg
   233   229   238     4 gKDPSl
   234   137   142     1 pLg
   234   179   185     9 qRRMDGIGAPp
   234   218   233     1 eDg
   234   231   247     4 gKDPSk
   235   134   144     1 pLg
   235   176   187     1 qRr
   235   215   227     1 eSg
   235   228   241     4 gKDYSl
   236   135   143     1 pLg
   236   165   174     1 rEa
   236   177   187     1 qEr
   236   178   189     3 rVDAe
   236   187   201     1 eEd
   236   218   233     1 eAg
   236   231   247     3 gVQGg
   237   135   140     1 pLg
   237   177   183     1 qNk
   237   216   223     1 eSg
   238   137   142     1 pLg
   238   179   185     8 qQRMDSVGLr
   238   180   194     1 rEg
   238   218   233     1 eSn
   238   231   247     5 gNDNGTn
   239   134   144     1 pLg
   239   177   188     1 rRp
   239   215   227     1 eSg
   239   228   241     4 gKDYSl
   240   135   142     1 pLg
   240   177   185     6 mRRVDERe
   240   178   192     3 eETAg
   240   218   235     1 eSg
   240   231   249     5 gGGDGNp
   241   135   140     1 pLg
   241   177   183     1 qNk
   241   216   223     1 eSg
   242   135   140     1 pLg
   242   177   183     1 qNk
   242   216   223     1 eSg
   243   137   142     1 pLg
   243   179   185     9 qRRMDGIGAPp
   243   218   233     1 eDg
   243   231   247     4 gKDPSk
   244   135   143     1 pLg
   244   165   174     1 rEa
   244   177   187     1 qEr
   244   216   227     1 dAg
   244   229   241     3 gVQGg
   245   134   141     2 sAQd
   245   136   145     2 fPYg
   245   180   191     6 tRALTEVq
   245   181   198     3 qSDVs
   246   137   140     1 pLg
   246   179   183     4 qRRMEs
   246   180   188     3 sVATe
   246   218   229     1 eAg
   246   231   243     5 gKGDNVd
   247   135   143     1 pVg
   247   177   186     9 qHRMDGIGAAp
   247   216   234     1 dSg
   247   229   248     4 gTDLKa
   248   135   142     1 pLg
   248   177   185    12 mRRVDEREETAGGv
   248   215   235     1 eSg
   248   228   249     5 gGGDGNp
   249   134   144     1 pLg
   249   177   188     1 rRp
   249   215   227     1 eSg
   249   228   241     4 gKDYSl
   250   330    73     1 tAd
   250   460   204    12 nLTVSGDATGQQYr
   251   135   142     1 pLg
   251   177   185    12 mRRVDEREETAGGv
   251   215   235     1 gSg
   251   228   249     5 gGGDGNp
   252   137   142     1 pLg
   252   167   173     1 kNd
   252   179   186     1 mSr
   252   180   188     2 rVDe
   252   220   230     1 eSg
   252   233   244    13 gALMTEEGKKDKEAa
   253   427   174     1 rDa
   253   440   188     2 gRVd
   253   449   199     1 kEd
   253   459   210    12 gLVAKGDKLGQQYr
   253   468   231     1 dSg
   253   481   245     3 gVQGg
   254   427   174     1 rDa
   254   440   188     2 gRVd
   254   449   199     1 kEd
   254   459   210    12 gLVAKGDKLGQQYr
   254   468   231     1 dSg
   254   481   245     3 gVQGg
   255   168   170     1 mKr
   256   398   143     1 pLg
   256   456   202    12 qLGSGGDSMGQQYn
   257   134   141     2 sAQd
   257   136   145     2 fPYg
   257   180   191     6 tRALTEVq
   257   181   198     3 qSDVs
   258   136   142     1 pLg
   258   166   173     1 hKd
   258   178   186     5 mSRVDEr
   258   217   230     1 eSg
   258   230   244    13 gALTTEEGKADKKAa
   259   134   141     2 aAQd
   259   136   145     2 fPYg
   259   180   191     6 tRSLGEVr
   259   181   198     3 rSDVs
   260   135   143     1 pLg
   260   165   174     1 rEa
   260   177   187     1 qEr
   260   216   227     1 dAg
   260   229   241     3 gVQGg
   261   137   140     1 pLn
   261   179   183     1 mSr
   261   218   223     1 dRg
   262   201   207     1 sDa
   262   218   225     1 eQg
   263   134   141     1 pLg
   263   176   184    12 mRRVDEREETAGGv
   263   214   234     1 eSg
   263   227   248     5 gGGDGNp
   264   134   141     1 sAe
   264   136   144     3 dFPYg
   264   180   191    12 tRHLGEVQSEVSSp
   265   134   141     2 qATd
   265   136   145     2 fPYg
   265   180   191     6 tRSLGEVe
   265   181   198     2 eSTe
   266   133   141     2 sAPd
   266   135   145     2 fPHa
   266   179   191    10 sRSLEGVETAGk
   267   134   142     1 pLg
   267   176   185    13 qRRMDGLGLGPSEAk
   267   211   233     1 qNg
   267   224   247     4 gTNLKd
   268    58    61     2 kTHi
   268    65    70     4 pPTTAa
   268   171   180     1 rDr
   268   175   185     1 rGf
   268   224   235     1 rDg
   269   457   205    12 gLDVMGDSLGQNYr
   269   466   226     1 eSg
   269   479   240     3 kNSDd
   270   134   141     2 sAAd
   270   136   145     2 fPYg
   270   180   191     6 tRSLGEVp
   270   181   198     3 pTEGs
   271   398   139     4 ePVVQk
   271   443   188     1 qSr
   271   444   190     3 rEATk
   271   453   202     1 sRd
   271   463   213    12 aIGITGDGLGQQYk
   272   438   180     1 qEk
   272   455   198    12 gLDVKGDGMGQQYr
   272   477   232     5 gSQSTVd
   273   135   142     1 pLg
   273   177   185    12 mRRMDGVGAEGLDs
   273   215   235     1 eSg
   273   228   249     2 gKGn
   274   184   188     1 hPg
   274   215   220     1 qHe
   275   134   142     1 pLg
   275   176   185    13 qRRMDGLGLGPSEAk
   275   211   233     1 qNg
   275   224   247     4 gTNLKd
   276   134   142     1 pLg
   276   176   185    13 qRRMDGLGLGPSEAk
   276   211   233     1 qNg
   276   224   247     4 gTNLKd
   277    93    99    10 dIEQFPVALTSt
   277   136   152     1 pLg
   277   170   187     1 tGf
   277   178   196     1 mSr
   277   179   198     2 rVDe
   277   219   240     1 eSg
   277   232   254    13 gALMTEEGKADKKSa
   278   136   141     2 sAPd
   278   138   145     2 fPHa
   278   182   191    10 sRSLEGVETAGk
   279   133   141     2 sAPd
   279   135   145     2 fPHa
   279   179   191    10 sRSLEGVETAGk
   280   134   141     2 qATd
   280   136   145     2 fPYg
   280   180   191     6 tRSLGEVe
   280   181   198     2 eSTe
   281    47    54     3 pSTGl
   281   134   144     2 qATd
   281   136   148     2 fPYg
   281   180   194     6 tRSLGEVe
   281   181   201     1 eSt
   282   134   141     2 qATd
   282   136   145     2 fPYg
   282   180   191     6 tRSLGEVe
   282   181   198     2 eSTe
   283   396   142     1 pLg
   283   438   185     1 qHk
   283   456   204    12 gLDIKGDGLGQQYr
   283   465   225     1 eSg
   284   396   140     1 pLg
   284   457   202    12 gLDVKGDGLGQQYr
   284   466   223     1 eSg
   285   384   134     1 pLn
   285   444   195    12 gLDVKGDGMGQQYr
   285   466   229     5 gNEHSVd
   286   134   135     1 dLe
   286   177   179     1 rEk
   286   214   217     1 hLg
   287   134   141     2 sAQd
   287   136   145     2 fPYg
   287   180   191    12 tRALTEVQTDVTSa
   288   134   141     2 sAPd
   288   136   145     2 fAYg
   288   180   191    12 tRALGEVQSEVSSp
   289    58    60     2 kASt
   289   137   141     1 pLe
   289   179   184     9 qRRMEGIGAPp
   289   218   232     1 eDg
   289   231   246     4 gNDPKa
   290   395   141     2 sAQd
   290   397   145     2 fPYg
   290   441   191     6 tRALTEVq
   290   442   198     3 qSDVs
   291   134   141     2 sAPd
   291   136   145     2 fAYg
   291   180   191    12 tRALGEVQSEVSSp
   292   134   141     2 qATd
   292   136   145     2 fPYg
   292   180   191     6 tRSLGEVe
   292   181   198     2 eSTe
   293   136   141     2 kADd
   293   138   145     2 fPYg
   293   182   191     6 nRSLTDEq
   293   183   198     3 qSTEt
   294   136   141     2 tADd
   294   138   145     2 fPYg
   294   182   191    12 nRALTEEQSTETSk
   295   439   185     1 qHr
   295   456   203    12 gLDQKGDGMGQQYr
   295   465   224     1 kSg
   295   478   238     4 gKDPSl
   296   134   141     2 sAEd
   296   136   145     2 fPYg
   296   180   191    12 tRHLGEVQSEVSSp
   297   328    70     6 pPTTAASs
   297   432   180     1 rDr
   297   436   185     1 rGf
