Complet list of 2xru hssp fileClick here to see the 3D structure Complete list of 2xru.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      2XRU
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-09-22
HEADER     NUCLEOTIDE-BINDING, KINASE, CELL CYCLE, 2010-09-29 2XRU
COMPND     SERINE/THREONINE-PROTEIN KINASE 6
SOURCE     HOMO SAPIENS
AUTHOR     Bindi, S.; Fancelli, D.; Alli, C.; Berta, D.; Bertrand, J.A.; Cameron,
SEQLENGTH   253
NCHAIN        1 chain(s) in 2XRU data set
NALIGN      115
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : G3QW90_GORGO        0.96  0.96    1  254  126  388  263    1   10  403  G3QW90     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101146407 PE=4 SV=1
    2 : A4UTN8_PIG          0.93  0.95    1  253  125  386  262    1   10  401  A4UTN8     Aurora kinase A OS=Sus scrofa GN=Aurka PE=2 SV=1
    3 : L8J3P4_BOSMU        0.93  0.95    1  253  126  387  262    1   10  402  L8J3P4     Serine/threonine-protein kinase 6 OS=Bos grunniens mutus GN=M91_17507 PE=4 SV=1
    4 : M3WUX0_FELCA        0.93  0.95    1  254  113  375  263    1   10  391  M3WUX0     Uncharacterized protein (Fragment) OS=Felis catus GN=AURKA PE=4 SV=1
    5 : Q4R1K4_PIG          0.92  0.94    1  253  126  390  265    2   13  405  Q4R1K4     Aurora-A OS=Sus scrofa GN=aurora-A PE=2 SV=1
    6 : G1TEP5_RABIT        0.91  0.95    1  254  125  387  263    1   10  402  G1TEP5     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100345632 PE=4 SV=1
    7 : G3HBL6_CRIGR        0.90  0.94    1  254  108  370  263    1   10  386  G3HBL6     Serine/threonine-protein kinase 6 OS=Cricetulus griseus GN=I79_007850 PE=4 SV=1
    8 : AURAA_XENLA         0.79  0.89    1  253  133  394  262    1   10  407  Q91820     Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1
    9 : B5DFP5_XENTR        0.79  0.90    1  254  139  401  263    1   10  415  B5DFP5     Aurora kinase A OS=Xenopus tropicalis GN=aurka PE=2 SV=1
   10 : Q4SS89_TETNG        0.77  0.89    2  237    3  249  247    2   12  367  Q4SS89     Chromosome 11 SCAF14479, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00013546001 PE=4 SV=1
   11 : G3NSV6_GASAC        0.73  0.87    1  254  147  411  265    2   12  424  G3NSV6     Uncharacterized protein OS=Gasterosteus aculeatus GN=AURKA PE=4 SV=1
   12 : G3NSW0_GASAC        0.73  0.87    1  254  143  407  265    2   12  420  G3NSW0     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=AURKA PE=4 SV=1
   13 : AURK_ASTPE          0.70  0.83    1  254  140  404  265    2   12  407  D7UQM5     Aurora kinase OS=Asterina pectinifera GN=aur PE=1 SV=1
   14 : F7CH47_CALJA        0.70  0.83    1  253   70  331  262    1   10  344  F7CH47     Uncharacterized protein OS=Callithrix jacchus GN=AURKB PE=4 SV=1
   15 : G1P9K6_MYOLU        0.70  0.84    1  210    7  225  219    1   10  225  G1P9K6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
   16 : G1P0L7_MYOLU        0.69  0.83    1  253   65  326  262    1   10  339  G1P0L7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
   17 : G1T141_RABIT        0.69  0.84    1  253   19  280  262    1   10  292  G1T141     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100343856 PE=4 SV=1
   18 : H2QH96_PANTR        0.69  0.82    1  253   36  297  262    1   10  309  H2QH96     Uncharacterized protein OS=Pan troglodytes GN=AURKC PE=4 SV=1
   19 : H2Z804_CIOSA        0.69  0.86    2  253   36  296  261    1   10  302  H2Z804     Uncharacterized protein OS=Ciona savignyi GN=Csa.4656 PE=4 SV=1
   20 : I1K9I2_SOYBN        0.69  0.84    1  206   28  241  214    1    9  241  I1K9I2     Uncharacterized protein OS=Glycine max PE=4 SV=1
   21 : L8IPH5_BOSMU        0.69  0.83    1  253   70  331  262    1   10  344  L8IPH5     Serine/threonine-protein kinase 12 OS=Bos grunniens mutus GN=M91_04988 PE=4 SV=1
   22 : H0V0I1_CAVPO        0.68  0.83    1  253   69  330  262    1   10  339  H0V0I1     Uncharacterized protein OS=Cavia porcellus GN=LOC100727564 PE=4 SV=1
   23 : H2P0C0_PONAB        0.68  0.82    1  253   36  297  262    1   10  309  H2P0C0     Uncharacterized protein OS=Pongo abelii GN=AURKC PE=4 SV=1
   24 : AURKB_XENTR         0.67  0.85    1  253   86  347  262    1   10  360  A4IGM9     Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1
   25 : E1FL40_LOALO        0.67  0.82    1  251   40  299  260    1   10  304  E1FL40     AUR protein kinase OS=Loa loa GN=LOAG_01615 PE=4 SV=1
   26 : E1Z7C1_CHLVA        0.67  0.82    1  253  118  381  264    2   12  390  E1Z7C1     Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_34300 PE=4 SV=1
   27 : F7AFU9_XENTR        0.67  0.85    1  253    3  264  262    1   10  277  F7AFU9     Aurora kinase B (Fragment) OS=Xenopus tropicalis GN=aurkb PE=4 SV=1
   28 : M3Y4U0_MUSPF        0.67  0.81    1  253   34  295  262    1   10  307  M3Y4U0     Uncharacterized protein (Fragment) OS=Mustela putorius furo GN=AURKC PE=4 SV=1
   29 : G3TRT6_LOXAF        0.66  0.82    1  253    9  272  264    2   12  284  G3TRT6     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=LOC100660262 PE=4 SV=1
   30 : A9NRB9_PICSI        0.65  0.82    1  252   28  289  262    2   11  300  A9NRB9     Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1
   31 : A9NX61_PICSI        0.65  0.83    1  253   30  292  263    2   11  302  A9NX61     Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1
   32 : B4F8A1_MAIZE        0.65  0.81    1  253   22  284  263    2   11  292  B4F8A1     Serine/threonine-protein kinase Eg2-like OS=Zea mays PE=2 SV=1
   33 : B9RRX5_RICCO        0.65  0.83    1  253   23  285  263    2   11  293  B9RRX5     Serine/threonine-protein kinase, putative OS=Ricinus communis GN=RCOM_0799040 PE=4 SV=1
   34 : F2UGX7_SALS5        0.65  0.78    1  254   39  303  265    2   12  308  F2UGX7     AUR protein kinase OS=Salpingoeca sp. (strain ATCC 50818) GN=PTSG_07989 PE=4 SV=1
   35 : G3PVJ4_GASAC        0.65  0.84    1  253   58  319  262    1   10  331  G3PVJ4     Uncharacterized protein OS=Gasterosteus aculeatus GN=AURKC PE=4 SV=1
   36 : M1CE13_SOLTU        0.65  0.83    1  230   32  271  240    2   11  272  M1CE13     Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400025461 PE=4 SV=1
   37 : M4APC9_XIPMA        0.65  0.85    1  253   57  318  262    1   10  331  M4APC9     Uncharacterized protein OS=Xiphophorus maculatus GN=AURKC PE=4 SV=1
   38 : C5XLY9_SORBI        0.64  0.81    1  253   17  279  263    2   11  287  C5XLY9     Putative uncharacterized protein Sb03g003130 OS=Sorghum bicolor GN=Sb03g003130 PE=4 SV=1
   39 : D8TXJ9_VOLCA        0.64  0.79    1  253   57  320  264    2   12  328  D8TXJ9     Serine/threonine protein kinase OS=Volvox carteri GN=alk2a PE=4 SV=1
   40 : N6TSG7_9CUCU        0.63  0.77    2  254   70  333  264    2   12  345  N6TSG7     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=YQE_11155 PE=4 SV=1
   41 : D2VH35_NAEGR        0.60  0.77    1  251   74  333  260    1   10  341  D2VH35     Predicted protein OS=Naegleria gruberi GN=NAEGRDRAFT_33959 PE=4 SV=1
   42 : F1LD22_ASCSU        0.60  0.80    1  249    7  266  260    2   12  302  F1LD22     Serine/threonine-protein kinase 6-A OS=Ascaris suum PE=2 SV=1
   43 : ARK1_SCHPO          0.59  0.77    1  251   82  342  261    2   11  355  O59790     Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2
   44 : B0WKU9_CULQU        0.59  0.78    1  253  114  377  264    2   12  380  B0WKU9     Serine/threonine-protein kinase 6 OS=Culex quinquefasciatus GN=CpipJ_CPIJ007519 PE=4 SV=1
   45 : B3M1C2_DROAN        0.59  0.79    1  253  140  403  264    2   12  404  B3M1C2     GF17839 OS=Drosophila ananassae GN=Dana\GF17839 PE=4 SV=1
   46 : C5PHM3_COCP7        0.59  0.74    1  252  106  369  265    3   15  389  C5PHM3     Serine/threonine-protein kinase, putative OS=Coccidioides posadasii (strain C735) GN=CPC735_053960 PE=4 SV=1
   47 : D7LCJ8_ARALL        0.59  0.79    1  253   15  277  263    2   11  288  D7LCJ8     ATAUR3 OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_903994 PE=4 SV=1
   48 : H2W3P3_CAEJA        0.59  0.77    2  251   28  286  259    1   10  309  H2W3P3     Uncharacterized protein OS=Caenorhabditis japonica GN=WBGene00128903 PE=4 SV=2
   49 : M5X7W6_PRUPE        0.59  0.78    1  253   12  274  263    2   11  282  M5X7W6     Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024695mg PE=4 SV=1
   50 : B4HHJ5_DROSE        0.58  0.79    1  253  157  420  264    2   12  421  B4HHJ5     GM23989 OS=Drosophila sechellia GN=Dsec\GM23989 PE=4 SV=1
   51 : H3DWR7_PRIPA        0.58  0.80    2  252   52  311  260    1   10  400  H3DWR7     Uncharacterized protein OS=Pristionchus pacificus GN=WBGene00091413 PE=4 SV=1
   52 : K2R4B7_MACPH        0.58  0.76    8  228    2  234  234    3   15  295  K2R4B7     Uncharacterized protein OS=Macrophomina phaseolina (strain MS6) GN=MPH_05584 PE=4 SV=1
   53 : R0HQR0_9BRAS        0.58  0.78    1  253   15  277  263    2   11  285  R0HQR0     Uncharacterized protein OS=Capsella rubella GN=CARUB_v10023787mg PE=4 SV=1
   54 : A8NQ19_COPC7        0.57  0.78    1  254  153  417  265    3   12  421  A8NQ19     Other/AUR protein kinase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_05421 PE=4 SV=1
   55 : B9RDF3_RICCO        0.57  0.78   32  253   21  252  232    2   11  260  B9RDF3     Serine/threonine-protein kinase, putative OS=Ricinus communis GN=RCOM_1612520 PE=4 SV=1
   56 : G2RB39_THITE        0.57  0.75    1  252  127  391  266    4   16  406  G2RB39     Putative uncharacterized protein OS=Thielavia terrestris (strain ATCC 38088 / NRRL 8126) GN=THITE_2118954 PE=4 SV=1
   57 : G2Y2K8_BOTF4        0.57  0.75    1  252  109  370  263    3   13  403  G2Y2K8     Similar to serine / threonine protein kinase OS=Botryotinia fuckeliana (strain T4) GN=BofuT4_P114370.1 PE=4 SV=1
   58 : M5BRQ2_THACB        0.57  0.77    1  250  120  380  261    3   12  392  M5BRQ2     Aurora kinase A OS=Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14) GN=aim1 PE=4 SV=1
   59 : A6RCS9_AJECN        0.56  0.73    1  252  109  372  265    3   15  391  A6RCS9     Serine/threonine-protein kinase Eg2 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=HCAG_07437 PE=4 SV=1
   60 : C0NME1_AJECG        0.56  0.73    1  252  109  372  265    3   15  391  C0NME1     Serine/threonine-protein kinase Eg2 OS=Ajellomyces capsulata (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_04671 PE=4 SV=1
   61 : F0U9F9_AJEC8        0.56  0.73    1  252  109  372  265    3   15  391  F0U9F9     Serine/threonine protein kinase Eg2 OS=Ajellomyces capsulata (strain H88) GN=HCEG_01263 PE=4 SV=1
   62 : F0ZBQ9_DICPU        0.56  0.77    1  253   78  339  262    1   10  359  F0ZBQ9     Putative uncharacterized protein OS=Dictyostelium purpureum GN=DICPUDRAFT_96852 PE=4 SV=1
   63 : L2G4Y4_COLGN        0.56  0.72    1  252  117  367  254    3    6  381  L2G4Y4     Serine threonine-protein kinase eg2 OS=Colletotrichum gloeosporioides (strain Nara gc5) GN=CGGC5_6788 PE=4 SV=1
   64 : M7T235_EUTLA        0.56  0.74    1  252  123  386  265    3   15  400  M7T235     Putative serine threonine-protein kinase protein OS=Eutypa lata (strain UCR-EL1) GN=UCREL1_2381 PE=4 SV=1
   65 : C1HDZ8_PARBA        0.55  0.73    1  252  108  371  265    3   15  389  C1HDZ8     Serine/threonine-protein kinase OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=PAAG_08991 PE=4 SV=1
   66 : E4ZHN7_LEPMJ        0.55  0.74    1  252  112  375  265    3   15  401  E4ZHN7     Similar to serine/threonine-protein kinase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LEMA_P059040.1 PE=4 SV=1
   67 : B4FJD5_MAIZE        0.54  0.76    3  253    7  267  261    2   11  285  B4FJD5     Uncharacterized protein OS=Zea mays PE=2 SV=1
   68 : B8M0Z8_TALSN        0.54  0.73    1  252  100  363  265    3   15  378  B8M0Z8     Serine/threonine protein kinase (Ark1), putative OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_090170 PE=4 SV=1
   69 : F2QLM7_PICP7        0.54  0.75    4  254   61  321  261    1   11  332  F2QLM7     Aurora kinase, other OS=Komagataella pastoris (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) GN=aim1 PE=4 SV=1
   70 : K9HI97_AGABB        0.54  0.77    1  254  140  404  265    3   12  409  K9HI97     Uncharacterized protein OS=Agaricus bisporus var. bisporus (strain H97 / ATCC MYA-4626 / FGSC 10389) GN=AGABI2DRAFT_193568 PE=4 SV=1
   71 : D6X165_TRICA        0.53  0.74    2  252   48  309  262    2   12  310  D6X165     IplI-aurora-like kinase OS=Tribolium castaneum GN=ial PE=4 SV=1
   72 : F2CRP5_HORVD        0.53  0.75    2  253    5  266  262    2   11  279  F2CRP5     Predicted protein OS=Hordeum vulgare var. distichum PE=2 SV=1
   73 : F2RTQ2_TRIT1        0.53  0.66    1  251   89  325  264    5   41  346  F2RTQ2     AUR protein kinase OS=Trichophyton tonsurans (strain CBS 112818) GN=TESG_02209 PE=4 SV=1
   74 : G5EDL3_CAEEL        0.53  0.74    3  251   39  298  260    2   12  326  G5EDL3     Aurora/Ipl1-related protein kinase 1 OS=Caenorhabditis elegans GN=air-1 PE=1 SV=1
   75 : K7INW3_NASVI        0.53  0.74    2  252   39  300  262    2   12  305  K7INW3     Uncharacterized protein OS=Nasonia vitripennis PE=4 SV=1
   76 : B0XL95_CULQU        0.52  0.77    2  252   46  307  262    2   12  310  B0XL95     Serine/threonine-protein kinase 6 OS=Culex quinquefasciatus GN=CpipJ_CPIJ020233 PE=4 SV=1
   77 : B4P132_DROYA        0.51  0.74    2  251   47  307  261    2   12  329  B4P132     GE13219 OS=Drosophila yakuba GN=Dyak\GE13219 PE=4 SV=1
   78 : I1BU11_RHIO9        0.51  0.73    1  229   98  337  240    3   12  353  I1BU11     Uncharacterized protein OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=RO3G_04396 PE=4 SV=1
   79 : L5LZH2_MYODS        0.51  0.62   70  253   70  301  232    2   49  314  L5LZH2     Serine/threonine-protein kinase 12 OS=Myotis davidii GN=MDA_GLEAN10018339 PE=4 SV=1
   80 : B4JPU6_DROGR        0.50  0.75    2  251   47  307  261    2   12  331  B4JPU6     GH13588 OS=Drosophila grimshawi GN=Dgri\GH13588 PE=4 SV=1
   81 : D0MSX3_PHYIT        0.50  0.69    1  249   25  281  260    2   15  296  D0MSX3     Protein kinase, putative OS=Phytophthora infestans (strain T30-4) GN=PITG_00115 PE=4 SV=1
   82 : D0N2X6_PHYIT        0.50  0.69    1  252   53  317  265    2   14  320  D0N2X6     Protein kinase, putative OS=Phytophthora infestans (strain T30-4) GN=PITG_05483 PE=4 SV=1
   83 : G4YWP4_PHYSP        0.50  0.69    2  254   38  303  266    2   14  304  G4YWP4     Putative uncharacterized protein OS=Phytophthora sojae (strain P6497) GN=PHYSODRAFT_487332 PE=4 SV=1
   84 : M9N6Q1_ASHGS        0.50  0.72    1  254  102  365  264    1   11  367  M9N6Q1     FAFL101Cp OS=Ashbya gossypii FDAG1 GN=FAGOS_FAFL101C PE=4 SV=1
   85 : C5E4L2_ZYGRC        0.48  0.72    1  254  102  365  264    1   11  367  C5E4L2     ZYRO0E07018p OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0E07018g PE=4 SV=1
   86 : G2QRJ7_THITE        0.48  0.68    1  252   39  301  264    4   14  305  G2QRJ7     Putative uncharacterized protein OS=Thielavia terrestris (strain ATCC 38088 / NRRL 8126) GN=THITE_2073368 PE=4 SV=1
   87 : G8JP38_ERECY        0.48  0.72    1  254  101  364  264    1   11  366  G8JP38     Uncharacterized protein OS=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) GN=Ecym_2194 PE=4 SV=1
   88 : IPL1_CANGA          0.48  0.71    1  254   93  356  264    1   11  358  Q6FV07     Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1
   89 : J7S6M5_KAZNA        0.48  0.72    1  254  106  369  264    1   11  372  J7S6M5     Uncharacterized protein OS=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) GN=KNAG0D01090 PE=4 SV=1
   90 : C8ZIH0_YEAS8        0.47  0.70    1  254   97  360  264    1   11  367  C8ZIH0     Ipl1p OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1P2_0738g PE=4 SV=1
   91 : E7KVC2_YEASL        0.47  0.70    1  254   97  360  264    1   11  367  E7KVC2     Ipl1p OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=QA23_4768 PE=4 SV=1
   92 : E7M0Z0_YEASV        0.47  0.70    1  254   97  360  264    1   11  367  E7M0Z0     Ipl1p OS=Saccharomyces cerevisiae (strain VIN 13) GN=VIN13_4767 PE=4 SV=1
   93 : H2B183_KAZAF        0.47  0.72    1  254   95  358  264    1   11  360  H2B183     Uncharacterized protein OS=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) GN=KAFR0K00280 PE=4 SV=1
   94 : IPL1_KLULA          0.47  0.73    5  254   97  356  260    1   11  361  Q6CWQ4     Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1
   95 : J8PVQ6_SACAR        0.47  0.72    1  254   97  360  264    1   11  367  J8PVQ6     Ipl1p OS=Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644) GN=SU7_3482 PE=4 SV=1
   96 : H9IYL6_BOMMO        0.46  0.71    2  228   23  237  228    3   15  252  H9IYL6     Uncharacterized protein OS=Bombyx mori PE=4 SV=1
   97 : A4I3C6_LEIIN        0.42  0.68    1  251   24  283  260    1   10  301  A4I3C6     Uncharacterized protein OS=Leishmania infantum GN=LMAIRK PE=4 SV=1
   98 : E1Z5I2_CHLVA        0.40  0.62    5  250   20  274  260    3   20  296  E1Z5I2     Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_50248 PE=4 SV=1
   99 : S4RC79_PETMA        0.38  0.61    8  249   13  266  257    5   19  302  S4RC79     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
  100 : G0QKU2_ICHMG        0.37  0.63   10  251    3  256  255    4   15  276  G0QKU2     Protein kinase domain protein OS=Ichthyophthirius multifiliis (strain G5) GN=IMG5_021860 PE=4 SV=1
  101 : G0R4J4_ICHMG        0.37  0.64   32  254   26  277  253    4   32  297  G0R4J4     Protein kinase domain protein OS=Ichthyophthirius multifiliis (strain G5) GN=IMG5_193100 PE=4 SV=1
  102 : G0UYB1_TRYCI        0.36  0.62    5  250    7  261  256    3   12  273  G0UYB1     Putative serine/threonine kinase OS=Trypanosoma congolense (strain IL3000) GN=TCIL3000_10_11590 PE=4 SV=1
  103 : D8TK99_VOLCA        0.35  0.59    4  249    1  264  268    5   27  294  D8TK99     Serine/threonine protein kinase 15 (Fragment) OS=Volvox carteri GN=stpk15 PE=4 SV=1
  104 : H2T1P8_TAKRU        0.35  0.61    8  249   22  275  260    3   25  275  H2T1P8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101075949 PE=4 SV=1
  105 : A8IWA1_CHLRE        0.33  0.62    3  252    1  259  261    5   14  259  A8IWA1     Predicted protein (Fragment) OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_102238 PE=4 SV=1
  106 : B8C2P8_THAPS        0.33  0.56    8  253    2  263  269    7   31  263  B8C2P8     Predicted protein (Fragment) OS=Thalassiosira pseudonana GN=THAPSDRAFT_17024 PE=4 SV=1
  107 : A8IMW2_CHLRE        0.32  0.53    4  249    2  300  303    6   62  329  A8IMW2     Serine/threonine protein kinase 15 (Fragment) OS=Chlamydomonas reinhardtii GN=STPK15 PE=4 SV=1
  108 : A8IRV4_CHLRE        0.32  0.56   11  252    1  255  257    5   18  258  A8IRV4     Predicted protein (Fragment) OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_115581 PE=4 SV=1
  109 : C1EDI1_MICSR        0.32  0.57    7  249    1  271  275    5   37  280  C1EDI1     Predicted protein (Fragment) OS=Micromonas sp. (strain RCC299 / NOUM17) GN=MICPUN_69531 PE=4 SV=1
  110 : D2VAU0_NAEGR        0.32  0.53    5  250    1  260  273    3   41  267  D2VAU0     Predicted protein (Fragment) OS=Naegleria gruberi GN=NAEGRDRAFT_2797 PE=4 SV=1
  111 : D8TWR1_VOLCA        0.32  0.54    3  253   18  315  300    9   52  346  D8TWR1     Putative uncharacterized protein (Fragment) OS=Volvox carteri GN=VOLCADRAFT_117692 PE=4 SV=1
  112 : H2M9L8_ORYLA        0.32  0.59    8  249    5  258  262    6   29  262  H2M9L8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101160808 PE=4 SV=1
  113 : A8JC82_CHLRE        0.31  0.53    1  250   22  288  277    6   38  288  A8JC82     Predicted protein (Fragment) OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_59448 PE=4 SV=1
  114 : D2VEL5_NAEGR        0.31  0.51    5  249    6  283  284    6   46  296  D2VEL5     Predicted protein (Fragment) OS=Naegleria gruberi GN=NAEGRDRAFT_33426 PE=4 SV=1