   297   464   214    12 gLQVGGDGLGQQYr
   297   473   235     1 rDg
   298   133   141     2 kAAd
   298   135   145     2 fPYg
   298   179   191     9 tRSLGEFDAEk
   299   180   187    12 qRRLEGLGVEATTh
   299   181   200     1 hQs
   299   219   239     1 qSg
   299   232   253     7 gQQDKSGDs
   300   395   144     1 pLg
   300   438   188     1 rRp
   300   455   206    12 gLDVKGDGMGQQYr
   300   464   227     1 eSg
   300   477   241     4 gKDYSl
   301   398   142     1 pLn
   301   428   173     1 kAd
   301   440   186     1 mSr
   301   441   188     2 rVDe
   301   460   209    12 gLDVKGDGLGQQYr
   301   469   230     1 eSg
   301   482   244    13 gALMTDEGKADKRAa
   302   136   141     1 sSg
   302   138   144     3 vFPYp
   302   183   192    12 tRSLGDIETETERk
   303   177   183     1 qEk
   303   214   221     1 iNg
   304   136   142     1 pLg
   304   178   185     9 qKRMDGIGAIe
   304   217   233     1 eSg
   304   230   247     5 gKSDQLd
   305   136   142     1 pLg
   305   178   185     9 qKRMDGIGAIe
   305   217   233     1 eSg
   305   230   247     5 gKSDQLd
   306   134   141     2 sAPd
   306   136   145     2 fAYg
   306   180   191    12 tRALGEVQSEVSSp
   307   171   177    13 mQRVETLYPPMDVAk
   307   172   191     2 kASa
   307   210   231     1 eSg
   307   223   245     3 gKGDd
   308   438   184     6 gRRVDADa
   308   439   191     3 aANPd
   308   456   211    12 gLATKGDAMGQQYr
   308   465   232     1 qCg
   308   478   246     5 gAGEGSe
   309   134   141     2 sAPd
   309   136   145     2 fGYg
   309   180   191    12 tRSLGEVQSEVSSp
   310   136   141     3 hEGDe
   310   180   188     5 tKELSSh
   310   181   194     1 hSp
   311   134   141     2 sAEd
   311   136   145     2 fPYg
   311   180   191    12 tRHLGEVQSEVSSp
   312   398   142     1 pLg
   312   440   185     8 qQRMDSVGLr
   312   441   194     1 rEg
   312   458   212    12 gLDTRGDSMGQQYr
   312   467   233     1 eSn
   312   480   247     5 gNDNGTn
   313   396   143     1 pLg
   313   426   174     1 rEa
   313   438   187     1 qEr
   313   456   206    12 gLAAKGDKLGQQYr
   313   465   227     1 eAg
   313   478   241     3 gVQGg
   314   134   141     2 qAId
   314   136   145     2 fPYg
   314   180   191     6 tRSLGEVe
   314   181   198     2 eSTe
   315   134   141     2 qAId
   315   136   145     2 fPYg
   315   180   191     6 tRSLGEVe
   315   181   198     2 eSTe
   316   136   137     1 pLg
   316   178   180     9 qRRMEGVGSDk
   316   214   225     1 eSg
   316   227   239     4 gTDYSl
   317   395   144     1 pLg
   317   438   188     1 rRp
   317   455   206    12 gLDVKADGMGQQYr
   317   464   227     1 eSg
   317   477   241     4 gKDYSl
   318   126   131     1 pLg
   318   168   174     1 mSr
   318   169   176     2 rQGv
   318   207   216     1 dSg
   318   220   230     5 gKGEGNd
   319   134   141     2 sAPd
   319   136   145     2 fGYg
   319   180   191    12 tRSLGEVQSEVSSp
   320   134   141     2 sAPd
   320   136   145     2 fGYg
   320   180   191    12 tRPLGEVQSEVSSp
   321   134   141     2 sAPd
   321   136   145     2 fSYg
   321   180   191    12 tRSLGEVQSEVSSp
   322   134   141     2 sAEd
   322   136   145     2 fPYg
   322   180   191    12 tRHLGEVQSEVSSp
   323   396   140     1 pLg
   323   438   183     1 qHk
   323   456   202    12 gLDVKGDGLGQQYr
   323   465   223     1 eSg
   324   397   142     1 pLg
   324   457   203    12 gLDVKGDGLGQQYr
   324   466   224     1 nCg
   325   396   140     1 pLg
   325   438   183     1 qHk
   325   456   202    12 gLDVKGDGLGQQYr
   325   465   223     1 eSg
   326   137   144     1 pLg
   326   167   175     1 rEa
   326   179   188     1 mHr
   326   218   228     1 dSg
   327   396   140     1 pLg
   327   438   183     1 qHk
   327   456   202    12 gLDVKGDGLGQQYr
   327   465   223     1 eSg
   328   396   140     1 pLg
   328   438   183     1 qHk
   328   456   202    12 gLDVKGDGLGQQYr
   328   465   223     1 eSg
   329   458   203    13 kKECSDAEGLGQHYi
   329   467   225     1 eQg
   330   397   142     1 pLg
   330   439   185     6 mHRMDGIg
   330   440   192     3 gAQAg
   330   457   212    12 gLDVKGDSMGQQYr
   330   466   233     1 eSg
   330   479   247     2 gKGs
   331   133   141     5 sTPEFRs
   331   135   148     3 vYANe
   331   138   154     1 eGg
   331   180   197    12 tRALNDVLPVSTVd
   332   133   141     5 sTPEFRs
   332   135   148     3 vYANe
   332   138   154     1 eGg
   332   180   197    12 tRALNDVLPVSTVd
   333   134   141     2 sAPd
   333   136   145     2 fPHa
   333   180   191    10 tRSLADVDTAGk
   334   134   141     2 qAPd
   334   136   145     2 fPYg
   334   180   191    12 tRALSEVESSVAPa
   335   398   142     1 pLg
   335   440   185     8 qRRMDGIGAp
   335   441   194     1 pPg
   335   458   212    12 gLDVKGDGMGQQYr
   335   467   233     1 eDg
   335   480   247     4 gKDPSk
   336   395   144     1 pLg
   336   438   188     1 rRp
   336   455   206    12 gLDVKADGMGQQYr
   336   464   227     1 eSg
   336   477   241     4 gKDYSl
   337   136   141     2 sSAe
   337   138   145     2 fPYp
   337   183   192    12 tRSLSDIQTETERk
   338   396   143     1 pLg
   338   426   174     1 rEa
   338   438   187     1 qEr
   338   439   189     3 rVDAe
   338   448   201     1 eEd
   338   458   212    12 gLAAKGDKLGQQYr
   338   467   233     1 eAg
   338   480   247     3 gVQGg
   339   136   141     4 sSSVFh
   339   138   147     1 yPa
   339   182   192    12 tRSLGDIETETERk
   340   136   141     4 sSSVFh
   340   138   147     1 yPa
   340   182   192    12 tRSLGDIETETERk
   341   396   142     1 pLg
   341   438   185    12 mRRVDEREETAGGv
   341   455   214    12 gLDSKGDGMGQQYr
   341   464   235     1 gSg
   341   477   249     5 gGGDGNp
   342   133   141     2 eRDd
   342   135   145     2 fPYk
   342   179   191     6 sKTLGDIe
   342   180   198     2 eTEv
   343   396   140     1 pLg
   343   438   183     1 qNk
   343   456   202    12 gLDVKGDGLGQQYr
   343   465   223     1 eSg
   344   398   142     1 pLg
   344   428   173     1 kNd
   344   440   186     1 mSr
   344   441   188     2 rVDe
   344   460   209    12 gLDVKGDAMGQQYr
   344   469   230     1 eSg
   344   482   244    13 gALMTEEGKKDKEAa
   345   216   218     1 eRg
   346   429   170     1 mKr
   346   445   187    12 nFADKGDQLKQQYv
   347   133   139     1 pLg
   347   175   182     9 qRRMNGVATEp
   347   214   230     1 eAg
   347   227   244     3 gQDLe
   348   208   214    12 nMYKFAERDVYGQq
   348   219   237     1 dLg
   349   396   142     1 pLg
   349   438   185    12 mRRVDEREETAGGv
   349   455   214    12 gLDSKGDGMGQQYr
   349   464   235     1 eSg
   349   477   249     5 gGGDGNp
   350   133   141     2 kSPd
   350   135   145     2 fKDa
   350   179   191    10 tRALSEVLPEQk
   351   133   141     5 sTPEFRs
   351   135   148     3 vYANe
   351   138   154     1 eGg
   351   180   197    12 tRALNDVLPVSTVd
   352   396   140     1 pLg
   352   438   183     1 qNk
   352   456   202    12 gLDVKGDGLGQQYr
   352   465   223     1 eSg
   353   396   140     1 pLg
   353   438   183     1 qNk
   353   456   202    12 gLDVKGDGLGQQYr
   353   465   223     1 eSg
   354   398   142     1 pLg
   354   440   185     8 qRRMDGIGAp
   354   441   194     1 pPg
   354   458   212    12 gLDVKGDGMGQQYr
   354   467   233     1 eDg
   354   480   247     4 gKDPSk
   355   133   141     4 tSDAFe
   355   179   191    12 nQALTSIETQIPAt
   356   396   143     1 pLg
   356   426   174     1 rEa
   356   438   187     1 qEr
   356   456   206    12 gLAASGDKLGQQYr
   356   465   227     1 dAg
   356   478   241     3 gVQGg
   357   396   143     1 pLg
   357   426   174     1 rEa
   357   438   187     1 qEr
   357   456   206    12 gLAAKGDKLGQQYr
   357   465   227     1 dAg
   357   478   241     3 gVQGg
   358   398   140     1 pLn
   358   440   183     1 mSr
   358   458   202    12 gLDQTSDGLGQQWk
   358   467   223     1 dRg
   359   326    69     2 fTPs
   359   439   184     1 qSr
   359   456   202    12 sLAAKGDAMGQQYa
   360   395   141     2 sAQd
   360   397   145     2 fPYg
   360   441   191    12 tRALTEVQSDVSSa
   360   456   218    12 nLSSKGDKLGQQYq
   361   398   140     1 pLg
   361   440   183     9 qRRMESVATEs
   361   456   208    12 gLDTRGDGMGQQYr
   361   465   229     1 eAg
   361   478   243     5 gKGDNVd
   362   396   143     1 pVg
   362   438   186     9 qHRMDGIGAAp
   362   456   213    12 gLDSKGDAMGQQYr
   362   465   234     1 dSg
   362   478   248     4 gTDLKa
   363   396   142     1 pLg
   363   438   185    12 mRRVDEREETAGGv
   363   455   214    12 gLDSKGDGMGQQYr
   363   464   235     1 eSg
   363   477   249     5 gGGDGNp
   364   395   141     1 sAe
   364   397   144     3 dFPYg
   364   441   191    12 tRHLGEVQSEVSSp
   364   456   218    12 nLSSKGDKLGQQYq
   365   134   139     2 sSSd
   365   136   143     2 fPYp
   365   181   190    12 tRSLGDVETEVVAr
   366   395   142     1 pLg
   366   437   185    13 qRRMDGLGLGPSEAk
   366   451   212    12 gLEVKGDAMGQQYr
   366   460   233     1 qNg
   366   473   247     4 gTNLKd
   367   135   140     1 pLg
   367   177   183     8 qRTMEGIGMq
   367   216   230     1 eSg
   367   229   244     4 gKDPGl
   368   325    70     2 fTPs
   368   436   183     1 qEk
   368   452   200    12 kLSEGSDSLGQQYn
   368   461   221     1 iNg
   369   133   141     4 sSPAFq
   369   135   147     2 tAYg
   369   180   194    12 tRALGEVLPATGSg
   369   181   207     2 gCEk
   370   438   183     1 qEk
   370   454   200    12 kLSEGSDSLGQQYn
   370   463   221     1 iNg
   371   134   141     2 sAPd
   371   136   145     2 fPYp
   371   180   191    10 tRSLSGDGGGCr
   372   180   187    12 qRRLEGVGADTHTn
   372   181   200     1 nEa
   372   219   239     1 eSg
   372   232   253     7 gQQDKSGDs
   373   396   142     1 pLg
   373   438   185     8 mRRMDGVGAe
   373   439   194     3 eGLDs
   373   456   214    12 gLDAKGDSMGQQYr
   373   465   235     1 eSg
   373   478   249     2 gKGn
   374   326    69     2 fTPd
   374   443   188     1 hPg
   374   453   199    12 qFIEKKDAHGQQYi
   374   462   220     1 qHe
   375   395   142     1 pLg
   375   437   185    13 qRRMDGLGLGPSEAk
   375   451   212    12 gLEVKGDAMGQQYr
   375   460   233     1 qNg
   375   473   247     4 gTNLKd
   376   395   142     1 pLg
   376   437   185    13 qRRMDGLGLGPSEAk
   376   451   212    12 gLEVKGDAMGQQYr
   376   460   233     1 qNg
   376   473   247     4 gTNLKd
   377   395   141     2 sAQd
   377   397   145     2 fPYg
   377   441   191     6 tRALTEVq
   377   442   198     3 qSDVs
   377   459   218    12 nLSSKGDKLGQQYq
   378   397   142     1 pLg
   378   427   173     1 hKd
   378   439   186     5 mSRVDEr
   378   457   209    12 gLDVKGDGLGQQYr
   378   466   230     1 eSg
   378   479   244    13 gALTTEEGKADKKAa
   379   326    72     1 fSd
   379   394   141     2 aAQd
   379   396   145     2 fPYg
   379   440   191     6 tRSLGEVr
   379   441   198     3 rSDVs
   379   458   218    12 nLSSKGDKLGQQYq
   380   395   135     1 dLe
   380   438   179     1 rEk
   380   454   196    12 qLQEGQDALGQCYl
   380   463   217     1 hLg
   381   395   141     1 pLg
   381   437   184    12 mRRVDEREETAGGv
   381   454   213    12 gLDSKGDGMGQQYr
   381   463   234     1 eSg
   381   476   248     5 gGGDGNp
   382   134   141     2 sAQd
   382   136   145     2 fPYg
   382   180   191    12 tRALTEVQSDVSSa
   383   326    72     1 fSq
   383   394   141     2 qATd
   383   396   145     2 fPYg
   383   440   191     6 tRSLGEVe
   383   441   198     2 eSTe
   383   458   217    12 nLSSKGDKLGQQYq
   384   326    72     1 fSq
   384   394   141     2 qATd
   384   396   145     2 fPYg
   384   440   191     6 tRSLGEVe
   384   441   198     2 eSTe
   384   458   217    12 nLSSKGDKLGQQYq
   385   133   141     4 sSPVFq
   385   135   147     2 rAYa
   385   180   194    20 tRALNEVLPVGGGEGDGGGEEe
   385   181   215     2 eEEe
   386   325    72     1 fSa
   386   393   141     2 sAPd
   386   395   145     2 fPHa
   386   439   191    10 sRSLEGVETAGk
   386   454   216    12 nLASKGDALGQQYq
   387   326    72     1 fSe
   387   394   141     1 sAe
   387   396   144     3 dFPYg
   387   440   191    12 tRHLGEVQSEVSSp
   387   455   218    12 nLSSKGDKLGQQYq
   388   394   141     2 kAAd
   388   396   145     2 fPYg
   388   440   191     9 tRSLGEFDAEk
   388   454   214    12 nLSSKGDKLGQQYq
   389   328    74     2 fDQd
   389   439   187    12 qRRLEGLGVEATTh
   389   440   200     1 hQs
   389   457   218    12 gLDVSGDQLGQNYr
   389   466   239     1 qSg
   389   479   253     7 gQQDKSGDs
   390   432   177    13 mQRVETLYPPMDVAk
   390   433   191     2 kASa
   390   450   210    12 gLDVAGDAMGQQYr
   390   459   231     1 eSg
   390   472   245     3 gKGDd
   391   326    72     1 fSe
   391   394   141     2 sAAd
   391   396   145     2 fPYg
   391   440   191     6 tRSLGEVp
   391   441   198     3 pTEGs
   391   458   218    12 nLASKGDKLGQQYq
   392   326    72     1 fSk
   392   394   141     1 sAe
   392   396   144     3 dFPYg
   392   440   191    12 tRHLGEVQSEVSSp
   392   455   218    12 nLSSKGDKLGQQYq
   393   326    72     1 fSq
   393   394   141     2 qAId
   393   396   145     2 fPYg
   393   440   191     6 tRSLGEVe
   393   441   198     2 eSTe
   393   458   217    12 nLSSKGDKLGQQYq
   394   326    72     1 fSq
   394   394   141     2 qAId
   394   396   145     2 fPYg
   394   440   191     6 tRSLGEVe
   394   441   198     2 eSTe
   394   458   217    12 nLSSKGDKLGQQYq
   395   354    99    10 dIEQFPVALTSt
   395   397   152     1 pLg
   395   431   187     1 tGf
   395   439   196     1 mSr
   395   440   198     2 rVDe
   395   459   219    12 gLDVKGDAMGQQYr
   395   468   240     1 eSg
   395   481   254    13 gALMTEEGKADKKSa
   396   326    72     1 fSe
   396   394   141     1 sAe
   396   396   144     3 dFPYg
   396   440   191    12 tRHLGEVQSEVSSp
   396   455   218    12 nLSSKGDKLGQQYq
   397   328    72     1 fSa
   397   396   141     2 sAPd
   397   398   145     2 fPHa
   397   442   191    10 sRSLEGVETAGk
   397   457   216    12 nLASKGDALGQQYq
   398   325    72     1 fSa
   398   393   141     2 sAPd
   398   395   145     2 fPHa
   398   439   191    10 sRSLEGVETAGk
   398   454   216    12 nLASKGDALGQQYq
   399   133   141     2 qAEd
   399   135   145     2 fPHg
   399   179   191    12 tRALTEVSSTVTAa
   400   326    72     1 fSq
   400   394   141     2 qATd
   400   396   145     2 fPYg
   400   440   191     6 tRSLGEVe
   400   441   198     2 eSTe
   400   458   217    12 nLSSKGDKLGQQYq
   401   308    54     3 pSTGl
   401   326    75     1 fSq
   401   394   144     2 qATd
   401   396   148     2 fPYg
   401   440   194     6 tRSLGEVe
   401   441   201     1 eSt
   401   458   219    12 nLSSKGDKLGQQYq
   402   326    72     1 fSq
   402   394   141     2 qATd
   402   396   145     2 fPYg
   402   440   191     6 tRSLGEVe
   402   441   198     2 eSTe
   402   458   217    12 nLSSKGDKLGQQYq
   403   398   144     1 pLg
   403   428   175     1 rEa
   403   440   188     1 mHr
   403   458   207    12 gLDVKGDGRGQQYr
   403   467   228     1 dSg
   404   326    72     1 fGd
   404   394   141     2 sAQd
   404   396   145     2 fPYg
   404   440   191    12 tRALTEVQTDVTSa
   404   455   218    12 nLSSKGDKLGQQYq
   405   326    72     1 fSn
   405   394   141     2 sAPd
   405   396   145     2 fAYg
   405   440   191    12 tRALGEVQSEVSSp
   405   455   218    12 nISSKGDKLGQQYq
   406   319    60     2 kASt
   406   328    71     2 fDSs
   406   396   141     1 pLe