  115 : F1DGA8_COFAR        0.30  0.50    8  251    9  270  278    7   51  281  F1DGA8     Phosphoenolpyruvate carboxylase kinase OS=Coffea arabica GN=MA29G21.15 PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1  126 A R              0   0  198   79   41  RKRRRRRKK RRNRRRRR RRRRRRRRRRKRKRRKKRKR NKRKKKK RK  KR KKRKKKKKKKK K R
     2  127 A Q        +     0   0  145   92   70  QQQQQQQQQRRRKSSSRRKRSPRKERKRRRRRRKKRKRQKDEEITNQKETK PE QQEKKKKVQKQ K E
     3  128 A W        -     0   0   76   96   25  WWWWWWWWWWWWWFLFLLWWFLLFFWFFLWWWWWVWLWWWWWFWWWWFWWF WW FFWFFFWFFFWWL W
     4  129 A A    >   -     0   0   34   99   73  AAAAATTCCSSSSTTTTTTTTTTTRQTTRTTVTCSTTVTATTHTQHSSSES TT HHHHHHCHHHHSHTN
     5  130 A L  T 3  S+     0   0   64  104   31  LLLLLLLLLLLLLIIIIILLIIIILLIVILLLLLILILILILILLLLILLL LL LLLLLLILLLLLLIL
     6  131 A E  T 3  S+     0   0  140  104   62  EEEEEEEEEEEEADHDEDSNDDDDSTDDDENSNDDNDSDTNDGSSGANRNK AH GGTGGGDGGGGSGNH
     7  132 A D  S <  S+     0   0   48  105   41  DDDDDDDDDNNNNDDDDDNDDDDDDDDDDDDDDDDDNDDDDDMNNMDDDNN DD MMDMMMDMMMMDMDG
     8  133 A F  E     -A   27   0A   6  111    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FFFFFFFFFFFFFFF
     9  134 A E  E     -A   26   0A 106  111   31  EEEEEDDEEDDDDEDEEEDDEEEDEDDEEDDEDEDDDEEDEEEDDEEEEDDEEE EEDEEEDEEEEEEED
    10  135 A I  E     +A   25   0A  80  112   23  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIVIIIIIIIIIVIIIIIIIIIIIM IIMIIIIIIIIIIIM
    11  136 A G  E     +     0   0A  39  113   33  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGSGGG
    12  137 A R  E     -     0   0A 150  113   45  RRRRRRRRRRRRRRRRRRKKRRRRRKRRRKKKKRRKRKKRKRKRRKGRKRRKKR RRRKKKKRRKKKKKR
    13  138 A P  E     -A   23   0A  60  113   64  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPMPPPPLPPPP PPPPPPLPPPPYAKP
    14  139 A L  E     +     0   0A  61  113    7  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLILLL
    15  140 A G  E     -A   22   0A  27  113   15  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGG
    16  141 A K  E     +A   21   0A 140  113   45  KKKKKKKKKKKKKKKKKKRRKKKKKRKKKRRRRKKRKRKKTKKRRKKKKRKKKK KKKKKKMKKKKEKKK
    17  142 A G        -     0   0   47  113    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGG
    18  143 A K  S    S+     0   0  183  113   35  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KKKKKKRKKKKRKKK
    19  144 A F  S    S-     0   0   55  113    5  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FFFFFFFFFFFFFFF
    20  145 A G        -     0   0    6  113   12  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGG
    21  146 A N  E     -AB  16  38A  29  113   71  NNNNNNNNNNNNNNNNNNSHNNNNNNNNNNNHHNNHNHNNRNRNNRRSRNSRRR RRRRRRHRRRRKRKR
    22  147 A V  E     -AB  15  37A  28  113    0  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVV
    23  148 A Y  E     -AB  13  36A  48  113   18  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYY
    24  149 A L  E     + B   0  35A  40  113   55  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLM LLMLLLLLLLLLLCM
    25  150 A A  E     -AB  10  34A   3  113   31  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAV AAVAAAAAAAAAAAV
    26  151 A R  E     -AB   9  33A  69  113   29  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRKRRRRRKRRRRRRRRKRR RRRRRRRRRRKRKRR
    27  152 A E  E  >> -AB   8  32A  14  113   58  EEEEEEEEEEEEEELELLEEEELDVEDLLEEEEEVEEEEEEEEEEEETEEHEET EETEEEEEEEEEEHT
    28  153 A K  T  45S+     0   0   92  113   49  KKKKKKKRRRQQKKRKKKKKKKKKKRKKQKKKKKKKKRKKKVKKKRAKAKRRVK RRKRRRKRRRKKRKK
    29  154 A Q  T  45S+     0   0  161  113   78  QQQQQQQEEQQQKKDKDESTKKEQGKQEERKRRKKRKRQKKDKEESKEKEDQKC TSCSSSKTTSSQSKC
    30  155 A S  T  45S-     0   0   82  113   49  SSSSSSSSSSSSSSSSSSSSSSSNISNSNSSSSSLSHSSSSSTTSSSGSSPSSe STpTTTSSNTSSTSe
    31  156 A K  T  <5 +     0   0  121  112   70  KKKKKKKKKKKKKHHRHHKNHHHKNKKHHKKNNKQNQSKKKKGKQGKHKQEGKr NGqGGGQGGGGGGGn
    32  157 A F  E   < -B   27   0A  93  115   54  FFFFFFFFFFFFFFFFFFFHFFFFFFFFFYYQHFSHFQFFFFFFFFYFYFYFYYYFFYFFFFFFFFYFFY
    33  158 A I  E     +B   26   0A  70  115   44  IIIIIIIIIIIIIIIIIIIIIIIIIIIILVVIIIIIVIIIIVIVVVIHIVIVIIIIVIVVVIIIVVVIII
    34  159 A L  E     -B   25   0A   4  115   60  LLLLLLLLLLLLVVVVVVVVVVVMVVMVVVVVVVVVVVVVVVVIVCVAVVVCVLVCCVCCCVCCCCVCCL
    35  160 A A  E     -BC  24  85A   9  115    2  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
    36  161 A L  E     -BC  23  84A   1  115   21  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLILLLLLLLLLLLLLLLLLLLLLL
    37  162 A K  E     -BC  22  83A  29  115    0  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    38  163 A V  E     -BC  21  82A  12  115   34  VVVVVVVVVVVVVVVVVVVVVVVVIVVVVVVVVVVVVVVVLVTVVVVVVVIVVTVVVCVVVVVVVVVVIT
    39  164 A L  E     - C   0  81A  19  115   23  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILILLLILILLLLLLLLLLLILML
    40  165 A F  E >>  - C   0  80A  53  115   88  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFDYHFFHFFFFFHFYFYHYHHHFHHHHFHDY
    41  166 A K  H 3> S+     0   0   48  115   10  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    42  167 A A  H 3> S+     0   0   54  115   71  ATAATATSTKKKSSSSSSSSSSSSSNSSSNNSSSSSSSINKESKRHESERSSESESNSSSSYNNSSASKS
    43  168 A Q  H <> S+     0   0   72  115   53  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQDQQEQQEQQQQQEQEQEEEEEEQEEEEKEEE
    44  169 A L  H  X>S+     0   0    7  115   25  LLLLLLLLLLLLLILIIILLIIILLLLIILLLLLMLMLLILLLVILILIILLIIILIILLLLLLLLLLLI
    45  170 A E  H  <5S+     0   0   91  115   82  EEEEEEEEEEEEQEEEEELQEEEEIQEEEQQKQQEKEKQKEAVHDVEIEGKQEVEQQVVVVQQQVQQQII
    46  171 A K  H  <5S+     0   0  192  115   60  KKKKKKKKKKKKKKKKKKKQKKKKKQKKKQQQQKKQKQHEKKQAEKKSKESQKQKQKQQQQTQHQQKQNQ
    47  172 A A  H  <5S-     0   0   54  115   87  AAAAAAAAAAAAAEEEEESSEEEENSEEESSSSHESESSFEHSQSGYGYSAGYSYgGCGGGHGGGGYGFT
    48  173 A G  T ><5S+     0   0   32  106   71  GGGGGGGGGGGGKGGGGGNQGGGGSNGGGQQQQNGQGQNNKCKGKGKGKNSKKRRgKQKKKNRGKKHGKK
    49  174 A V  T 3>< +     0   0   35  110   41  VVVVVVVVVVVVVVMVMLVVVVLVVVVLLVVVVVVVVVVNVVIIVVIVIVVVIVIVVVVVVIVVVVFVVV
    50  175 A E  H 3> S+     0   0   84  110   50  EEEEEEEEEEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEAQEEEEHEQEEEHEHEEEEEEEEEEEHQEE
    51  176 A H  H <> S+     0   0   62  110   62  HHHHHHHHHHHHHHHHHHHHHHHHHHHPHHHHHHHHHHHHHQKHHKHHHHHKHKHKKKKKKHKRKKAKKK
    52  177 A Q  H  > S+     0   0   67  113   33  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQ
    53  178 A L  H  X S+     0   0   19  115   28  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLVVVLLLLVLVLILVVILLLLVVLVLVFV
    54  179 A R  H  X S+     0   0  136  115   52  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRERRLRRRKRRRRRRRRRRRRRRR
    55  180 A R  H  X S+     0   0  101  115   29  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
    56  181 A E  H  X S+     0   0   15  115    4  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
    57  182 A V  H  X S+     0   0    6  115   29  VVVVVVVVVVVVIIIIIIIVIIIIIIIIIIIVVVIVIVIVIIIIIIMIMIIIMIMIIIIIIIIIIIIIVI
    58  183 A E  H  X S+     0   0   73  115   27  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
    59  184 A I  H  < S+     0   0   35  115   11  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
    60  185 A Q  H >< S+     0   0    2  115   28  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
    61  186 A S  H 3< S+     0   0   25  115   63  SSSSSSSSSSSSSASAAASSAAASASSAASSSSSASSSATSYSSSSTSTSGSTQTSSQSSSSSSSSQSSQ
    62  187 A H  T 3< S+     0   0  132  115   71  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHNHHNSHSHHNSNNNNNNNNHNNNHSNSN
    63  188 A L    <   -     0   0   10  115   19  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVL
    64  189 A R        +     0   0  141  115   58  RRRRRRRRRRRRRQQQQQRRQQQRRRRQQRRRRQKRKRRRRRRRRRSHRRRASRCRRRRRRRRRRTDRKR
    65  190 A H    >   -     0   0   25  115    8  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
    66  191 A P  T 3  S+     0   0   83  115   23  PPPPPPPPPPPPDPPPPPPPPPPPPPPPPPPPPKPPPPPPKPKPPPPPPPPPPPPPPPPPPPPPPPPPVP
    67  192 A N  T 3  S+     0   0   17  115   34  NNNNNNNNNNNNHNNNNNHHNNNNHNNNNNNNNNNNNNNNNNNNHNNNNHHNNNNNNNNNNNNNNNNNNN
    68  193 A I  B <  S-f  147   0B   3  115   17  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIVVIIVIIIIIIIIVVCV
    69  194 A L        -     0   0    6  115   34  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLIL
    70  195 A R        -     0   0   56  116   47  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRGRRKQRRRRRQQRKRRKR
    71  196 A L  B     -D   85   0A   2  116   14  LLLLLLLLLLLLLLLLLLLLLLLMMLMLLLLLLLFLFLLMLLLMLLLLLLMLLLLLLLLLLLLLLLLLLL
    72  197 A Y        -     0   0   90  116   20  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFYYFYYYYYYYFYYYFFYYYYFYYYYYYYYYFYYYFFYYY
    73  198 A G        -     0   0   12  116   53  GGGGGGGGGGGGGNNNNNGGNNNNNGNNNGGGGGNGNGGGGGGGAGGTGATGGGGGGGGGGGGGGGTGGG
    74  199 A Y        +     0   0  105  116   56  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFYYYHYYHWYWYYHWYWHHYHHHYHHHHWHHY
    75  200 A F  E     -E   82   0A  11  116    4  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
    76  201 A H  E     -E   81   0A 116  116   57  HHHHHHHHHHHHYYHYHHHYYYHHYYHHHYYYYHHYHYYHYHHHHHDWHHWHHHHHHHHHHYHHHHHHHH
    77  202 A D        -     0   0   51  116   14  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
    78  203 A A  S    S+     0   0   87  116   69  AAAAAAAAAPLLDRERAAEQRRAREHRASQQQQERQRQEEESEEDSDADDESDEDSSTSSSESSSAESTE
    79  204 A T  S    S-     0   0   79  116   67  TTTTTTTSASSSTRRRRRTKRRRKKTKRRNSTKHKKKTESKAKTVKEKEVKKDKEKKKKKKKKKKKEKDK
    80  205 A R  E     -C   40   0A  79  116   48  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRKRKRRRRRRKRRKRRRRRRRRRRRRRRRRRRR
    81  206 A V  E     -CE  39  76A  18  116   22  VVVVVVVVVVVVVIVIIVVVIIVIIVIVVVVVVVVVVVVVVVIIIVIIIIIIIIIIVIVVVVVVVIVIVI
    82  207 A Y  E     -CE  38  75A   4  116    9  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFYYYYYYYYFFYFYYFFFFFFFFFFFFFFFVFYF
    83  208 A L  E     -C   37   0A   1  116    6  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    84  209 A I  E     -C   36   0A   9  116   30  IIIIIIIIIIIIIIIIIIIIIIIMIIMIIIIIIIVIMIIIIIIIIIIVIIVIIMIIIMIIIIIIIIVIIM
    85  210 A L  E     -CD  35  71A  12  116   23  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILILLLLLL
    86  211 A E        -     0   0   32  116    3  EEEEEEEDDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
    87  212 A Y        -     0   0   60  116   23  YYYYYYYYYFFFYYYYYYYYYYYFYYFYYYYYYYYYYYYYYFFYYFYYYYYFYFYFFFFFFFFFFFYFFF
    88  213 A A    >   -     0   0   12  116   40  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
    89  214 A P  T 3  S+     0   0   60  116   72  PPPPPPPPPPPPAPPPPPPPPPPPAAPPPPAAAAPAPAAPPSGPPGHPHPEGHGQGGGGGGKGGGGAGIA
    90  215 A L  T 3  S-     0   0   99  115   82  LLLLLLLGGKKKRRRRRRRKRRRRGRRRRRKKKKRKRKRKGRRGQNGGGQKKGKGKKKNNNGKKNKRKHK
    91  216 A G    <   -     0   0   28  115    6  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    92  217 A T  B  >  -G  138   0B  37  115   29  TAAAATTEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEAECETTEEEETEEEEEEEEEEEEEEEEEEEE
    93  218 A V  H  > S+     0   0    0  115   21  VVVVVVVLLLLLLLLLLLMLLLLLLLLLLLLLLLLLMLLVMLLLLLLMLLLLLLLLLLLLLCLLLLLLLL
    94  219 A Y  H  > S+     0   0   85  115   15  YYYYYYYFFYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFFYYYYFYYYYYYYYYYYFYYYYYYYY
    95  220 A R  H  > S+     0   0  180  115   52  RRRRrRRRRGSSkKKKKKKKKKKKKKKKKKKKKKKKKKKsHAQsnRGKGnKKGKKKKKKKKKKKKKKKKK
    96  221 A E  H  X S+     0   0   34  106   76  EEEEeEEEEEEEqEEEEEEEEEEEEEEEEEEEEIEEEEEmFEHqqHVQLqRHLQEHHQHHHEHHHHVHLQ
    97  222 A L  H  X S+     0   0   12  107   35  LLLLLLLLLLLLALLLLLLLLLLLLLLLLLLLLLLLLLLKLLLTALLLLALLLLLLLLLLLLLLLLLLLL
    98  223 A Q  H  < S+     0   0  123  107   64  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTQQQQQTVLQQRQQRKTRQQRKSKRRSRRRQRRRRRRKS
    99  224 A K  H  < S+     0   0  170  108   62  KKKKKKKKKRRRKKKKKKKKKKKKKRKKKRRRKERKKRAPKKRPPKKIKPAKKKKRRKKKKKKRKRAKKK
   100  225 A L  H  < S-     0   0   78  108   94  LLLLLLLCVCCCANSSCSQCSSSHCAHSSCCCCRCCYCCNCCAGLENKTMKENYKEEQEEEVEEEEAEKH
   101  226 A S  S  < S+     0   0   82  108   68  SSSSSSSTTGGGGRHRHEGKRREGGGGHHKKKKSGKGKTKTKKNKNGENKGQGGGNTGNNNGSNNQGHGG
   102  227 A K  S    S-     0   0   89  111   74  KKKKKKKRRSCCHTTTTKKYTTKRHSRTRCCHYRKYRHHRRRRKRRHKYRRRHHFRKRRRRSRRRRRRKC
   103  228 A F        -     0   0    4  113   11  FFFFFFFFFFFFFFIFLLFFFFLFFFFLLFFFFFFFFFFFFFFFFFLFLFFFLFLFFFFFFFFFFFFFLF
   104  229 A D     >  -     0   0   86  113   69  DDDDDDDDDPPPDDDDDDSSDDDDDDDDDNNSSDDSDSDPSESPDPTSSDDPTSCPPTPPPNPPPATPDT
   105  230 A E  H  > S+     0   0   52  113   19  EEEEEEEDEEEEEEEQEEEEEEEEEEEEEEEEEEDEDEEEEPEEEEEEEEDEEEEEEEEEEEEEEEEEEE
   106  231 A Q  H  > S+     0   0   77  113   84  QQQQQQQQQDAADQQQQQDRQQQQERQQQKKRRRQRQRREEREKRWQPERRWKRKWWKWWWMWWWPRWVK
   107  232 A R  H  > S+     0   0   82  114   78  RRRRRRRRKRRRRRRRRRVRRRRRRRRRRRRRRTRRRRRVQRVQQKQIQQTKQRQKKRKKKTKKKKTKTR
   108  233 A T  H  X S+     0   0    0  114   54  TTTTTTTSSSSSSTTTTTTATTTSTTSTTAASASTATSSCTAACSAAAASAAASAAASAAAASAAASSSS
   109  234 A A  H  X S+     0   0    0  116   45  AAAAAAAAAAAAAAAAAAAAAAAAAAAVAAAAAAAAAAAASASAAAAAAAGAAAAAASAAAAASAAAASS
   110  235 A T  H  X S+     0   0   24  116   81  TTTTTTTMLTTTVTTTTTTTTTTTKTTTtTTTTDTTTTSNKAKITQTKTTTQTRTQHRQQQTQQQQTQRR
   111  236 A Y  H  X S+     0   0    5  115   33  YYYYYYYYYYYYYIIIIIYYIIIFLYFIiYYYYYYYYYYYFYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   112  237 A I  H  X S+     0   0    1  115   45  IIIIIIIIIIIIIMMMMIIVMMIMMVMMMIIIVIMVMIIVMVIIIIIMIIIIIIIIIIIIITIIIVVIII
   113  238 A T  H  X S+     0   0   27  115   88  TTTTTTTKKMMMYEEEEEAAEEEEFAEEEAAAAFEAEALAYCFNRAAYLQYAAYAAAYAAALAAAAAAYD
   114  239 A E  H  X S+     0   0   30  115   51  EEEEEEEQQEEEQEEEEEESEEEEQSEEESSSSQESESSQQQQMSQSESAQQSQSQQQQQQQQQQQSQQQ
   115  240 A L  H  X S+     0   0    0  115   33  LLLLLLLLLLLLLLLLLLLLLLLLMLLVLLLLLLILILLIMLMLLMLILLMMLMLMMMMMMIMMMMLMIM
   116  241 A A  H  X S+     0   0    0  115   51  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATSASAAAAAAVCASATCAASATAAAAAAAAAAAAAAA
   117  242 A N  H  X S+     0   0   83  115   71  NNNDNNNEEDDDKDHDDDDRDDDDDKDDDRRRRNDRDRRDRSNSSAEDQSDGQDNSADAAADSSAAGADD
   118  243 A A  H  X S+     0   0    0  116    8  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   119  244 A L  H  X S+     0   0    1  116   14  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLLLLLLL
   120  245 A S  H >X S+     0   0   11  116   87  SSSSSLSLLNNNLMAMTTNITLTQSTQIILIIIKMIMIHLKESILKASALHKAISHKSKKKRKRKKAKSI
   121  246 A Y  H 3X S+     0   0   48  116   11  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   122  247 A C  H 3<>S+     0   0    1  116   78  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCLCCCCCLCCCCLLLLCCCLCLCLCLLLLLLCLLLLCLLL
   123  248 A H  H X<5S+     0   0   15  116    3  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
   124  249 A S  H 3<5S+     0   0   87  116   75  SSSSSSSSSSSSEGQKGDSGAGDEDAEEEEEGGREGEGIKAQKEEKGREESKGSKRKSKKKSRRKKKKDG
   125  250 A K  T 3<5S-     0   0  107  116   49  KKKKKKKKKKKKKKNKKKKKKRKRKKRKKKKKKKKKRKHRKKKRRKKKKRKKKKKKKKKKKKKKKKKKRK
   126  251 A R  T < 5S+     0   0  231  116   71  RRRRRRRKNKKKKKKKKKQHKKKKKHKKKHHHHSKHKHHKHRHNDHCNNDNNCHDHHHHHHHHHHHQHHH
   127  252 A V      < -     0   0   11  116   16  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVIVVVVIVIVVVVVVIIIVVVVVVVIV
   128  253 A I        -     0   0   15  116   25  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIMIIIIIMIIIIMIMMMIIIMMIIII
   129  254 A H        +     0   0    0  116    1  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
   130  255 A R        +     0   0   50  116    0  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   131  256 A D        +     0   0   32  116    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   132  257 A I        +     0   0    1  116   16  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
   133  258 A K    >   -     0   0   23  116    3  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
   134  259 A P  G >  S+     0   0    0  116   15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   135  260 A E  G 3  S+     0   0  114  116   10  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
   136  261 A N  G <  S+     0   0   10  116    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   137  262 A L  E <   - H   0 147B   0  116   24  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVILLILLLLIILLLIILIIILIIIILIIL
   138  263 A L  E     -GH  92 146B  33  116    3  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   139  264 A L  E     - H   0 145B   5  116   28  LLLLLLLLLLLLLLLLLLMILLLMLLMLLIVVVLLVLILLLILLLVLILLIVLLLVVLVVVIMVVMIVLL
   140  265 A G    >   -     0   0    4  116   36  GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGDNGGGGDGDGGGDGDGGGGGGGGGGGDGGG
   141  266 A S  T 3  S+     0   0  108  114   88  SSSSSSPSAAAALLLLFFLALLFYMLYLLFIAALYAYALAGGIHHIHAHHSIHIHIIIIIIIIIIIIIFI
   142  267 A A  T 3  S-     0   0   84  116   73  AAAAAANNNTNNKKRQRRRQRQRKFNKRRKQQQERQRQGNNKDGKHENEKDHENEHHNHHHNHHHHEHDN
   143  268 A G    <   +     0   0   24  116   37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGNG
   144  269 A E        -     0   0   42  116   63  EEEEEEEEEEEEDEEEEEEEEEEEEDEEEEEEETEEEEEEEDEDVERERVEEREREEEEEEEEEEERETE
   145  270 A L  E     - H   0 139B   0  116   28  LLLLLLLLLLLLLLVLVVLLLLVLLLLVVLLILLLLLILILLILLILLLLLILLLILLIIIIIIIILIVL
   146  271 A K  E     - H   0 138B  14  116    2  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
   147  272 A I  E     -fH  68 137B   0  116   23  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIILIIIIIIIIIIIIIIIIIIIILIIIIII
   148  273 A A        +     0   0   12  116   43  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAASAAASAASAGAASSAGASAGSSSASSSSASSG
   149  274 A D        +     0   0   63  116    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   150  275 A F        +     0   0    2  116    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   151  276 A G  S    S+     0   0   18  116    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   152  277 A W  S    S+     0   0  115  116   26  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   153  278 A S              0   0    4  116   23  sssssssssssssssssssssssssssssssssassssssasssssssssssssssssssssSsssasss
   154  279 A V              0   0  104  114   42  lllllllllllllmmmmmlmmmmmmlmammmmmlmmmmlllilllmmmmlmmmlmlmlmmmf.mmmlmml
   155      ! !              0   0    0    0    0  
   156  290 A C              0   0  176  114   20  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC.CCCCCCC
   157  291 A G        -     0   0   57  115    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGG
   158  292 A T    >   -     0   0   79  115    7  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTHTTTTTTT
   159  293 A L  G >   +     0   0   12  115   44  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLMLVLLLLLLLLLLLLALLLILLL
   160  294 A D  G 3  S+     0   0   23  115   15  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEPDDDDDDD
   161  295 A Y  G <  S+     0   0   19  115    2  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYNYYYYYYY
   162  296 A L    <   -     0   0   31  115   14  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLNLLLLLLL
   163  297 A P     >  -     0   0    0  116   45  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSPPAPAPPPAPAPPPPPPPPPPPAPPA
   164  298 A P  H  > S+     0   0    1  116    3  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   165  299 A E  H  4 S+     0   0    1  116    3  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQEEEEEEE
   166  300 A M  H >4 S+     0   0   36  116   27  MMMMMMMMMMMMMMMMMMMMMMMMMMMIMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMVHMMMMMMM
   167  301 A I  H 3< S+     0   0   36  116   33  IIIIIIIIIIIIIIIIIIVVIIIIVVIIIVVVVIIVIVVIIVVVVLVVVVIIVVVILVLLLVHILLVLVV
   168  302 A E  T 3< S-     0   0   61  116   69  EEEEEEEEEEEEEEEEEEEEEEEEREEEEEEEEREEEEETEMEQQIESEQNKEEEKQEKKKEPKRREVEE
   169  303 A G    <   +     0   0   60  116   65  GGGGGGGGGGGGGGQGGGASGGGGGGGRGNNKSQGSGKGGKNGGGPNGNGGPNGNSSGPPPNGPPGKRAS
   170  304 A R        -     0   0  112  116   72  RRRRRRRRRKKKKRRRRRKVRFRKENKRRKKTVEHVHTKKKKKQKgRQRKHgRKKgnRgggKsgggKgRR
   171  305 A M        -     0   0  179  115   89  MMMMMMMMMTTTTTTTTTDETTTTKYTTTEEEEPAETEVAAMEPPyDAPPSfDEAwyPyyyGytyfAyEE
   172  306 A H        -     0   0   58  115   44  HHHHHHHHHHHHHHYHYYHHHHYHHHHYYHHHHHHHHHHHHHHHHYHHHHHYHHHYYHYYYYYYYYHYHH
   173  307 A D        -     0   0   63  115   47  DDDDDDDDDDDDDNSNDDDDNNDDDDDNDDDDDDSDSDTDNDTTTDDSDTSNDSDNNTNNNDNNNSDSNS
   174  308 A E  S >  S+     0   0   60  115   77  EEEEEEEEEEEEEEEEEEAAEEEEDAEEETAYAAEAEYTEAAEKKEYAYKKEYEYEEEEEEQEEEEHDYE
   175  309 A K  T >> S+     0   0   28  115   70  KKKKKKKTKKKKKKMKKKNSKKKKKAKKRAGHSTKSKNAKTMKNNKAAANHKARAKKKKKKTKKKKAKKK
   176  310 A V  H 3> S+     0   0    0  116   18  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVIIIAVVVVVVVV
   177  311 A D  H <> S+     0   0    0  116    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   178  312 A L  H <> S+     0   0    1  116   69  LLLLLLLLLLLLLLLLLLLILLLLLVLLLIIIILLILINLLNLLLLNLNLILNYNLLYLLLVLLLLNLVY
   179  313 A W  H  X S+     0   0    0  116    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   180  314 A S  H  X S+     0   0    0  116   47  SSSSSSSSSSSSSCCCCCTSCCCCSSCSCSSSSSCSCSSACSSSSSTATSASTATSSASSSSSSSSTSAA
   181  315 A L  H  X S+     0   0    0  116   26  LLLLLLLLLLLLLIIIIILLIIIALLAIILLLLLILILLLILLLLLLILLLLLLLLLLLLLLLLLLLLLL
   182  316 A G  H  X S+     0   0    0  116    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   183  317 A V  H  X S+     0   0    0  116   19  VVVVVVVVVVVVVVVVVVIVVVVVVVVVVVVIVVVVVIVVVVVVVVIVIVIVIVIVVVVVVIVVVVIVIV
   184  318 A L  H  X S+     0   0    0  116   17  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   185  319 A C  H  X S+     0   0    0  116   73  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCTCCCCTCCLTACTCCCCCTCTCTMMTTTITTTTCTMT
   186  320 A Y  H  X>S+     0   0    1  116    1  YYYYYYYYYYYYYYYYYYYYYYYFYYFYYYYYYYYFYYYYYYYYYYYFYFYYYYYYYFYYYYYYYYYYYY
   187  321 A E  H  X5S+     0   0   11  116   15  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
   188  322 A F  H  <5S+     0   0    0  116   18  FFFFFFFFFFFFFLLLLLFFLLLFLFFLLFFFFFCFCFFFFFFLLFFFFLFFFFFFFFFFFFFFFFFFFF
   189  323 A L  H  <5S+     0   0   12  116    9  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   190  324 A V  H  <5S-     0   0   23  116   52  VVVVVVVVVVVVVVVVVVVYVVVVVYVVVYYYYFVYVYFSTVVVVVYVYVVVYVYVVVVVVVVVVVYVVI
   191  325 A G  S  <   -     0   0    8  116   29  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAAAPPPAPAPPPAAPAAASAAAAPAPP
   194  328 A P  T 3  S+     0   0    0  116    1  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   195  329 A F  T 3  S+     0   0    0  116    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   196  330 A E    <   +     0   0   81  116   46  EEEEEEEEEEEEEEEEEEEEEEEDEEDEEEEEEEEEEEEEFEEHFEEEEYEEEEEEEEEEEAEEEEEEEE
   197  331 A A        -     0   0   22  115   63  AAAAAAATTATTSSSSSSTASSSSSASSSAAAAATATAASAADASDARASS.ADADDDDDDSDDDDADED
   198  332 A N  S    S+     0   0  157  116   73  NNDSNNHDDKKKQASAVAQKAAAPKAPPPKKKKEAKAKPPQKMTKTEQEKEDEKETTLTTTDTTTTDTER
   199  333 A T  S  > S-     0   0   62  116   72  TTTTTTTTTTSSGSSSSSSESSSSTGSSSKEEEGSESEGDDEsGTPSHSNDTSnSPVsPPPEPPPQEPFs
   200  334 A Y  H  > S+     0   0  127  102   82  YYYYYYHHHHHHNHYHHHNHHHHHHHHHHHHHHHHHHHHHDQhFF.QQQYSPQvQ..q...E....Q.Km
   201  335 A Q  H >> S+     0   0  131  112   79  QQQQQQQQQEEETNSNTSKSNNSTNSTITSSSSTSSTSQNKKSDDFKATDTVKNKIVRVVVQVVVVDVSK
   202  336 A E  H 3> S+     0   0   72  114   72  EEEEEEEEEEEEEEEEEEDDEEEEEEEEEDDEDNEDEEDDSEADELDEDEKMDNDMMAMMMRMMMMDMSN
   203  337 A T  H 3X S+     0   0   11  115   28  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTITTTTTTTT
   204  338 A Y  H S+     0   0  110  116   61  KKRKKRRRRRRRRRRRRRRRRRRRKKRQRRKRRKKRKRKRRAKNKRKAKKERKRRKRTRRRNRRRRRRKR
   206  340 A R  I  <>S+     0   0   53  116   48  RRRRRRRRRRKKKRRRRRRRRRRRLRRRRRRRRRRRRRRKNKRKKRRARKARRRRRRKRRRNRRRKRRRR
   207  341 A I  I  <5S+     0   0    2  115    8  IIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIVIIIIIIIIIIIIIIIIIII
   208  342 A S  I  <5S+     0   0   22  115   82  SSSSSSSSSSSSTVLVLLT VVLVALVLLIVVVTMVTVVSVMAMLALKILKALAMAASAAAKAAAAVTAA
   209  343 A R  I  <5S-     0   0  157  115   62  RRRRRRRKKRRRKKKKKKT KKKNNRNKKKKKQSKQKKGRAAKKKRKEKKKRKRKRRARRRERRRRRRQK
   210  344 A V  I   < +     0   0   34  115   69  VVVVVVVVVVVVVVVVVVL VVVVVVVVVIVVVVVVVVVAVCVVGGIAVVLAIVVACVGGGNAAGGVAVV
   211  345 A E      < +     0   0   84  114   51  EEEEEEEEEEEEED DDDQ DDDDKDDDDDDDDDDDDDDIRVDRDDDKDDREDDDDESEEEEDDEDDDDD
   212  346 A F        -     0   0   41  114   47  FFFFFFFFFYYYFL LVVY LLVLYLLVVLLLLLLLLLLFYILYYMLFLYYMLLLMMFMMMVMMMYLMLL
   213  347 A T        -     0   0  108  114   79  TTTTTTTQQTTTTK KKRS KKRKTRKRRKKKKRKKNKRGSRKDKTSTNKVTTKTTTQKKKHTTKTATQH
   214  348 A F        -     0   0   42  114   41  FFFFFFFYYYYYFF FFFF FFFFFFFLFFFFFFFFLFFVFYIVLIFYFLFIFFFIIIVVVYVIVVFIVF
   215  349 A P    >   -     0   0   31  114   11  PPPPPPPPPpppPP PPPP PPPPPpPPPpppppPpAppPPpPPPPpPpPPPpPpPPPPPPPPPPPpPPP
   216  350 A D  T 3  S+     0   0  165  113   74  DDDDDDDPStaaKA PVLP PALPCpPPSppppiKpKppPEiSPESpEpEHSpSpEGSSSSSSSSNpSSP
   217  351 A F  T 3  S+     0   0  108  114   91  FFCFFFFYYNNNHS STSH SSSFHEFSSVFFIPTVVFDYYSFEHFNYQHYFNYPWFHFFFAFFFFCFHT
   218  352 A V    <   -     0   0    8  114   31  VVVVAVVVVIIIVV VMMV VVMLVRLLMVVVVVVVIVVFVVVMVVVVTIVVVLVVVIVVVIVVVVVVVL
   219  353 A T     >  -     0   0   51  114   36  TPPPPTTSSSSSSP PSPS PPPSSSSPPSSSSSSSSSSSGPPSSSSKSSTSSSSSSSSSSSSSSSSSSS
   220  354 A E  H  > S+     0   0  138  114   79  EEEEEEEEEDAAET VLLE LTLDEDDLSDDPSADSDPDADDPRKSERAKGPAPAKSSAAATPPPPSPPA
   221  355 A G  H  > S+     0   0   30  114   50  GGGGGGGEGEGGGG GGGG GGGGGGGGGAAASEGAGAEEEGDPAEEGEAGEEEEEEDEEEDEEEEEEEE
   222  356 A A  H  > S+     0   0    0  114   22  AAAAAAAAAAAAAA AAAA AAASAASAAAAAAAAAGAAAAAAAAAAPAAAAAVAAAAAAAAAGAAAAAV
   223  357 A R  H  X S+     0   0   60  114   47  RRRRRKRRRKKKRQ QRRR QQQKKKKRQKKKKKKKRKKLKKRAARKRKSRRKKKKKARRRKKRKRKRKK
   224  358 A D  H  X S+     0   0   66  114   23  DDDDDDDDDDDDDD DDDD DDDDDDDDDDDDDDDDDDADDDDHHDNDHHDDNDNDDDDDDDDDDDDDDD
   225  359 A L  H >X S+     0   0    2  114    7  LLLLLFLLLLLLLL LLLL LLLLLLLLLLLLLFLLLLFLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLL
   226  360 A I  H >X S+     0   0    2  114    8  IIIIIIIVVVVVII IIII IIIIIIIIIIIIIVIIIIIIVIIIIIIIIIIIIIIIIIIIIIIIIIIIII
   227  361 A S  H 3< S+     0   0   44  114   75  SSSSSSSSSSAACS SSSR YSSSTKSSSRRSSKTSSSRKRSSSSKSGTSTKSATKKRKKKSKKKKSKQG
   228  362 A R  H << S+     0   0  120  114   48  RRRRRRRKKRRRKK KRRR KKKKKQKRKQQQQKKQKQKRKKRRKRQKRKKKQKRKRKKKKKKRKRKRKK
   229  363 A L  H << S+     0   0    1  112   10  LLLLLLLLLLLLLL LLLL LLLLLLLLLILMMLLVLMLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLL
   230  364 A L  S  < S+     0   0    4  111    3  LLLLLLLLLLLLLL LLLL LLLLLLLLLLLLLLLFLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLL
   231  365 A K        -     0   0   89  110   79  KKKKKKKKKKKKKR KRRK KKRRVVRRRVVVVRR RVIVVRQVVVVQVVV VQVVVQVVVIVVVVVVRQ
   232  366 A H  S    S+     0   0   64  110   89  HHHHHHHHHHHHHH HYYL HHYYKKYYYKKKKRH HKKVKKHKLLKVKLL KHKLLHLLLSLLLLKLYY
   233  367 A N  S >  S-     0   0   53  110   48  NNNNNNNNNNNNNN NQQE NKQHDDHQQDDNDRC NNDKEENQNDDDDNE DDDDDDDDDDDDDDDDTE
   234  368 A P  G >  S+     0   0   25  110   28  PPPPPPSPPPPPPP PPPP PAPPPPPPPSSSSPP PSAPPPPPPPPPSPP PPSPPPPPPPPPPPSPPP
   235  369 A S  G 3  S+     0   0  105  110   75  SSSSSSSNNMMMSS SSLR SSLPAKPSFTSASST IASESSEELSSKSQT SSSEEEEEEHEEEESEEE
   236  370 A Q  G <  S+     0   0   95  110   62  QHQQHHQHHHQQHE DEEH EEEQAEQEEQQQQED DHQHNEKQHKKKKHQ KKKKKRQQQQKKKKKKKK
   237  371 A R    <   -     0   0   10  110    0  RRRRRRRRRRRRRR RRRR RRRRRRRRRRRRRRR RRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRR
   238  372 A P        -     0   0   18  109   52  PPPPPPLLL LLLL LLLL LLLLLLLLLLLLLML LLLLILMMLILLLLL LLLLILIIIIIIIILMIL
   239  373 A M    >>  -     0   0   54  109   62  MTTTTTTPS PPSP PPPP PSPPPPPPAPPPPSS PPPDTPSPPPSSSPP SASPPPPPPSPPPACTNA
   240  374 A L  H 3> S+     0   0    0  109   26  LLLLLLLLL IILL LLLL LLLLLLLLLLLLLLL LLLLLLLLLLLLLLL ILLLLLLLLLLLLLLILL
   241  375 A R  H 3> S+     0   0   99  109   74  RKKKKAAKK QQEA AAAE ADAKRGKAAQHHHAQ QHTHETEEDDEDQDD DTQEETDDDKDDEEEDKT
   242  376 A E  H X> S+     0   0  102  109   53  EEEEEEEGG GGGQ QQQS QQQGDQGQQKKKKDS NKELQDQHQEKGRQK KEKEQQEEEDQQDDDEDE
   243  377 A V  H 3< S+     0   0    3  109   26  VVVVVVVVV VVVV VIIV VVIVVVVIVIVVLAV VVVVVVVVVVIVIVV IVIVVVVVVVVVVVIAIV
   244  378 A L  H 3< S+     0   0   40  109   72  LLLLLLLLL LLIS SLLL SALMMLMLLLLLLLI ILELLLMAMQMMMMM MILQEAQQQIQQQEMQER
   245  379 A E  H << S+     0   0  134  109   79  EEEEEEEEE AAAA ARKV AAKEEQEEEEQEEQD DENKKTRIVKQNEVE QRESKTQQQNTTQCKQTK
   246  380 A H  S  < S-     0   0   20  109    3  HHHHHHHHH HHHH HHHH HHHHHHHHHHHHHHH HHDHHHHHHHHHHHH HHHHHHHHHHHHHHHHHH
   247  381 A P  S >> S+     0   0   85  109   27  PPPPPPPPP PPAP PPPP PPPPPPPPPPPPPPS PPPPPAPPPPPSPPF PPPPPPPPPPPPPPPPPP
   248  382 A W  T 34 S+     0   0   14  109    2  WWWWWWWWW WWWW WWWW WWWWWWWWWWWWWWW WWWWFWWWWWWWWWW WWWWWWWWWWWWWWWWWW
   249  383 A I  T 34 S+     0   0    3  109   25  IIIVIVVII VVIV VVVI VVVVIIVVVIIIIIV VIIIIIIIIIIIIIV ILIIIVIIIIIIIIIIII
   250  384 A T  T <4 S+     0   0   76  100   79  TTITTKKII VVQQ RQQK RRQKRQKRQVFVVTR KVRLI VKLIVLVLK VIIIIIIIIQVLIVKLVV