   406   438   184     8 qRRMEGIGAp
   406   439   193     1 pPg
   406   456   211    12 gLEMKGDAMGQQYr
   406   465   232     1 eDg
   406   478   246     4 gNDPKa
   407   326    72     1 fSn
   407   394   141     2 sAPd
   407   396   145     2 fAYg
   407   440   191    12 tRALGEVQSEVSSp
   407   455   218    12 nISSKGDKLGQQYq
   408   328    72     1 fSt
   408   396   141     2 kADd
   408   398   145     2 fPYg
   408   442   191     6 nRSLTDEq
   408   443   198     3 qSTEt
   408   460   218    12 nLASTGDALGQQYq
   409   328    72     1 fSp
   409   396   141     2 tADd
   409   398   145     2 fPYg
   409   442   191    12 nRALTEEQSTETSk
   409   457   218    12 nLASAGDALGQQYq
   410   326    70     1 fSp
   410   394   139     2 sSSd
   410   396   143     2 fPYp
   410   441   190    12 tRSLGDVETEVVAr
   410   456   217    12 nLASKGDQLGQQYq
   411   133   141     4 sSPVFq
   411   135   147     2 rAYa
   411   180   194    24 tRALNEVLPVGGGEGDGGEEEEEEEe
   411   181   219     3 eEEEe
   412   326    72     1 fSe
   412   394   141     2 qAPd
   412   396   145     2 fPYg
   412   440   191    12 tRALSEVESSVAPa
   412   454   217    12 nLSSKGDKLGQQYq
   413   134   139     2 tDPg
   413   136   143     2 fPFr
   413   180   189     6 tRALTTVq
   413   181   196     1 qPq
   414   134   139     2 tDPg
   414   136   143     2 fPFr
   414   180   189     8 tRALTEVQPr
   415   328    72     1 fSp
   415   396   141     1 sSg
   415   398   144     3 vFPYp
   415   443   192    12 tRSLGDIETETERk
   415   457   218    12 nLASKGDQLGQQYq
   416   136   140     4 lGLADe
   416   140   148     1 gVt
   416   182   191     6 qNRLGYHk
   416   183   198     1 kEs
   416   206   222    10 sSTIDGDELGQq
   416   217   243     1 dSh
   417   327    72     2 fDQt
   417   395   142     1 pLg
   417   437   185     9 qKRMDGIGAIe
   417   455   212    12 gLDSKGDAMGQQYr
   417   464   233     1 eSg
   417   477   247     5 gKSDQLd
   418   327    72     2 fDQt
   418   395   142     1 pLg
   418   437   185     9 qKRMDGIGAIe
   418   455   212    12 gLDSKGDAMGQQYr
   418   464   233     1 eSg
   418   477   247     5 gKSDQLd
   419   326    72     1 fSn
   419   394   141     2 sAPd
   419   396   145     2 fAYg
   419   440   191    12 tRALGEVQSEVSSp
   419   455   218    12 nISSKGDKLGQQYq
   420   326    72     1 fSd
   420   394   141     2 sAPd
   420   396   145     2 fGYg
   420   440   191    12 tRSLGEVQSEVSSp
   420   455   218    12 nISSKGDKLGQQYq
   421   328    72     1 fGp
   421   396   141     3 hEGDe
   421   440   188     5 tKELSSh
   421   441   194     1 hSp
   421   458   212    12 nLSSKGDALGQQYq
   422   326    67     2 fSPk
   422   454   197    12 nLEKTSDDLKQQYt
   422   463   218     1 eRg
   423   325    69     2 fTId
   423   453   199    12 qFSQNKDFYGQQYi
   423   462   220     1 qNe
   424   327    67     1 fDp
   424   396   137     1 pLg
   424   438   180     9 qRRMEGVGSDk
   424   453   204    12 gLDVKGDGMGQQYr
   424   462   225     1 eSg
   424   475   239     4 gTDYSl
   425   387   131     1 pLg
   425   429   174     1 mSr
   425   430   176     2 rQGv
   425   447   195    12 gLDTKGDGLGQQYr
   425   456   216     1 dSg
   425   469   230     5 gKGEGNd
   426   324    69     2 fESs
   426   392   139     1 pLg
   426   434   182     9 qRRMNGVATEp
   426   452   209    12 gLESKGDGMGQQYr
   426   461   230     1 eAg
   426   474   244     3 gQDLe
   427   328    73     2 fDIs
   427   439   186     8 iRRWPILTEe
   427   440   195     1 eFi
   427   457   213    15 gNMYKFAERDVYGQQYr
   427   466   237     1 dLg
   428   326    72     1 fSd
   428   394   141     2 sAPd
   428   396   145     2 fGYg
   428   440   191    12 tRSLGEVQSEVSSp
   428   455   218    12 nISSKGDKLGQQYq
   429   326    72     1 fSd
   429   394   141     2 sAPd
   429   396   145     2 fGYg
   429   440   191    12 tRPLGEVQSEVSSp
   429   455   218    12 nISSKGDKLGQQYq
   430   326    72     1 fSd
   430   394   141     2 sAPd
   430   396   145     2 fSYg
   430   440   191    12 tRSLGEVQSEVSSp
   430   455   218    12 nISSKGDKLGQQYq
   431   325    72     1 lSp
   431   393   141     5 sTPEFRs
   431   395   148     3 vYANe
   431   398   154     1 eGg
   431   440   197    12 tRALNDVLPVSTVd
   431   455   224    12 sLSASGDALGQQYq
   432   325    72     1 lSp
   432   393   141     5 sTPEFRs
   432   395   148     3 vYANe
   432   398   154     1 eGg
   432   440   197    12 tRALNDVLPVSTVd
   432   455   224    12 sLSASGDALGQQYq
   433   326    72     1 fSs
   433   394   141     2 sAPd
   433   396   145     2 fPHa
   433   440   191     6 tRSLADVd
   433   441   198     1 dTa
   433   458   216    12 nLASKGDALGQQYq
   434   328    72     1 fSp
   434   396   141     2 sSAe
   434   398   145     2 fPYp
   434   443   192    12 tRSLSDIQTETERk
   434   457   218    12 nLASKGDKLGQQYq
   435    47    54    19 gKHMCACSVIDLLTRPLRTEl
   435   134   160     1 sDe
   435   136   163     3 tFPYr
   435   168   198     1 rRk
   435   172   203     1 gGa
   435   180   212     6 tRSLGPAg
   435   181   219     1 gLd
   436   325    72     1 lTp
   436   393   141     4 sSPAFq
   436   395   147     2 tAYg
   436   440   194    12 tRALGEVLPATGSg
   436   441   207     2 gCEk
   436   458   226    12 nLSSSGDALGQQYq
   437   328    72     1 fSp
   437   396   141     4 sSSVFh
   437   398   147     1 yPa
   437   442   192    12 tRSLGDIETETERk
   437   456   218    12 nLASKGDQLGQQYq
   438   328    72     1 fSp
   438   396   141     4 sSSVFh
   438   398   147     1 yPa
   438   442   192    12 tRSLGDIETETERk
   438   456   218    12 nLASKGDQLGQQYq
   439   328    71     2 fDQd
   439   395   140     4 lGLADe
   439   399   148     1 gVt
   439   441   191    12 qNRLGYHKESTSSc
   439   454   216    18 gMPESGSSTIDGDELGQQYr
   439   463   243     1 dSh
   440   394   141     2 eRDd
   440   396   145     2 fPYk
   440   440   191     6 sKTLGDIe
   440   441   198     2 eTEv
   440   458   217    12 nMASKGDKLGQQYq
   441   326    72     1 fNe
   441   394   141     2 sAPd
   441   396   145     2 fPYp
   441   440   191    10 tRSLSGDGGGCr
   441   454   215    12 nMESKGDKLGQQYq
   442   328    74     2 fDQd
   442   439   187    12 qRRLEGVGADTHTn
   442   440   200     1 nEa
   442   457   218    12 gLDVTGDQLGQNYr
   442   466   239     1 eSg
   442   479   253     7 gQQDKSGDs
   443   328    79     1 fSd
   443   396   148     2 kHPt
   443   398   152     2 fPFq
   443   443   199     2 kALt
   443   460   218    12 nRSAEGDELGQQYq
   444   325    72     1 lTp
   444   393   141     2 kSPd
   444   395   145     2 fKDa
   444   439   191    10 tRALSEVLPEQk
   444   454   216    12 nLSDKGDKLGQQYq
   445   325    72     1 lSp
   445   393   141     5 sTPEFRs
   445   395   148     3 vYANe
   445   398   154     1 eGg
   445   440   197    12 tRALNDVLPVSTVd
   445   455   224    12 sLSASGDALGQQYq
   446   325    72     1 fNk
   446   393   141     4 tSDAFe
   446   439   191    12 nQALTSIETQIPAt
   446   453   217    12 nRATKGDPLGQQYq
   447   396   140     1 pLg
   447   438   183     8 qRTMEGIGMq
   447   456   209    12 gLDAKGDAMGQQYr
   447   465   230     1 eSg
   447   478   244     4 gKDPGl
   448   325    72     1 fGp
   448   393   141     2 qAEd
   448   395   145     2 fPHg
   448   439   191    12 tRALTEVSSTVTAa
   448   453   217    12 nLSSKGDKLGQQYq
   449   325    72     1 lTp
   449   393   141     4 sSPVFq
   449   395   147     2 rAYa
   449   440   194    20 tRALNEVLPVGGGEGDGGGEEe
   449   441   215     2 eEEe
   449   458   234    12 nLSSSGDALGQQYq
   450   325    72     1 lTp
   450   393   141     4 sSPVFq
   450   395   147     2 rAYa
   450   440   194    24 tRALNEVLPVGGGEGDGGEEEEEEEe
   450   441   219     3 eEEEe
   450   458   239    12 nLSSSGDALGQQYq
   451   326    70     1 fGd
   451   394   139     2 tDPg
   451   396   143     2 fPFr
   451   440   189     6 tRALTTVq
   451   441   196     1 qPq
   451   458   214    12 nLESRGDKLGQQYq
   452   326    70     1 fGd
   452   394   139     2 tDPg
   452   396   143     2 fPFr
   452   440   189     8 tRALTEVQPr
   452   457   214    12 nLGSRGDKLGQQYq
   453   308    54    19 gKHMCACSVIDLLTRPLRTEl
   453   326    91     1 fSd
   453   394   160     1 sDe
   453   396   163     3 tFPYr
   453   428   198     1 rRk
   453   432   203     1 gGa
   453   440   212     6 tRSLGPAg
   453   441   219     1 gLd
   453   458   237    12 nGSKSGNVLGQRYq
   454   325    72     1 fGd
   454   393   141     1 tDe
   454   395   144     3 tFPYr
   454   427   179     1 rKn
   454   431   184     1 aAg
   454   439   193    13 tRGLEDVGNEPGVEr
   454   454   221    12 nSSQSDNVLGQKYq
   455    10    18     1 lLp
   455   136   145    80 sTAITTFNQSVQTEISAEPLDASSATHADQNHLDVDEHGNPAEDRKHSVVSISTTISQSISPQPTPIIEDEGHHDDAHEILe
   455   138   227     2 rLGs
   455   141   232     1 pFl
   455   184   276     1 rSl
   455   207   300    10 qEGKMGDGKGQq
   455   218   321     1 eQg
   456    10    18     1 lLp
   456   136   145    81 sTAIATFNQSVQTEISAEPSDHASSANHGDPSHLDVDEHGNPNDDRKHSVVSISTTISQSISPQPTPIIEDEGHHDDAHEILe
   456   138   228     2 rLGs
   456   141   233     1 pFl
   456   184   277     1 rSl
   456   207   301    10 qEGKMGDGKGQq
   456   218   322     1 eQg
   457    10    17     1 aLp
   457   136   144    86 eTTITRHNTSVNTEISATRQSNGADDDDDDDFTYNDSAIESPIEMEGEERRLSIKPQDRKHSVVSVTTSISMRTESISPRPEPNGGTe
   457   138   232     2 dAFs
   457   141   237     1 dSa
   457   149   246    12 gPPPFLRSLLLLAe
   457   184   293     1 rSl
   457   207   317    11 qEGKKLGDALGQq
   457   218   339     1 dQg
   458    65    73     2 sGWd
   458    69    79     1 pEr
   458   137   148    87 sRWLERYPCEVRTSVTVGTPTTEQFDHEHEEQEVAPATQDLPPVSRREDGRKGSIVSVTTVTQKYESALSPRLNKGISESDEMLFPGIe
   458   139   237     1 eAp
   458   211   310     9 gTLKGDGKGQq
   458   222   330     1 vAg
   459    65    71     2 sGWd
   459    69    77     1 pEh
   459   137   146    87 sRWLERYPCEVRTSVTVGTPTTEQFEHEDEEKNVAPATQDPPPVPQREDGRKGSIVSVTTVTQKYESALSPRMNKGISENDEVLFPGIe
   459   139   235     1 eAp
   459   184   281     1 eAl
   459   211   309     8 tLKGDGKGQq
   459   222   328     1 vAg
   460    10    18     1 lLp
   460   136   145    85 aTAISIFNQSVQTKISAEPSDHTFPANDHSRAAGQVYLDTEEHGNPTENRKQNAVFITTAITQSISPQSTPVIEDEGHHDDAHEILe
   460   138   232     2 kLGs
   460   141   237     1 pFl
   460   181   278     1 rSl
   460   207   305     7 qVDDGKGQq
   460   218   323     1 eHg
   461    10    17     1 sLp
   461   136   144    91 eTTIAKYNTSVNTEISATRQVNGAGDDEDDDQFDDDMKKPDFTIESPIEMEGEERRLSIRAPDRKQSVVSVTTSISMRTESISPRPEPNDNGe
   461   138   237     2 dVFn
   461   141   242     1 dSa
   461   149   251    12 gPPPFLRSLLLLAe
   461   184   298     1 rSl
   461   207   322    11 qEGKKLGDALGQq
   461   218   344     1 dQg
   462    10    17     1 sLs
   462   136   144    91 eTTIAKYNTSVNTEISATRQVNGAGDDEDDDQFDDDMKNPDFTIESPIEMEGEERRLSIRAPDRKQSVVSVTTSISMRTESISPRPEPNDNGe
   462   138   237     2 dVFn
   462   141   242     1 dTa
   462   149   251    12 gPPPFLRSLLLLAe
   462   184   298     1 rSl
   462   207   322    11 qEGKKLGDALGQq
   462   218   344     1 dQg
   463    10    17     1 sLs
   463   136   144    91 eTTIAKYNTSVNTEISATRQVNGAGDDEDDDQFDDDMKNPDFTIESPIEMEGEERRLSIRAPDRKQSVVSVTTSISMRTESISPRPEPNDNGe
   463   138   237     2 dVFn
   463   141   242     1 dTa
   463   149   251    12 gPPPFLRSLLLLAe
   463   184   298     1 rSl
   463   207   322    11 qEGKKLGDALGQq
   463   218   344     1 dQg
   464    64    73     2 sGWd
   464    68    79     1 pQt
   464   136   148    79 aNWKARIHYEVKTSVSVGTPVAGQFDDGEEQNNGGSDRDSDGRKGSIVSITTVTQSFEPADSPRLAKTNEHGDELVFPGIe
   464   138   229     1 ePp
   464   182   274     6 qEALNSAp
   464   199   297     1 pGe
   464   205   304     8 hVEGDGLGQq
   464   216   323     1 lLg
   465    10    17     1 aLp
   465   136   144    86 eTTITRHNTSVNTEIFATRQTNGADDDDDDDFTYNDSAIESPIEMEGEERRLSIKAQDRKHSVVSVTTSISMRTESISPRPEPNGGTe
   465   138   232     2 eVFs
   465   141   237     1 dSa
   465   149   246    12 gPPPFLRSLLLLAe
   465   184   293     1 rSl
   465   207   317    11 qEGKKLGDALGQq
   465   218   339     1 eQg
   466    65    72     2 sGWd
   466    69    78     1 pQt
   466   137   147    86 tRWFERYPYEVKTSVSVGTPTAEDFEENDAGSSGRDEANGNTSRRPDDGRKGSIVSVTTVTQQYEPVNSPRLTKSMTGGDEVLFAGIe
   466   141   237     1 pMa
   466   184   281     1 eTl
   466   205   303     1 eDe
   466   211   310     8 tVQGDGKGQq
   466   222   329     1 vAg
   467   315    76     1 fNd
   467   383   145    67 sTAITTFNQSVQTEISAEPLDASSATHADQNHLDVDEHGNPAEDRKHSVVSISTTISQSISPQPTPIIe
   467   385   214     3 dEGHh
   467   388   220     1 dAh
   467   396   229    12 gSTPFLRALLLLAe
   467   431   276     1 rSl
   467   448   294    18 kIPPKGQEGKMGDGKGQQYt
   467   457   321     1 eQg
   468   317    75     1 wSd
   468   385   144    91 eTTIAKYNTSVNTEISATRQVNGAGDDEDDDQFDDDMKKPDFTIESPIEMEGEERRLSIRAPDRKQSVVSVTTSISMRTESISPRPEPNDNGe
   468   387   237     2 dVFn
   468   390   242     1 dSa
   468   398   251    12 gPPPFLRSLLLLAe
   468   433   298     1 rSl
   468   448   314     2 gCQl
   468   450   318    17 pPPGQEGKKLGDALGQQYn
   468   459   344     1 dQg
   469   317    75     1 wSd
   469   385   144    91 eTTIAKYNTSVNTEISATRQVNGAGDDEDDDQFDDDMKNPDFTIESPIEMEGEERRLSIRAPDRKQSVVSVTTSISMRTESISPRPEPNDNGe
   469   387   237     2 dVFn
   469   390   242     1 dTa
   469   398   251    12 gPPPFLRSLLLLAe
   469   433   298     1 rSl
   469   448   314     2 gCQl
   469   450   318    17 pPPGQEGKKLGDALGQQYn
   469   459   344     1 dQg
   470   317    75     1 wSd
   470   385   144    91 eTTIAKYNTSVNTEISATRQVNGAGDDEDDDQFDDDMKNPDFTIESPIEMEGEERRLSIRAPDRKQSVVSVTTSISMRTESISPRPEPNDNGe
   470   387   237     2 dVFn
   470   390   242     1 dTa
   470   398   251    12 gPPPFLRSLLLLAe
   470   433   298     1 rSl
   470   448   314     2 gCQl
   470   450   318    17 pPPGQEGKKLGDALGQQYn
   470   459   344     1 dQg
   471    10    17     1 gLp
   471   136   144    94 eATIAKYNTSVNTEISASPRIQQINGVHDDDDDDDDEDAPVRQESAIESPIEMEGEERRLSIKAQDRKHSVVSVTTTLSMRTESISPRPEPGTFNe
   471   138   240     2 nVFn
   471   141   245     1 dTa
   471   149   254    12 gEVPFLRSLLLLAe
   471   184   301     1 rSl
   471   207   325    11 qEGKKMGDSLGQq
   471   218   347     1 dQg
   472    65    72     2 sGWd
   472    69    78     1 pQt
   472   137   147    86 tRWFERYPYEVKTSVSVGTPTAEDFEENDAGSSGRDEANGNTSRRPDDGRKGSIVSVTTVTQQYEPVNSPRLTKSMTGGDEVLFAGIe
   472   141   237     1 pMa
   472   184   281     1 eTl
   472   205   303     1 eDe
   472   211   310     8 tVQGDGKGQq
   472   222   329     1 vAg
   473    10    20     1 fLp
   473   136   147    90 aSTIASYNTAVHTEISASPHSTPFSDSDSPDLDDFDDSPGPPHDGANDFLTARSTAAGRKESVVSISTTISQHNESISPQACSPLDMEEGCd
   473   138   239     2 gDAd
   473   147   250    13 lGPPPFLRALLLLAe
   473   182   298     1 rAl
   473   205   322    12 qEAEGKMGDKLGQq
   473   216   345     1 eMg
   474   315    75     1 wSd
   474   383   144    86 eTTITRHNTSVNTEIFATRQTNGADDDDDDDFTYNDSAIESPIEMEGEERRLSIKAQDRKHSVVSVTTSISMRTESISPRPEPNGGTe
   474   385   232     2 eVFs
   474   388   237     1 dSa
   474   396   246    12 gPPPFLRSLLLLAe
   474   431   293     1 rSl
   474   446   309     2 gCQl
   474   448   313    17 pPPGQEGKKLGDALGQQYn
   474   457   339     1 eQg
   475    65    72     2 sGWd
   475    69    78     1 pKt
   475   137   147    86 aRWLERYHYEVKTSISIGTPTASQLDEDSERSDAENQNDHPEPPRADNGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDEAVFPGIe
   475   139   235     1 eAp
   475   183   280     6 qECLNSQp
   475   206   309     9 aAIKGDGKGQq
   475   217   329     1 vAg