   251  385 A A  S  < S+     0   0   82   95   69  AAAAAAAKD EEEA AAAA TAAAQAAAAQQQQKT AQAKT KLAKKAKAG KKKKK KKKKKKKKKKKK
   252  386 A N  S    S+     0   0   42   84   46  NNNNNKNNN SSKN HHHN HHHN HNHHNNNNNN NNHH   HHHN NHH NHNHH HHHNHHHHNHNY
   253  387 A S              0   0   20   64   72  SSSSSSSSS AAIS SSSA SSSS ASSS AAAVS SAAV   AT A AT  ARA      A    A KR
   254  388 A S              0   0  130   27   53  S  S SS A TTS                    P     S             A              PP
## ALIGNMENTS   71 -  115
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1  126 A R              0   0  198   79   41    K    S  KS QKQQNKKKKK K S               Q  
     2  127 A Q        +     0   0  145   92   70  EEK KRDE EAKKNSRNKSSSSQ LKE               S  
     3  128 A W        -     0   0   76   96   25  WWFWWWWW WWWWLLLLLFLLLT LWW       W     W W  
     4  129 A A    >   -     0   0   34   99   73  SSHSSSSR TSKEKSHKSTSSST SST     S T S   H T  
     5  130 A L  T 3  S+     0   0   64  104   31  LLLLLKPI SLMMLLLLLKLLLLLLPIL   LI I I  IV LI 
     6  131 A E  T 3  S+     0   0  140  104   62  NSGDDDRE RSDDAKSAKDDDDEQDRHE   GD D E  DT QS 
     7  132 A D  S <  S+     0   0   48  105   41  DDMDDNDD DDDDDDQDDDDDDDDDDDD   PE D E DDD DD 
     8  133 A F  E     -A   27   0A   6  111    0  FFFFFFFF FFFFFFFFFFFFFFFFFFFF  YFFFYF FFFYYFY
     9  134 A E  E     -A   26   0A 106  111   31  EEEDDEEK EELIEEEEEDEEEEEEEEEQ  QEKHVE EEDRREQ
    10  135 A I  E     +A   25   0A  80  112   23  LIIVVLMV MIVVIIIMVILLLIILLLVVI LIVLFI VYLVIIL
    11  136 A G  E     +     0   0A  39  113   33  GGGGGGGG GGTTGGGGGGGGGGGGGLGMI GILLGIGLGRGTIC
    12  137 A R  E     -     0   0A 150  113   45  RKKRACAK ARKKKKRKRLKKKKKKSHRNK NKMKPKRKQKRNKE
    13  138 A P  E     -A   23   0A  60  113   64  RCPPPPHH PENNVKPIKKKKKKIKSKVLK KPLKTPLLILTTPE
    14  139 A L  E     +     0   0A  61  113    7  LILLLLLL LLLLLLLLLLLLLLLLLLLLL IILLLILILMLLIL
    15  140 A G  E     -A   22   0A  27  113   15  GGGGGGGG GGGGGGGGGGGGGGGGGGGGG GSGYGSGSGYGYSG
    16  141 A K  E     +A   21   0A 140  113   45  REKKRRRT RTQQKKKKKKKKKKKKQGTKE SRKESRYSENRSRR
    17  142 A G        -     0   0   47  113    0  GGGGGGGG GGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGG
    18  143 A K  S    S+     0   0  183  113   35  KKKKKKKK KKKKKKKKKKKKKKKKKNSSK NASSAAGAAAHYAR
    19  144 A F  S    S-     0   0   55  113    5  FFFFFFFF FFFFFFFFFFFFFFFFFYFFF FFFLFFFYFIFAYF
    20  145 A G        -     0   0    6  113   12  GGGGGGGG GGGGGGGGGGGGGGGGGGGAS SGASSGAGGSAAGG
    21  146 A N  E     -AB  16  38A  29  113   71  RKRNRRRT RQNNRRRKKKKKKKKKHDRCE TRCVVRAKQMVQRI
    22  147 A V  E     -AB  15  37A  28  113    0  VVVVVVVV VVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVV
    23  148 A Y  E     -AB  13  36A  48  113   18  FYYFYYYY YYYYYYYYYFYYYYYYHYSYY RYYCKYYYRYKYYY
    24  149 A L  E     + B   0  35A  40  113   55  IILILLLK LLLLCCLCCCCCCCCCVLLRL LLRQKLELLHLTLR
    25  150 A A  E     -AB  10  34A   3  113   31  AAASAAAA AAAAVVVVVVVVVVVVAAAAS AAAAVAVCCAAAAC
    26  151 A R  E     -AB   9  33A  69  113   29  RRRRRRRQ RRKKRRRRRRRRRKKRRSRRC TRKQRRERVVRTRF
    27  152 A E  E  >> -AB   8  32A  14  113   58  EEEEEEEE EEEEHHHHHHHHHHHHEVHSD DKSHSKRKHDQCKS
    28  153 A K  T  45S+     0   0   92  113   49  KKRKKRRK RKKKIKRIKKRRRKRKKRRCK ALVRKLAHKKVRKP
    29  154 A Q  T  45S+     0   0  161  113   78  KQSKTHHR HSCCEVEPKESSSKESKKGHK QAKREASTARNYSL
    30  155 A S  T  45S-     0   0   82  113   49  TSTTTTSS SSSTSTSSSSTTTSTTTSTTT GTTSTTDTTSTSTT
    31  156 A K  T  <5 +     0   0  121  112   70  GGGKNKHK HRNNGGGGGGGGGGGGGNGGS .GGGGGGGEGGGKG
    32  157 A F  E   < -B   27   0A  93  115   54  LYFRYFYT FMLVFFFFFFYYYFLYFYLIFFRDLREDSDLIQMDE
    33  158 A I  E     +B   26   0A  70  115   44  IVVIMMLI IYTTVIIIIIIIIIIILVVELIKLEHELRMQTLEIS
    34  159 A L  E     -B   25   0A   4  115   60  VVCIVVVV VVVVCCCCCCCCCCCCVVCVFFWFVVYFMYYVVVYY
    35  160 A A  E     -BC  24  85A   9  115    2  AAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAVAA
    36  161 A L  E     -BC  23  84A   1  115   21  LLLLLMML MLLLLMLLLLLLLLLLIIIILIVIILMIAIALVLIC
    37  162 A K  E     -BC  22  83A  29  115    0  KKKKKKKK KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    38  163 A V  E     -BC  21  82A  12  115   34  TVVVTVVI VVVVAVVAAVVVVAAVTKAMKKIVTIVVVIVLIVVT
    39  164 A L  E     - C   0  81A  19  115   23  LTLLLMML MLLLMMLMIMMMMMMMLLLIIIIMIYVMLMLYIYII
    40  165 A F  E >>  - C   0  80A  53  115   88  LYHFFFFR FVFFEEDEEQEEEEEEFSSDKRDKDKNKPRKKDNKD
    41  166 A K  H 3> S+     0   0   48  115   10  KKKKKKKK KKKKKKKKKKKKKKKKKIKKKKKKKRRKLKKrKDKK
    42  167 A A  H 3> S+     0   0   54  115   71  KESTTSEE EESSKQAKNTEEENKESKAQEQTRKSARSREaTVQT
    43  168 A Q  H <> S+     0   0   72  115   53  EKEQEEEE EQPPDEQEEDEEEEEEQKHATTRDSRSDSDKHKNYL
    44  169 A L  H  X>S+     0   0    7  115   25  ILLLLLLL VLLLIIIIIIIIIIIIILIMILLLMLLLLLLILKLL
    45  170 A E  H  <5S+     0   0   91  115   82  VQVLMVRE RKTTIMAILLIIIIVIVAIRNIRIHHDIALIIDAYL
    46  171 A K  H  <5S+     0   0  192  115   60  EKHQKKKN KARRQQRQQQKKKQQKKESRQNKRKEKRDYKFVPND
    47  172 A A  H  <5S-     0   0   54  115   87  GYGLSGGS GADDYYEYFYYYYYYYSFHAYLEKAMAKAKASLDhS
    48  173 A G  T ><5S+     0   0   32  106   71  GRHGRRCR NGGGNNKNNKNNNNTKKD.GNKN.G...M.K..Vn.
    49  174 A V  T 3>< +     0   0   35  110   41  VFVVVVVV VVGGIVAILLLLLLILCI.MIIM.MEL.K.QIAAV.
    50  175 A E  H 3> S+     0   0   84  110   50  EHESEEQV QSVVEQEELEQQQQQQEV.VTQE.VRE.L.TTAQG.
    51  176 A H  H <> S+     0   0   62  110   62  KAKHKKRQ RHSNKKVKKRKKKKKRRN.DQDD.QFS.H.KRSHK.
    52  177 A Q  H  > S+     0   0   67  113   33  QHQQQQQF QQNNQQHQQQQQQQQQQQ.RDYQNRQANRNYSHET.
    53  178 A L  H  X S+     0   0   19  115   28  ILLLAMVI VLLLFFVFLFFFFVFFVLLVILMMVLLMVMVMLMLT
    54  179 A R  H  X S+     0   0  136  115   52  LRRKLLLK LRKKRRRRKIRRRRRRMRRRIQLVTAKVQTKPLYTD
    55  180 A R  H  X S+     0   0  101  115   29  RRRRRRRR RKRRRRRRRRRRRRRRRRSAKNReNRDeNsSfQRnr
    56  181 A E  H  X S+     0   0   15  115    4  EEEEEEEE EEEEEEEEEEEEEEEEEEEEEEEeEEEeEeEeEEkp
    57  182 A V  H  X S+     0   0    6  115   29  IIIIIVII IVVVVVIVVVVVVIVVIIRVIIVRVIIRIRKIVVVK
    58  183 A E  H  X S+     0   0   73  115   27  EEEEEEEE EEEEEEEEDEEEEEEEEEDEKIANECANDDERRALI
    59  184 A I  H  < S+     0   0   35  115   11  IIIIIIII IIIIIIVIIIIIIIIIIIIISIIIILIIIAILCIML
    60  185 A Q  H >< S+     0   0    2  115   28  QQQQQQQQ QHQQQQHQQQQQQQQQQALHQQMLQHLLNLLHMQEH
    61  186 A S  H 3< S+     0   0   25  115   63  SHSYSSSA SSVASSSSLSTTTTGTSFRSTSRACINAQILSKSNL
    62  187 A H  T 3< S+     0   0  132  115   71  HGNHHRRH RRRRSSNSGSSSSISSHNQQLFSMRREMLHEDLSNV
    63  188 A L    <   -     0   0   10  115   19  LLLLLLLL LILLLLLLMLLLLLFLLTLLLLIALILALTMLVLEA
    64  189 A R        +     0   0  141  115   58  KDRRRKKH KRRRRNRRDNNNNNKNKRDKENKQKVRQQDDAQQQG
    65  190 A H    >   -     0   0   25  115    8  HHHHHHHH HHHHHHQHHHHHHHHHHHHHHHHNHHHNHNHHHHSH
    66  191 A P  T 3  S+     0   0   83  115   23  PPPPPPPP PEPPPQPPPPPPPPKPSKPPPAKPPPEPPPPDPHPP
    67  192 A N  T 3  S+     0   0   17  115   34  NNNNNHNN NNNNNNGNNNNNNNNNNYLANNNFSYHFHFNSNNFN
    68  193 A I  B <  S-f  147   0B   3  115   17  IVIIIIII IIVVLLILIILLLLLLILLILIVVIVIVVIIIVIII
    69  194 A L        -     0   0    6  115   34  LLLLLLLI LLLLTTLTIATTTTTTLLVLIIIVLVMVVISIVVVL
    70  195 A R        -     0   0   56  116   47  QRRTQRRRRRPRCQKGQKKKKKKQKRRREKKDREAGRTKKAQHNH
    71  196 A L  B     -D   85   0A   2  116   14  LLLLLLLLLLLMMLLFLLLSSSLLLLTMMLLLFLLLFFLLLLLFL
    72  197 A Y        -     0   0   90  116   20  LFYYLYLFYLFHHYYYYYYYYYYYYLYHYYYHYYYVYLFCYHFYF
    73  198 A G        -     0   0   12  116   53  CAGGTTTGNTAGGGGNGAGGGGSGGTAGGGGDYNADYGYYAEAYK
    74  199 A Y        +     0   0  105  116   56  WWHYYWWYYWTYYYYWYHYYYYFFYWYCCFFVSYATSSSTAVASI
    75  200 A F  E     -E   82   0A  11  116    4  FFFFFFFFFFFFFFFFFFFFFFFFFFFCFFYLFFWFFFFFWIFFY
    76  201 A H  E     -E   81   0A 116  116   57  HHHHHQHHYHQYYHHHHHHHHHHYHHFQEAYETEKATQATKDQAE
    77  202 A D        -     0   0   51  116   14  DDDDDDDNDDDDDDDDDDDDDDDDDDDDDDDSSDDTSDSDDTEGD
    78  203 A A  S    S+     0   0   87  116   69  SASDEDEERDADDEDEEEEEEEEEEEEEDEETRSSIRDHEKPGKD
    79  204 A T  S    S-     0   0   79  116   67  HEKKKRSTRSTSSKKRKKKKKKKKKRHQNEKNENKNEQRKATQRN
    80  205 A R  E     -C   40   0A  79  116   48  RRRRRRRNRRRCCRRRRRRRRRRRRRDCYAFHNYYKNNHKYTTYY
    81  206 A V  E     -CE  39  76A  18  116   22  IVVVIIIIIIVVVVVIVVVVVVIVVIIVVIIYLVVYLVLLVLLLL
    82  207 A Y  E     -CE  38  75A   4  116    9  YIFFYYYYYYYYYYYFYYYYYYYYYYYYYYYYYYYYYYYYYYVYH
    83  208 A L  E     -C   37   0A   1  116    6  LLLVLLLVLLLLLLLLLLLLLLILLLLFLLLLILLLILMFLLLIL
    84  209 A I  E     -C   36   0A   9  116   30  AVIIVAAVIAVVVLLVVLILLLVLLVIVVIVVVVAVVLVVAVVVI
    85  210 A L  E     -CD  35  71A  12  116   23  VLLLLLLLLLMLLMMLMMMMMMMMMVLMLQQLMLLTMQTLLMQMS
    86  211 A E        -     0   0   32  116    3  DEEDEEEEEEKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
    87  212 A Y        -     0   0   60  116   23  YYFYFLIYYIYYYYYYYHYYYYYYYFPYMLYFYMWLYLYLWLYYL
    88  213 A A    >   -     0   0   12  116   40  AAAAAAAAAAAAALLALSMLLLLVLACVCGAVICALICAIAAACC
    89  214 A P  T 3  S+     0   0   60  116   72  GADSASSEPSGPPVVAVILVVVIYVASPHHSSNHPENCNSPEPPS
    90  215 A L  T 3  S-     0   0   99  115   82  KR.RRQEQREGFYNNGNNYNNNQYNGNGNGHGGNQGGEGGGGGGA
    91  216 A G    <   -     0   0   28  115    6  GG.GGGGGGGGGGGGGGGGGGGGGGGGGGKGGGGGGGWGGGGGGg
    92  217 A T  B  >  -G  138   0B  37  115   29  EE.EEEEEEEDEEEEEEEEEEEEEEEMEEEQEDENEDPDEDDDSd
    93  218 A V  H  > S+     0   0    0  115   21  LL.LLLLLLLLLLLLLLLLMMMLLMLLFMLLLCMMLCGLLVLLLL
    94  219 A Y  H  > S+     0   0   85  115   15  YY.FYYFYYFYYYYYYYYYYYYYYYYYFSFYFFSFFYEYFYYLDF
    95  220 A R  H  > S+     0   0  180  115   52  kK.nkkkKKkKKKKKRKKKKKKKKKkSSrakDSRdDSLSEsDGCT
    96  221 A E  H  X S+     0   0   34  106   76  qV.qkkrKEr.EEHLLHSTLLLLFLtEHlkqKL.l.L.L.l....