   476    10    18     1 sHp
   476   136   145    92 aTTIAKYNTGVYTDIFANPPPRKANSEDDDDDDDDEDTSHGVAVETPPATDGTEEKKLDIKPVDRKQSVVSISTTISTRTESISPRPDPNFHPe
   476   138   239     2 eAFn
   476   147   250    15 aRLGEAPFVRSLLLLAe
   476   182   300     1 rTl
   476   205   324    11 qEGKKLGDDLGQq
   476   216   346     1 eQg
   477    65    72     2 aGWd
   477    69    78     1 pQt
   477   137   147    88 aRWRERYPYEVKTSVTVGTPRSESFDDYEEDNGDGHEHTVGTPRPADINGRKGSIVSITTLTQHFEPAPSPRFPRNESHNSDEVLYAGIe
   477   139   237     1 eAp
   477   183   282     6 qENLNTEp
   477   206   311    10 eGGVVGDGKGQq
   477   217   332     1 lCg
   478   315    75     1 wSd
   478   383   144    86 eTTITRHNTSVNTEISATRQSNGADDDDDDDFTYNDSAIESPIEMEGEERRLSIKPQDRKHSVVSVTTSISMRTESISPRPEPNGGTe
   478   385   232     2 dAFs
   478   388   237     1 dSa
   478   396   246    12 gPPPFLRSLLLLAe
   478   431   293     1 rSl
   478   446   309     2 gCQl
   478   448   313    17 pPPGQEGKKLGDALGQQYn
   478   457   339     1 dQg
   479    65    72     2 sGWd
   479    69    78     1 pQt
   479   137   147    86 tRWFERYPYEVKTSVSVGTPTAEEFEDHDIGSSGRDDANDSVPRRTDDGRKGSIVSVTTVTQQYEPVNSPRLTKNMAGDDEVLFAGIe
   479   141   237     1 pMt
   479   184   281     1 eAl
   479   211   309     9 gSVQGDGKGQq
   479   222   329     1 iAg
   480    65    72     2 sGWd
   480    69    78     1 pQt
   480   137   147    86 tRWFERYPYEVKTSVSVGTPTAEEFEDHDIGSSGRDDTNDSVPRRTDDGRKGSIVSVTTVTQQYEPVNSPRLTKNMAGDDEVLFAGIe
   480   141   237     1 pMt
   480   184   281     1 eAl
   480   205   303     1 qDd
   480   211   310     8 sVQGDGKGQq
   480   222   329     1 iAg
   481    65    78     2 tGWd
   481    69    84     1 pHt
   481   137   153    79 qKWRERVPYEVKTSVSVGTPVADQFADEEAEDQTSTTKDTDGRKSSIVSITTVTQTYEPADSPRLVKTISEDDEIVFPGIe
   481   139   234     1 eAp
   481   183   279    20 qQNLNGITKEALAPSYEDGESt
   481   184   300     1 tTe
   481   211   328     6 qGDGLGQq
   481   222   345     1 iKg
   482     8    22     1 eLs
   482   134   149    93 qTAIRAHNTSVQTDIRASPAASVAGDWQDDHEEDEESEDEQADSSEPDSDPEITFDRNARKPSVVSVSTTISMKSEAISPQPHHRPSIPRVASDd
   482   136   244     3 sEDEg
   482   147   258    12 gPPPYFRSLLLLAq
   482   182   305     1 kGm
   482   220   344     1 eGg
   483    65    74     2 sGWd
   483    69    80     1 pQt
   483   137   149    85 aKWKGRRHCEVKTSVTVGALDEDGTVNGVSPSHVEPLEEQIRPVSPERDADGRKGSIVSITTVTQSFEHAGASGHADDAESVFPGIe
   483   139   236     1 eAp
   483   184   282     1 eAl
   483   207   306    12 eEDKPIDGDGLGQq
   483   218   329     1 gAg
   484    65    78     2 tGWd
   484    69    84     1 pHt
   484   137   153    79 qKWRERVPYEVKTSVSVGTPVADQFADEEAEDQTSTTKDTDGRKSSIVSITTVTQTYEPADSPRLVKTISEDDEIVFPGIe
   484   139   234     1 eAp
   484   183   279    20 qQNLNGITKEALAPSYEDGESt
   484   184   300     1 tTe
   484   211   328     6 qGDGLGQq
   484   222   345     1 iKg
   485    65    72     2 aGWd
   485    69    78     1 pQt
   485   137   147    88 aRWRERYPYEVKTSVTVGTPRSESFDDYEDSGDGHEHTIGTPRPSDVNGRKGSIVSITTLTQHFEPAPSPRFPRNESHSSDEVLYAGIEe
   485   183   281     6 qESLNTEp
   485   206   310     9 gGVAGDGKGQq
   485   217   330     1 lAg
   486    65    72     2 aGWd
   486    69    78     1 pRt
   486   137   147    85 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDGENQKNAPEIGRDNGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGId
   486   139   234     1 eAp
   486   183   279     6 qECLNTEp
   486   206   308     9 eAIKGDGKGQq
   486   217   328     1 iAg
   487   328    73     4 wDFHPe
   487   397   146    87 sRWLERYPCEVRTSVTVGTPTTEQFEHEDEEKNVAPATQDPPPVPQREDGRKGSIVSVTTVTQKYESALSPRMNKGISENDEVLFPGIe
   487   399   235     1 eAp
   487   443   280     5 qEALNTq
   487   455   297     2 gCQl
   487   457   301    18 pPAGDSDGTLKGDGKGQQYn
   487   466   328     1 vAg
   488    65    72     2 aGWd
   488    69    78     1 pRt
   488   137   147    85 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDGENQKNAPEIGRDNGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGId
   488   139   234     1 eAp
   488   183   279     6 qECLNTQp
   488   206   308     9 eAIKGDGKGQq
   488   217   328     1 iAg
   489    65    72     2 aGWd
   489    69    78     1 pQt
   489   137   147    90 aRWRERYPYEVRTSVTVGTPRSESFDDYDEDQANDLHTAEHTIGAPRPADVNGRKGSIVSITTLTQHFEPAPSPRFPRNESHGDDILYAGIe
   489   139   239     1 eAp
   489   183   284     6 qESLNTEp
   489   206   313     9 gGVAGDGKGQq
   489   217   333     1 lCg
   490    63    69     4 sDWDSd
   490   134   144    83 sAWREKKKYEVKTDITVGTPRPESLSEDDEGKDDEDIKNLKALQARRKASIVSITTVSQSYEPANSPRAPIPECEEDVIFFKIEe
   490   181   274     1 eTq
   490   203   297    11 eEQRANSDGLGQq
   490   214   319     1 eKs
   491   326    71     2 wDSd
   491   328    75     1 vEt
   491   396   144    83 sAWREKKKYEVKTDITVGTPRPESLSEDDEGKDDEDIKNLKALQARRKASIVSITTVSQSYEPANSPRAPIPECEEDVIFFKIEe
   491   442   273     2 qETq
   491   457   290     2 gCQl
   491   459   294    16 pSGEEQRANSDGLGQQYn
   491   468   319     1 eKs
   492    10    17     1 eQg
   492   136   144    94 qKAIAAYNTSVSTEIRASPAGSVADGAEESEEDSSEEEDDEDEAEYDHNIRKQSVVSVSTTISMKSEALSPAPQSRPSISRMASDDGDHDDPEALk
   492   138   240     2 nLGp
   492   141   245     1 pYy
   492   184   289     1 kGm
   492   222   328     1 eAg
   493    65    72     2 sGWd
   493    69    78     1 pQt
   493   137   147    90 aRWRERYPYEVKTSVTVGTPRSESFDEYDEDHVNNLENNEHTIGTPRPSDVNGRKGSIVSITTLTQHFEPAPSPRFPRNESHSSDEILYAGi
   493   139   239     2 eEAp
   493   183   285     6 qESLNSEp
   493   206   314     9 sAVAGDGKGQq
   493   217   334     1 lCg
   494   274    20     1 tTg
   494   328    75     1 wTd
   494   396   144    94 eATIAKYNTSVNTEISASPRIQQINGVHDDDDDDDDEDAPVRQESAIESPIEMEGEERRLSIKAQDRKHSVVSVTTTLSMRTESISPRPEPGTFNe
   494   398   240     2 nVFn
   494   401   245     1 dTa
   494   409   254    12 gEVPFLRSLLLLAe
   494   444   301     1 rSl
   494   459   317     2 gCQl
   494   461   321    17 pPPGQEGKKMGDSLGQQYn
   494   470   347     1 dQg
   495    65    72     2 sGWd
   495    69    78     1 pQt
   495   137   147    87 tRWFERYPYEVKTSVSVGTPTPEEFEENDAGSSGRDEANDKTSRRPDDGRKGSIVSVTTVTQQQYEPVNSPRLTKSMTGGDEVLFAGIe
   495   141   238     1 pMa
   495   183   281     6 qETLNTEp
   495   200   304     1 eDe
   495   206   311     8 tVQGDGKGQq
   495   217   330     1 vAg
   496    10    17     1 aLp
   496   136   144    88 eKTIAKYNTSVNTEISATRQVNGADCDDDHDEAMENPNFSIESPIEMEGGERRLSIRPPNRKQSVVSVTTSISMRTESISPRPEPNHNTe
   496   138   234     2 dVFn
   496   141   239     1 dTa
   496   149   248    12 gPPPFLRSLLLLAe
   496   184   295     1 rSl
   496   207   319    11 qEGKKLGDGLGQq
   496   218   341     1 dQg
   497   310    76     1 fNd
   497   378   145    66 sTAIATFNQSVQTEISAEPSDHASSANHGDPSHLDVDEHGNPNDDRKHSVVSISTTISQSISPQPTPi
   497   380   213     3 iEDEg
   497   391   227    15 eRLGSTPFLRALLLLAe
   497   426   277     1 rSl
   497   443   295    18 kIPPKGQEGKMGDGKGQQYt
   497   452   322     1 eQg
   498    65    73     2 sGWd
   498    69    79     1 pQt
   498   137   148    88 aKWKERINYEVKTSVTVGTPVNESFDDTDGEESHLDAPDPSRTAGARDPDGRKGSIVSVTTVTQSFEPADSPRLSKSMADGDDILYPGIe
   498   139   238     1 eAp
   498   184   284     1 eSl
   498   205   306     1 eGe
   498   211   313     8 hLEGDGLGQq
   498   222   332     1 lKg
   499   327    75     3 wDYNp
   499   397   148    80 aNWKARIHYEVKTSVSVGTPVAGQFDDGEEQNNGGSDRDSDGRKGSIVSITTVTQSFEPADSPRLAKTNEHGDELVFPGIEe
   499   443   274     6 qEALNSAp
   499   454   291     2 gCKl
   499   456   295    19 pPPGEEENGHVEGDGLGQQYn
   499   465   323     1 lLg
   500   328    74     3 wDFHp
   500   398   147    87 tRWFERYPYEVKTSVSVGTPTAEDFEENDAGSSGRDEANGNTSRRPDDGRKGSIVSVTTVTQQYEPVNSPRLTKSMTGGDEVLFAGIEe
   500   401   237     1 pMa
   500   444   281     1 eTl
   500   459   297     2 gCQl
   500   461   301    19 pPEDEDQNGTVQGDGKGQQYn