    97  222 A L  H  X S+     0   0   12  107   35  AL.SRAGLLN.LLLLLLLLLLLLLLNLLKSLIL.V.MLL.K....
    98  223 A Q  H  < S+     0   0  123  107   64  GR.QQSAEQA.AAKRRKKERRRQKRSNKNQQVR.S.RRQ.S....
    99  224 A K  H  < S+     0   0  170  108   62  MS.PPPPAKPKKKGARGNILLLSNSPRNQPKAK.R.KRN.Q....
   100  225 A L  H  < S-     0   0   78  108   94  GV.GKNNKSNMEERKERNHHHHHNHQVKGNGAF.G.FVL.R....
   101  226 A S  S  < S+     0   0   82  108   68  GG.HEGHGRHRKKSGGNGGGGGGGGGKGRKQKG.G.GGG.G....
   102  227 A K  S    S-     0   0   89  111   74  HH.KRRRRTRSHFHPRHPPPPPPPPRMKPRKRAYRRARR.R..L.
   103  228 A F        -     0   0    4  113   11  FF.VFFFFFFMFFFLFFFFFFFFLFFFLFFYFLLLILFL.LYLL.
   104  229 A D     >  -     0   0   86  113   69  TS.NSNDSDDPSANDPSNENNNNNNPPSTKDDDKGVDSG.AIMA.
   105  230 A E  H  > S+     0   0   52  113   19  EE.EEEEEQEGDDDDEDDNDDDDEDEPEEEEEEEEEEEE.ELAE.
   106  231 A Q  H  > S+     0   0   77  113   84  KR.VPQPAQPRAAVIKEVAIIIVTISPEEPTPEREKELD.ERAK.
   107  232 A R  H  > S+     0   0   82  114   78  ET.ILRRERRRVVVFRVLVLLLLLLKTAQIQTVKETVQH.LHHLR
   108  233 A T  H  X S+     0   0    0  114   54  AA.ASSSATAFAAAAAAAAAAAAAAAAAETAAAVATAAA.ADGEV
   109  234 A A  H  X S+     0   0    0  116   45  AAGGAAAAAAPAASSASSTSSSSSSAARAAARRSAYRARCVGGNS
   110  235 A T  H  X S+     0   0   24  116   81  KTARKKKKtKEHRYHRYHNDDDNYDRRLrNLRQfrtQHQipgrgr
   111  236 A Y  H  X S+     0   0    5  115   33  YY.FYYYYdYRYYYYYYYYYYYYFYYYYfFYYYfvvYIYyihvii
   112  237 A I  H  X S+     0   0    1  115   45  TV.VTTTIHTQVVVVSVIVIIIVVIIVALIIFIMMCILAMLFLAL
   113  238 A T  H  X S+     0   0   27  115   88  YA.RYYYVGYASAYYAYYYYYYYYYYAGRRKQAHKKAWAAEARAK
   114  239 A E  H  X S+     0   0   30  115   51  QS.QQQQQGQMQQQQQQQQQQQQQQQQEEQQQEQPIEQEQPQPEQ
   115  240 A L  H  X S+     0   0    0  115   33  VL.LVVVLAVLVVMMVMIIIIIIMIVLVIIILTILLTVIMFILSL
   116  241 A A  H  X S+     0   0    0  115   51  AS.AAAASGAYVIAAAAAAAAAAAAAALSIIIVVMFVLILMVLIV
   117  242 A N  H  X S+     0   0   83  115   71  DG.NDDNDGNTEEDDAGDSNNNDNTDELSQSALKGNLALEAQELS
   118  243 A A  H  X S+     0   0    0  116    8  AAAAAAAARAAAAAAAAAAAAAAAAAAMGAAGAGAAAAAAGAAAA
   119  244 A L  H  X S+     0   0    1  116   14  VLLLLLLLALQLLLLLLLILLLLLLVLFLLCVLMLILLLLLVLLI
   120  245 A S  H >X S+     0   0   11  116   87  NAKHENNEDNLKRDDRDHLDDDDDDELDLIIHELAGEEDIAALSS
   121  246 A Y  H 3X S+     0   0   48  116   11  YYYYFYYYVYAYYYYYYYYYYYYYYYYYYYFYYYFYYHYYVYYDY
   122  247 A C  H 3<>S+     0   0    1  116   78  CCLCCCCMLCCCCMMLMMLMMMLMMCLLLMLCCLLCCLCIICLLC
   123  248 A H  H X<5S+     0   0   15  116    3  HHHHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
   124  249 A S  H 3<5S+     0   0   87  116   75  KKKSRALSQLQSSEQSEKQKKKQSKQQTAQQSATSVASESERRHH
   125  250 A K  T 3<5S-     0   0  107  116   49  KKKKNNNFKNQCCRRKRKRKKKKKKHHQHKNKQHQRQCRLKLWNM
   126  251 A R  T < 5S+     0   0  231  116   71  CQHGNNNGKNHNNNNHNRHNNNHNNHHDGKNGGGSKGGGNGHGKG
   127  252 A V      < -     0   0   11  116   16  VVVVVVVVVVVVVIIVIIIIIIIIIVIIVFIFIIFVIVIILVIIV
   128  253 A I        -     0   0   15  116   25  IIMIIIIIIIIIILIMLIIIIIILIILVIIIAILLCILICIVVVA
   129  254 A H        +     0   0    0  116    1  HHHHHHHHHHHHHHHHHHHHHHHHHHHYHHHHHHHHHHHHHHHHH
   130  255 A R        +     0   0   50  116    0  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   131  256 A D        +     0   0   32  116    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   132  257 A I        +     0   0    1  116   16  IIIIILLLILIIIIVIIVIIIIIIIIILLILLLLVLLLVLILVLI
   133  258 A K    >   -     0   0   23  116    3  KKKKKKKKKKKKKKKKKKKKKKKKKKKKTKKKKTKKKKKKKKKKK
   134  259 A P  G >  S+     0   0    0  116   15  PPPPPPPLPPPPPPPPPPPPPPPPPPPPLLPPPLLPPLPPPPPPP
   135  260 A E  G 3  S+     0   0  114  116   10  EEEEEEEEEEEEEEEEEEEEEEEEEEEEAEQEDSEEDSDEEEEDD
   136  261 A N  G <  S+     0   0   10  116    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNnNNNNNnNNN
   137  262 A L  E <   - H   0 147B   0  116   24  LLILLIIILILLLIIIIVIIIIIIIIILLIILLLLlLMLLMvVMI
   138  263 A L  E     -GH  92 146B  33  116    3  LLLLLLLLLLLLLILLILLLLLLLLLLLLMLLLLLLLFLMLFLLL
   139  264 A L  E     - H   0 145B   5  116   28  LLVLLLLLLLLILIIIIIIIIIIIIVLLLLLLILLKILILLFFIF
   140  265 A G    >   -     0   0    4  116   36  TDGDTTTSGTSGGGGGGGGGGGGGGADDATSDNTDgNGATTPADD
   141  266 A S  T 3  S+     0   0  108  114   88  YIISHDSKLSQHHFFLFFPFFFFFFFHAS..AANAcARAGNQAKT
   142  267 A A  T 3  S-     0   0   84  116   73  EEHKDDTQQTENNNDYNDHNNNNNNSNADNYTQNSDQDNSSQDCR
   143  268 A G    <   +     0   0   24  116   37  GGGLGDDGGDGKQNNGNNNNNNNNNGQGMGGGGMCIGGGGFGGGG
   144  269 A E        -     0   0   42  116   63  NRENNNDTEDTTTTTEVVQVVVTTVDNHSVAEHNNDHTHNQTTHR
   145  270 A L  E     - H   0 139B   0  116   28  VLILIVLVLLIIIIVLIVLIIIVIILILTLILVILLVVILVVVLL
   146  271 A K  E     - H   0 138B  14  116    2  KKKKKKKKKKQKKKKKKKKKKKKKKKKKRKKKKKKKKKKKKKKKK
   147  272 A I  E     -fH  68 137B   0  116   23  LIILLLLLILLLLLLLLLLLLLLLLLLLILIILILILVLLILLLL
   148  273 A A        +     0   0   12  116   43  AASAAAAGAAGAATTATATTTTTTTAATACTSTAAATGTVATATA
   149  274 A D        +     0   0   63  116    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   150  275 A F        +     0   0    2  116    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFFFFFFF
   151  276 A G  S    S+     0   0   18  116    1  GGGGGGGGGGGGGGGGGGGGGGGGGEGGGGGGGGGGgGGGGGGGG
   152  277 A W  S    S+     0   0  115  116   26  WWWWWWWWWWWWWWWYWWWWWWWWWMWFLYCLLLLFlLLILFLLS
   153  278 A S              0   0    4  116   23  sasssssssssssssssssssssssIsaatsgsaaagasassasa
   154  279 A V              0   0  104  114   42  mlmlmmlfmllfflmlllfvvvlli.slvffvnmrvatgfrsrvi
   155      ! !              0   0    0    0    0  
   156  290 A C              0   0  176  114   20  CCCCCCCCCCCCCCCCCCCCCCCCC.CCCCCCVCLCVCKCLCVRV
   157  291 A G        -     0   0   57  115    1  GGGGGGGGGGGGGGGGGGGGGGGGG.GGGGGGGGGGGGGGGGGGG
   158  292 A T    >   -     0   0   79  115    7  TTTTTTTTTTTTTTTTTTTTTTTTT.TTTTTTTTTSTSTTTSTTT
   159  293 A L  G >   +     0   0   12  115   44  LILMLLLLLLLPPVLLVIIIIIIII.PPPLLPPPFPPLPAILLPP
   160  294 A D  G 3  S+     0   0   23  115   15  DDDDDDDDDDDDDDDDDDDDDDDDD.EDNDDNDNGGDNDEDADDY
   161  295 A Y  G <  S+     0   0   19  115    2  YYYYYYYYYYYYYYYYYYYYYYYYY.YYYYYYYYYYYWYYYYYYY
   162  296 A L    <   -     0   0   31  115   14  LLLLLLLLLLLLLLLLLLLLLLLLL.FLMAIVLIFVLMLLLSMLV
   163  297 A P     >  -     0   0    0  116   45  PAPAPPPPPPSSSSSPSSSSSSSSSKPASSSAASASAAAAAAWAA
   164  298 A P  H  > S+     0   0    1  116    3  PPPPPPPPPPPPPPPPPPPPPPPPPRPPPPPPPPPPPPPPPPHPP
   165  299 A E  H  4 S+     0   0    1  116    3  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEMEE
   166  300 A M  H >4 S+     0   0   36  116   27  MMMMMMMMMMMMMLLMLMIMMMILMVIIVMMVLVDILVVVIIGLV
   167  301 A I  H 3< S+     0   0   36  116   33  VVLVVVVIIVIVVIIVIIVVVVIIVYVIAVLLLATLLLLVLLMLL
   168  302 A E  T 3< S-     0   0   61  116   69  EEKSNDDAEDRMMRAAKTDEEETKEDSLSENMLTSKLRLSDLALR
   169  303 A G    <   +     0   0   60  116   65  HKPNGGGNGGGGGSSASPYSSSSSLVRNRGGEGRVRGPCNCGPGG
   170  304 A R        -     0   0  112  116   72  RKgQQKNERHEEERKgRRKRRRKRRSQKGKErTSPDTgENpegMR
   171  305 A M        -     0   0  179  115   89  RAwPKISPTSKSSEEkEEEEEEEEE.IGPEDyGAGPGgPEgyrPE
   172  306 A H        -     0   0   58  115   44  YHYHYYYHHYYYYYYYYYYYYYYYY.YHHYYNHHYYHYYYYDYHY
   173  307 A D        -     0   0   63  115   47  GDDDDDDTNDDDDNDSDDDDDDDND.DGGDGGGGDGGGGGTAGTN
   174  308 A E  S >  S+     0   0   60  115   77  KYEFIDDEEDEYYEDGEEHHHHHNH.MKTNRLPLSLPMPINPFEE
   175  309 A K  T >> S+     0   0   28  115   70  YAKNYSSAKSSRRKKAKQNTTTTKT.SAPSSSEERKEEEMKAAAK
   176  310 A V  H 3> S+     0   0    0  116   18  VVVVVVVVVVVTTVVVVVVIIIVVIVAVAVVAVSVTVVVVVVTVV
   177  311 A D  H <> S+     0   0    0  116    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   178  312 A L  H <> S+     0   0    1  116   69  HNLIHQQILQISSVVQVVIAAAIVVHLWAAIIWVVMWVWWCICYV
   179  313 A W  H  X S+     0   0    0  116    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   180  314 A S  H  X S+     0   0    0  116   47  CTSACCCSCCASSAATAAAAAAAAACCAASSSASSSAAASSSASS
   181  315 A L  H  X S+     0   0    0  116   26  LILILLLLILVLLLLLLLLLLLLLLILLLILCLLALLLLYVLVLA
   182  316 A G  H  X S+     0   0    0  116    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   183  317 A V  H  X S+     0   0    0  116   19  VIVIIIIVVIIVVVVVVVIVVVVVVVIVCIIVTCVVAVVCVVVCV
   184  318 A L  H  X S+     0   0    0  116   17  LLLLLLLILLILLLLLLLVLLLLLLLFLALLIIMVIIVVILIVII
   185  319 A C  H  X S+     0   0    0  116   73  CCILCCCCCCMTTTTTTAAAAAATTLCIATALLFGILLVIALTVL
   186  320 A Y  H  X>S+     0   0    1  116    1  YYYFYYYYYYYYYYFYYYYFFFYYFYFYYYYYYYYFYYFYYYFFY
   187  321 A E  H  X5S+     0   0   11  116   15  EEEEEEEEEEEEEEEEEEEEEEEEEEEEAEEVEAEIETEEEMEEI
   188  322 A F  H  <5S+     0   0    0  116   18  FFFMFFFLLFLLLLLFLLLLLLLLLFLMMLLMFFVLFLLLLLLLM