   500   470   329     1 vAg
   501   274    21     1 sTn
   501   328    76     1 wSd
   501   396   145    92 aTTIAKYNTGVYTDIFANPPPRKANSEDDDDDDDDEDTSHGVAVETPPATDGTEEKKLDIKPVDRKQSVVSISTTISTRTESISPRPDPNFHPe
   501   398   239     2 eAFn
   501   407   250    15 aRLGEAPFVRSLLLLAe
   501   442   300     1 rTl
   501   457   316     2 gCQl
   501   459   320    17 pPPGQEGKKLGDDLGQQYn
   501   468   346     1 eQg
   502    10   232     1 nLp
   502   136   359   105 dATIARYNTAVHTEISAAPRQGQWNSESDEEEGDDEDEDRDEEPPAAAAAAAAAAALESPSIEIDGDERRLSIKPMDRKQSVVSVTTSISMRSESISPRP
     +                   EQDAQGq
   502   138   466     2 dLFn
   502   141   471     1 dTa
   502   149   480    12 gEVPFLRSLLLLAe
   502   184   527     1 rSl
   502   207   551    11 qEGKKLGDNLGQq
   502   218   573     1 eQg
   503    65    72     2 aGWd
   503    69    78     1 pRt
   503   137   147    86 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDNENQKDTPEPARADSGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGId
   503   139   235     1 eAp
   503   183   280     6 qECLNTEp
   503   206   309     9 eAIKGDGKGQq
   503   217   329     1 iAg
   504    65    72     2 sGWd
   504    69    78     1 pEt
   504   137   147    94 kRWLERYPCEVKTSVTVGTPTMDSFDDDADSRDAEPAGAVNGMGSIGVLDKPIYSNRSGDGRKGSIVSITTVTQQYESVSSPRLTKAIAEGDESLf
   504   139   243     3 pGIEe
   504   142   249     1 pLs
   504   184   292     6 qETLNTEp
   504   206   320    12 qTNGSVGGDGQGQq
   504   217   343     1 iAg
   505   328    76     3 wDYNp
   505   398   149    86 aKWKGRRHCEVKTSVTVGALDEDGTVNGVSPSHVEPLEEQIRPVSPERDADGRKGSIVSITTVTQSFEHAGASGHADDAESVFPGIEe
   505   445   282     1 eAl
   505   460   298     2 gCKl
   505   462   302    18 pPPGEEDKPIDGDGLGQQYn
   505   471   329     1 gAg
   506   328    75     4 wDFHPe
   506   397   148    87 sRWLERYPCEVRTSVTVGTPTTEQFDHEHEEQEVAPATQDLPPVSRREDGRKGSIVSVTTVTQKYESALSPRLNKGISESDEMLFPGIe
   506   399   237     1 eAp
   506   443   282     5 qEALNAq
   506   455   299     2 gCQl
   506   457   303    18 pPQDEVNGTLKGDGKGQQYn
   506   466   330     1 vAg
   507    65    72     2 sGWd
   507    69    78     1 pEt
   507   137   147    99 kRWLERYPCEVKTSVTVGTPTMDSFDDIEETKDGEPVTVNGNGNGSSNMMEKPIYSGRTGDGRKGSIVSITTVTQQYESVASPRLAKAIAEGDESLFPGI
     +                   e
   507   141   250     1 pLn
   507   184   294     1 eTl
   507   210   321    12 qANGTVGGDGQGQq
   507   221   344     1 lCg
   508    65    75     2 aNWd
   508    69    81     1 pTs
   508   137   150    86 vRWKERKRYEVKTDISAGAPDPEGMDSDGEENDTVTPMTDEGLQYAATVGRKASIVSVTTVSQHFEPANSPRTYEGFAAEDQVLEGIe
   508   139   238     1 eAp
   508   183   283     6 qESLNTEk
   508   203   309    12 dDDAEVKGDGMGQq
   508   214   332     1 tMg
   509   315    76     1 fSd
   509   383   145    66 aTAISIFNQSVQTKISAEPSDHTFPANDHSRAAGQVYLDTEEHGNPTENRKQNAVFITTAITQSISPq
   509   385   213     3 sTPVi
   509   395   226    17 aHEILEKLGSTPFLRGLLl
   509   430   278     1 rSl
   509   447   296    18 kILPKAQEGQVDDGKGQQYn
   509   456   323     1 eHg
   510    65    72     2 sGWd
   510    69    78     1 pQt
   510   137   147    88 kRWFERYPYEVKTSVSVGTPMAEDYEDDDSGSSGVEDEDDETKIRRRQDDGRKGSIVSVTTVTQRYENVNSGRRMKNVHGGDEVLFPGIe
   510   141   239     1 pLt
   510   183   282     6 qESLNTEp
   510   200   305     1 eDe
   510   206   312     8 aVQGDGKGQq
   510   217   331     1 iAg
   511   128   149    94 qKAINSHNTSVSTDIRASPRVPPEDDFDSADDSDDGHDVNGVHSADEYEEEDSYDRMRKQSVVSVSTTISMKSEAISPQPHIRPSISRVSSTESSd
   511   141   256    12 gPPPFFRSLLLLAq
   511   175   302     6 qQSLNQAp
   511   209   342     1 qGg
   511   222   356     1 aAp
   512    65    75     2 sNWd
   512    69    81     1 pQt
   512   137   150    90 eRWSKNRQYEVKTDISVGNFMSKEEDLIGPHDLSDQLPTSIFEQETFSLVPDNSGRKSSIVSVTTVSQHFEPINSPRNNFLPTAQSLLDIEe
   512   183   286     6 qESLNTEs
   512   204   313    11 eSCKLVGDGKGQq
   512   215   335     1 lMg
   513    65    72     2 aGWd
   513    69    78     1 pRt
   513   137   147    86 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDNENQKDTPEPARADSGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGId
   513   139   235     1 eAp
   513   183   280     6 qECLNTEp
   513   206   309     9 eAIKGDGKGQq
   513   217   329     1 iAg
   514    65    72     2 aGWd
   514    69    78     1 pRt
   514   137   147    86 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDNENQKDTPEPARADSGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGId
   514   139   235     1 eAp
   514   183   280     6 qECLNTEp
   514   206   309     9 eAIKGDGKGQq
   514   217   329     1 iAg
   515    65    72     2 sGWd
   515    69    78     1 pDt
   515   137   147    94 rRWLERYPCEVKTSVTVGTPTMDQFDDAEDAKDDEPATVNDNGSNMMEKPIYAGRNGDGRKGSIVSITTVTQQYESAASPRLGKTIAEGDESLFPg
   515   139   243     1 iEe
   515   142   247     1 pLn
   515   185   291     1 eAl
   515   211   318    12 qTNGKVGGDGQGQq
   515   222   341     1 iAg
   516    65    78     2 tGWd
   516    69    84     1 pHt
   516   137   153    91 qKWRERIPYEVKTSVSVGTPVADQFADEEAEDQVEELRKVVTRETSTTTKDTDGRKSSIVSITTVTQTYEPADSPRLVKTISEDDEMVFPGIe
   516   139   246     1 eAp
   516   183   291    20 qQNLNGITKEALAPSYEDGESt
   516   184   312     1 tTe
   516   211   340     6 qGDGLGQq
   516   222   357     1 iKg
   517    65    76     2 tGWd
   517    69    82     1 pHt
   517   137   151    92 qKWRERIPYEVKTSVSVGTPVADQFADEEAEDQVDELRKIVPRENSTSKEKDTDGRKGSIVSITTVTQTYEPADSPRLAKTISEGDEAVFPGIe
   517   139   245     1 eAp
   517   183   290    20 qQNLNGITKEDLAPGYEDGETs
   517   184   311     1 sTe
   517   211   339     6 qGDGLGQq
   517   222   356     1 iKg
   518   328    74     3 wDFHp
   518   398   147    87 tRWFERYPYEVKTSVSVGTPTAEDFEENDAGSSGRDEANGNTSRRPDDGRKGSIVSVTTVTQQYEPVNSPRLTKSMTGGDEVLFAGIEe
   518   401   237     1 pMa
   518   444   281     1 eTl
   518   459   297     2 gCQl
   518   461   301    19 pPEDEDQNGTVQGDGKGQQYn
   518   470   329     1 vAg
   519   274    20     1 sVg
   519   328    75     1 wSd
   519   396   144    88 eKTIAKYNTSVNTEISATRQVNGADCDDDHDEAMENPNFSIESPIEMEGGERRLSIRPPNRKQSVVSVTTSISMRTESISPRPEPNHNTe
   519   398   234     2 dVFn
   519   401   239     1 dTa
   519   409   248    12 gPPPFLRSLLLLAe
   519   444   295     1 rSl
   519   459   311     2 gCQl
   519   461   315    17 pPPGQEGKKLGDGLGQQYn
   519   470   341     1 dQg
   520   274    23     1 gTs
   520   328    78     1 fGd
   520   396   147    90 aSTIASYNTAVHTEISASPHSTPFSDSDSPDLDDFDDSPGPPHDGANDFLTARSTAAGRKESVVSISTTISQHNESISPQACSPLDMEEGCd
   520   398   239     2 gDAd
   520   407   250    13 lGPPPFLRALLLLAe
   520   442   298     1 rAl
   520   457   314     2 gVQl
   520   459   318    18 pKEGQEAEGKMGDKLGQQYn
   520   468   345     1 eMg
   521    65    72     2 aGWd
   521    69    78     1 pRt
   521   137   147    86 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDNENQKDTPEPARADSGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGId
   521   139   235     1 eAp
   521   183   280     6 qECLNTEp
   521   206   309     9 eAIKGDGKGQq
   521   217   329     1 iAg
   522    65    75     2 nNWd
   522    69    81     1 pTt
   522   137   150    94 aRWRERKRYEVKTNISVGTPRPESIEGDEDQITTPISLNNTCHEIPDGSHGLEAHNEANIGRKASIVSITTVSQHFEPADSPRSRIDFDIEEEAYp
   522   139   246     2 gIDe
   522   142   251     1 pLe
   522   185   295     1 eTl
   522   212   323     8 eLEGDGKGQq
   523   328    74     3 wDFDp
   523   398   147    87 aRWLERYHYEVKTSISIGTPTASQLDEDSERSDAENQNDHPEPPRADNGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDEAVFPGIEe
   523   444   280     6 qECLNSQp
   523   455   297     2 gCQl
   523   457   301    19 pPEGEDENAAIKGDGKGQQYn
   523   466   329     1 vAg
   524   328    74     3 wDYNp
   524   398   147    88 aRWRERYPYEVKTSVTVGTPRSESFDDYEEDNGDGHEHTVGTPRPADINGRKGSIVSITTLTQHFEPAPSPRFPRNESHNSDEVLYAGIe
   524   400   237     1 eAp
   524   444   282     6 qENLNTEp
   524   455   299     2 gCQl
   524   457   303    20 pPEGDEENEGGVVGDGKGQQYn
   524   466   332     1 lCg
   525   274   235     1 sTt
   525   328   290     1 wSd
   525   396   359   105 dATIARYNTAVHTEISAAPRQGQWNSESDEEEGDDEDEDRDEEPPAAAAAAAAAAALESPSIEIDGDERRLSIKPMDRKQSVVSVTTSISMRSESISPRP
     +                   EQDAQGq
   525   398   466     2 dLFn
   525   401   471     1 dTa
   525   409   480    12 gEVPFLRSLLLLAe
   525   444   527     1 rSl
   525   459   543     2 gCQl
   525   461   547    17 pPPGQEGKKLGDNLGQQYn
   525   470   573     1 eQg
   526   328    80     3 wDYHp
   526   398   153    80 qKWRERVPYEVKTSVSVGTPVADQFADEEAEDQTSTTKDTDGRKSSIVSITTVTQTYEPADSPRLVKTISEDDEIVFPGIEe
   526   444   279    20 qQNLNGITKEALAPSYEDGESt
   526   445   300     1 tTe
   526   460   316     2 gCKl
   526   462   320    16 pPPGEEAPQGDGLGQQYn
   526   471   345     1 iKg
   527   328    74     3 wDFDp
   527   398   147    87 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDNENQKDTPEPARADSGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGIDe
   527   444   280     6 qECLNTEp
   527   455   297     2 gCQl
   527   457   301    19 pPEGADENEAIKGDGKGQQYn
   527   466   329     1 iAg
   528   272    25     1 nNt
   528   326    80     1 fGe
   528   394   149    93 qTAIRAHNTSVQTDIRASPAASVAGDWQDDHEEDEESEDEQADSSEPDSDPEITFDRNARKPSVVSVSTTISMKSEAISPQPHHRPSIPRVASDd
   528   396   244     3 sEDEg
   528   407   258    12 gPPPYFRSLLLLAq
   528   442   305     1 kGm
   528   459   323    12 qLQAGGDGMGQQYn
   528   468   344     1 eGg
   529    65    72     2 aGWd
   529    69    78     1 pQt
   529   137   147    85 qSGASATSTEVKTSVTVGTPRSETFDEHEEDAIPRSTDEPRGGYREEGRKGSIVSVTTLTQHYESASSPRFPRSEMPGDDILYAGIe
   529   139   234     1 ePp
   529   183   279     6 qESLNTEp
   529   206   308     9 gVVAGDGKGQq
   529   217   328     1 lCg
   530    65    75     2 nNWd
   530    69    81     1 pTt
   530   137   150    98 aRWRERKRYEVKTNISVGTPRPESIESDEDQITTPINLNSNCNEVTDGSHGLEAHDEANIGRKASIVSITTVSQHFEPANSPRSRIDFDIEEESYPGIDe
   530   183   294     6 qETLNTDp
   530   206   323     8 eVAGDGKGQq
   531    65    74     2 sGWd
   531    69    80     1 pKt
   531   137   149   105 aKWRERIKYEVRTSVSVGTPLSDSFEDDEEGNGAGVGGSSSMASPPIAGSSNSGGGPPPSVYGRDADGRKGSIVSITTVTQSFEPADSPRLSKSMSGEGV
     +                   DDLVFPg
   531   139   256     3 iEEAp
   531   184   304     1 eGl
   531   205   326     1 qGe
   531   211   333     8 pLEGDGLGQq
   532   328    80     3 wDYHp
   532   398   153    80 qKWRERVPYEVKTSVSVGTPVADQFADEEAEDQTSTTKDTDGRKSSIVSITTVTQTYEPADSPRLVKTISEDDEIVFPGIEe
   532   444   279    20 qQNLNGITKEALAPSYEDGESt
   532   445   300     1 tTe
   532   460   316     2 gCKl
   532   462   320    16 pPPGEEAPQGDGLGQQYn
   532   471   345     1 iKg
   533    65    72     2 sGWd
   533    69    78     1 pDt
   533   137   147    94 rRWLERYPCEVKTSVTVGTPTMDQFDDAEDAKDDEPVTVNGNGSNMMEKPIYAGRNGDGRKGSIVSITTVTQQYESAASPRLGKTIAEGDESLFPg
   533   139   243     1 iEe
   533   142   247     1 pLn
   533   184   290     6 qEALNTQp
   533   206   318    12 qTNGKVGGDGQGQq
   533   217   341     1 iAg
   534   328    74     3 wDYNp
   534   398   147    87 aRWRERYPYEVKTSVTVGTPRSESFDDYEDSGDGHEHTIGTPRPSDVNGRKGSIVSITTLTQHFEPAPSPRFPRNESHSSDEVLYAGIe
   534   400   236     1 eAp
   534   444   281     6 qESLNTEp
   534   455   298     2 gCQl
   534   457   302    19 pPEGDEENGGVAGDGKGQQYn
   534   466   330     1 lAg
   535   328    74     3 wDFDp
   535   398   147    86 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDGENQKNAPEIGRDNGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGIDe
   535   444   279     6 qECLNTEp
   535   455   296     2 gCQl
   535   457   300    19 pPEGADENEAIKGDGKGQQYn
   535   466   328     1 iAg
   536   328    77     3 wDYHp
   536   398   150    87 vRWKERKRYEVKTDISAGAPDPEGMDSDGEENDTVTPMTDEGLQYAATVGRKASIVSVTTVSQHFEPANSPRTYEGFAAEDQVLEGIEe
   536   444   283     6 qESLNTEk
   536   455   300     2 gCQl
   536   457   304    19 pSDFEDDDAEVKGDGMGQQYn
   536   466   332     1 tMg
   537   328    74     3 wDFDp
   537   398   147    86 nRWLERYHYEVKTSISIGTPTASQLDEDSERSDGENQKNAPEIGRDNGRKGSIVSTTTVTQQYESADSPRLVKTIPEGDETVFPGIDe
   537   444   279     5 qECLNTq
   537   456   296     2 gCQl
   537   458   300    19 pPEGADENEAIKGDGKGQQYn
   537   467   328     1 iAg
   538   328    74     3 wDFNp
   538   398   147    90 aRWRERYPYEVRTSVTVGTPRSESFDDYDEDQANDLHTAEHTIGAPRPADVNGRKGSIVSITTLTQHFEPAPSPRFPRNESHGDDILYAGIe
   538   400   239     1 eAp
   538   444   284     6 qESLNTEp
   538   455   301     2 gCQl
   538   457   305    19 pPEGDEENGGVAGDGKGQQYn
   538   466   333     1 lCg
   539    65    74     2 sGWd
   539    69    80     1 pKt
   539   137   149   105 aKWRERIKYEVRTSVSVGTPLSDSFEDDEEGNGAGVGGSSSMASPPIAGSSNSGGGPPPSVYGRDADGRKGSIVSITTVTQSFEPADSPRLSKSMSGEGV
     +                   DDLVFPg
   539   139   256     3 iEEAp
   539   184   304     1 eGl
   539   205   326     1 qGe
   539   211   333     8 pLEGDGLGQq
   540    65    74     2 sGWd
   540    69    80     1 pKt
   540   137   149   105 aKWRERIKYEVRTSVSVGTPLSDSFEDDEEGNGAGVGGSSSMASPPIAGSSNSGGGPPPSVYGRDADGRKGSIVSITTVTQSFEPADSPRLSKSMSGEGV
     +                   DDLVFPg
   540   139   256     3 iEEAp
   540   184   304     1 eGl
   540   205   326     1 qGe
   540   211   333     8 pLEGDGLGQq
   541    65    75     2 nNWd
   541    69    81     1 pTt
   541   137   150    98 aRWRERKRYEVKTNISVGTPRPESIESDEDQITTPINLNSNCNEVTDGSHGLEAHDEANIGRKASIVSITTVSQHFEPANSPRSRIDFDIEEESYPGIDe
   541   183   294     6 qETLNTDp
   541   206   323     8 eVAGDGKGQq
   542   328    77     3 wDYSp
   542   398   150    90 eRWSKNRQYEVKTDISVGNFMSKEEDLIGPHDLSDQLPTSIFEQETFSLVPDNSGRKSSIVSVTTVSQHFEPINSPRNNFLPTAQSLLDIEe
   542   444   286     6 qESLNTEs
   542   455   303     2 gCQl
   542   457   307    19 pPEDEDESCKLVGDGKGQQYn
   542   466   335     1 lMg
   543   274    20     1 nLt
   543   328    75     1 fGe
   543   396   144    94 qKAIAAYNTSVSTEIRASPAGSVADGAEESEEDSSEEEDDEDEAEYDHNIRKQSVVSVSTTISMKSEALSPAPQSRPSISRMASDDGDHDDPEALk
   543   398   240     2 nLGp
   543   401   245     1 pYy
   543   444   289     1 kGm
   543   461   307    12 qLQAGGDGLGQQYn
   543   470   328     1 eAg
   544   328    74     3 wDYNp
   544   398   147    91 aRWRERYPYEVKTSVTVGTPRSESFDEYDEDHVNNLENNEHTIGTPRPSDVNGRKGSIVSITTLTQHFEPAPSPRFPRNESHSSDEILYAGIe
   544   400   240     1 eAp
   544   444   285     6 qESLNSEp
   544   455   302     2 gCQl
   544   457   306    19 pPEGDEENSAVAGDGKGQQYn
   544   466   334     1 lCg
   545    65    72     2 aGWd
   545    69    78     1 pEt
   545   137   147    94 aKWLERLPYEVKTSVTVGTPRNTDEDDDDEDDGNAGEMERSHTFGLNGNNGVPIKESSDGRKGSIVSVTTVTQQYESAHSPRLTKTIAEEGDMLLa
   545   139   243     2 gLEe
   545   142   248     1 pLn
   545   184   291     6 qEALNSQp
   545   207   320     8 eLRGDGKGQq
   545   218   339     1 vCg
   546    65    72     3 sGWTs
   546   137   147    94 kRWLERYPCEVKTSVTVGTPTMDSFDDDADSRDAEPAGAVNGMGSIGVLDKPIYSNRSGDGRKGSIVSITTVTQQYESVSSPRLTKAIAEGDESLf
   546   139   243     3 pGIEe
   546   142   249     1 pLs
   546   184   292     6 qETLNTEp
   546   206   320    12 qTNGSVGGDGQGQq
   546   217   343     1 iAg
   547   328    74     3 wDFHp
   547   398   147    87 tRWFERYPYEVKTSVSVGTPTPEEFEENDAGSSGRDEANDKTSRRPDDGRKGSIVSVTTVTQQQYEPVNSPRLTKSMTGGDEVLFAGIe
   547   445   281     6 qETLNTEp
   547   456   298     2 gCQl
   547   458   302    19 pPEDEDQNGTVQGDGKGQQYn
   547   467   330     1 vAg
   548   328    75     3 wDYNp
   548   398   148    88 aKWKERINYEVKTSVTVGTPVNESFDDTDGEESHLDAPDPSRTAGARDPDGRKGSIVSVTTVTQSFEPADSPRLSKSMADGDDILYPGIe
   548   400   238     1 eAp
   548   445   284     1 eSl
   548   460   300     2 gCKl
   548   462   304    19 pPEGEEENGHLEGDGLGQQYn
   548   471   332     1 lKg
//