   189  323 A L  H  <5S+     0   0   12  116    9  LLLLLLVILVLLLLVLLVLLLLVLLLLLLILLVLLLILLFLVLLL
   190  324 A V  H  <5S-     0   0   23  116   52  VYVVVVVVVVVVVVVTVVVTTTVVTVVAVFTATMTGTVVCVCTFS
   191  325 A G  S  <   -     0   0    8  116   29  PPAAPPPPPPPTTPPAPPPPPPPPPPTPPAALPPAPPPPSPPPPP
   194  328 A P  T 3  S+     0   0    0  116    1  PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPPPPPPPPPP
   195  329 A F  T 3  S+     0   0    0  116    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFYFF
   196  330 A E    <   +     0   0   81  116   46  EEEALEEEEEEYYEEEEEEEEEEEEEVLQTLENDSQNQHYAQANF
   197  331 A A        -     0   0   22  115   63  SADNSSSESSACSEEDEEEEEEEEETSDADCDATANAAASAESDG
   198  332 A N  S    S+     0   0  157  116   73  KESQDENLASPEEEDSENNEEEEDDEKDSKERDDSDEESSPTDDE
   199  333 A T  S  > S-     0   0   62  116   72  TEPTTTSdSNGNNSSPSSTMMMTTMGDDANKSTTSDTRTStNCTT
   200  334 A Y  H  > S+     0   0  127  102   82  SQ.GSTTtHSQQQKK.KKKKKKKKKENP.dNMPVPQPRPMqDRPS
   201  335 A Q  H >> S+     0   0  131  112   79  EQVDDEEeNENMMEEAEEDDDDEEDDDL.eNKEKAKE.VA.S.ET
   202  336 A E  H 3> S+     0   0   72  114   72  EDMKEASKEIEEELLMLLLTTTMMTKQS.KEHEHKLEGEVEE.YE
   203  337 A T  H 3X S+     0   0   11  115   28  TTTLTTTTTTTMMTTTTTTTTTTTTTITVTQLITIQIRITTT.IT
   204  338 A Y  H S+     0   0  110  116   61  HMRAQDSNREEKKKKRKKEKKKKRKAKKALQADSQEDAEQRVQDE
   206  340 A R  I  <>S+     0   0   53  116   48  KRRRKKKRRKLRKRRRRRRRRRRRRRKKTNKRNKANNANKLMANA
   207  341 A I  I  <5S+     0   0    2  115    8  IIIIIIIIIIIIIIIIIIIIIIIIIIIILIIIIVIIIGIIIIEIV
   208  342 A S  I  <5S+     0   0   22  115   82  RVVKKRRTVRTEELVELLRAAAVLALHLAVMELVRKLDLVRLALL
   209  343 A R  I  <5S-     0   0  157  115   62  HKREKRRRKRELLKRRKKRAAAKRASAKRKKRDLTKDPSDTDRSR
   210  344 A V  I   < +     0   0   34  115   69  VVGCVLMVVLGAVRGGRCGLLLGCLLMGVNVGRGRGRGGRKCIRG
   211  345 A E      < +     0   0   84  114   51  DDEKDEEDDDQDDNDDNDDDDDEDDDQVLEnEREVNRFNDRRirN
   212  346 A F        -     0   0   41  114   47  LLMIIVIILVLYYLLMLLIIIILLIIYLAIlYIYLYIYIIVYplL
   213  347 A T        -     0   0  108  114   79  KLTYPDSQKHRHQIKKVNVKKKKKKVTTRDFNTEEITEAYESPLR
   214  348 A F        -     0   0   42  114   41  FFIIWYYFFYVFFFFPFFFMMMFFFYIFFFFMWMFFWFDWYVFPF
   215  349 A P    >   -     0   0   31  114   11  PpPPPPPPPPPppPPlPPPPPPPPPPPPePPApPPvppePPPPPp
   216  350 A D  T 3  S+     0   0  165  113   74  EhSSPRPQPSPppDNaDEKSSSELSSDPpGGRdA.gdvdKSEHEr
   217  351 A F  T 3  S+     0   0  108  114   91  DDFVQFHSSYMALHHSHSQNNNHNNHSHTLYHDHGTDAGTWHGIS
   218  352 A V    <   -     0   0    8  114   31  VIVVIMLMVLVVVVIIIIVIIILVIIVLLIVIMAVIMLLMLIMVV
   219  353 A T     >  -     0   0   51  114   36  PSSTTSTTPSSSSDSSDSTSSSPSSPPSSSSSSSSSSSSPSSSAS
   220  354 A E  H  > S+     0   0  138  114   79  SAPDPSKTVSLEETSKPKPQQQNPQDPVPFLDALEDCEAPPAHSP
   221  355 A G  H  > S+     0   0   30  114   50  GDEGGGGEGGATDEDEDDEDDDIQDGETAEETEEDDESADENPGE
   222  356 A A  H  > S+     0   0    0  114   22  AAAAAACCAAAAAAAAAAAAAAVAAAAAAGAACAGACAAASCAVA
   223  357 A R  H  X S+     0   0   60  114   47  RKRAKKKKQKKKKRQKRKRQQQRRQKKRRVQKRQKKRRKKVRRLK
   224  358 A D  H  X S+     0   0   66  114   23  DDDSDDEQDEDSSHDHHDDDDDDDDDDDDDDDDDDSDGDDNDDND
   225  359 A L  H >X S+     0   0    2  114    7  LLLLLLLFLILFFLLYLLFLLLLLLLLLLFFLLLFMLLLLFLFFL
   226  360 A I  H >X S+     0   0    2  114    8  IIIIIIIIIIIIIIIVIIIIIIIIIIIILIIIIILIIVIIMIIVL
   227  361 A S  H 3< S+     0   0   44  114   75  SCKNSSGLSATAASTHSSELLLQVLSSRRKNADHRDDHKNSSRDR
   228  362 A R  H << S+     0   0  120  114   48  KKKAKKGKKGRGGRKSRKRKKKRRKKNKRKKRKQQSKAGGIRRRK
   229  363 A L  H << S+     0   0    1  112   10  LLLILLLVLLILLLLLLLILLLILL LLLLLMLLALLLLLVMLLM
   230  364 A L  S  < S+     0   0    4  111    3  LLLIILL LLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLI
   231  365 A K        -     0   0   89  110   79  TVVKKRR KRQQKERVEVVKKKVQK IQRVQVHQTTHVHTVQADC
   232  366 A H  S    S+     0   0   64  110   89  RKLKRSK HRKRRYHLYTLYYYIFY RVRKRVPKRIPVPTRRPPK
   233  367 A N  S >  S-     0   0   53  110   48  SDDEESE NKLKKDNDDDEDDDEED EDDKDNNDDDNDDDDDIND
   234  368 A P  G >  S+     0   0   25  110   28  SSPPSSS PSPPPPSPPTPPPPPPP GLPPPPPPPPPPAPPPPPV
   235  369 A S  G 3  S+     0   0  105  110   75  HRAQKGK SQESRGKSATKKKKSSN SSGQNKLAAALSSETSGES
   236  370 A Q  G <  S+     0   0   95  110   62  KKSEDAG DGRDDDDKNQKDDDKKE KKKEEKKQLKKQQKQRDTR
   237  371 A R    <   -     0   0   10  110    0  RRRRRRR RRRRRRRRRRRRRRRRR RrRRRRrRRRrRrRRRRRR
   238  372 A P        -     0   0   18  109   52  MIILIII LVLLMIILILMMMMMIM LgPMIIvPPLrPpIPAPLI
   239  373 A M    >>  -     0   0   54  109   62  SSPPSTT PSSSSPSSASTRRRSPR AGGTNTGSTSGSGGSSTNS
   240  374 A L  H 3> S+     0   0    0  109   26  LLLLLLL LLLLLLLFLLLLLLLLL LVLLLLALAAALAGILVEA
   241  375 A R  H 3> S+     0   0   99  109   74  NDDVPVV AVQEAKRDKTKGGGKSE HNPNVEGSKEGEAPAERVD
   242  376 A E  H X> S+     0   0  102  109   53  DDEDNDE QDEDDEEDDGEDDDEED RDADDAEAQDEQDEEEQTQ
   243  377 A V  H 3< S+     0   0    3  109   26  VIVIVVV VVIAAVVAVVIVVVIVV VIVAIIVVMAVVLLLILAV
   244  378 A L  H 3< S+     0   0   40  109   72  MLQMKMM SMKVAKKLRKMKKKKKK LRLLNIKLLLKRKRLELKL
   245  379 A E  H << S+     0   0  134  109   79  CKRARKT ATAKKKQAGTSMMMRSM SSEQNRLDASLQAKDGAER
   246  380 A H  S  < S-     0   0   20  109    3  HHHHHHH HNHHHHHHHHHHHHHHH HHHHNHHHHHHHHHHHHHH
   247  381 A P  S >> S+     0   0   85  109   27  PPPPYFY PQRPPPPPSPPPPPPAP PPPPEPTPPPPAPPPQPPP
   248  382 A W  T 34 S+     0   0   14  109    2  WWWWWWW WWWWWWWWWWWWWWWWW FWFFWWWFWWWFFFWWWFW
   249  383 A I  T 34 S+     0   0    3  109   25  IIIIIIV VIFIIIIIIIIIIIIII LFLILFFMIMFFFFILIMV
   250  384 A T  T <4 S+     0   0   76  100   79  VVLKVKK RK QQETVLLLLLLLAL LR QNV  LK A KL L I
   251  385 A A  S  < S+     0   0   82   95   69  RKKEEDA AD NNKKKKKKRRRKNR K  SK   RA E  K   S
   252  386 A N  S    S+     0   0   42   84   46  NN  NS  H  HHNNHNNYNNNNNN     N   HD H  Y    
   253  387 A S              0   0   20   64   72   A      S   DKR QKKKKKKRK     I    S    S    
   254  388 A S              0   0  130   27   53              SPP PPSPPPPGP     S              
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1  126 A   0   0   0   0   0   0   0   0   0   0   4   0   0   0  43  44   5   0   4   0    79    0    0   1.123     37  0.59
    2  127 A   1   1   1   0   0   0   0   0   1   2  11   2   0   0  20  24  18  13   3   2    92    0    0   2.038     68  0.29
    3  128 A   1  18   0   0  21  59   0   0   0   0   0   1   0   0   0   0   0   0   0   0    96    0    0   1.038     34  0.74
    4  129 A   2   0   0   0   0   0   0   0   7   0  26  33   4  16   3   3   2   2   1   0    99    0    0   1.824     60  0.26
    5  130 A   2  66  25   2   0   0   0   0   0   2   1   0   0   0   0   2   0   0   0   0   104    0    0   0.967     32  0.69
    6  131 A   0   0   0   0   0   0   0  13   5   0  11   4   0   4   4   3   2  18   9  28   104    0    0   2.086     69  0.38
    7  132 A   0   0   0  12   0   0   0   1   0   1   0   0   0   0   0   0   1   2  10  72   105    0    0   0.937     31  0.59
    8  133 A   0   0   0   0  95   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0   111    0    0   0.184      6  0.99
    9  134 A   1   1   1   0   0   0   0   0   0   0   0   0   0   1   2   2   3  63   0  27   111    0    0   1.056     35  0.69
   10  135 A  12  11  71   5   1   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   112    0    0   0.977     32  0.76
   11  136 A   0   4   4   1   0   0   0  87   0   0   1   3   1   0   1   0   0   0   0   0   113    0    0   0.624     20  0.66
   12  137 A   0   1   0   1   0   0   0   1   3   1   1   0   1   1  46  41   1   1   3   0   113    0    0   1.292     43  0.55
   13  138 A   2   6   3   1   0   0   1   0   1  65   1   3   1   2   1  12   0   2   2   0   113    0    0   1.433     47  0.36
   14  139 A   0  93   6   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   113    0    0   0.282      9  0.93
   15  140 A   0   0   0   0   0   0   3  94   0   0   4   0   0   0   0   0   0   0   0   0   113    0    0   0.275      9  0.84
   16  141 A   0   0   0   1   0   0   1   1   0   0   4   4   0   0  19  63   3   4   1   0   113    0    0   1.249     41  0.54
   17  142 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   113    0    0   0.000      0  1.00
   18  143 A   0   0   0   0   0   0   1   1   6   0   4   0   0   1   3  83   0   0   2   0   113    0    0   0.737     24  0.65
   19  144 A   0   1   1   0  95   0   3   0   1   0   0   0   0   0   0   0   0   0   0   0   113    0    0   0.274      9  0.95
   20  145 A   0   0   0   0   0   0   0  91   4   0   4   0   0   0   0   0   0   0   0   0   113    0    0   0.360     12  0.87
   21  146 A   3   0   1   1   0   0   0   0   1   0   3   2   2   6  29  12   3   1  37   1   113    0    0   1.789     59  0.29
   22  147 A 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   113    0    0   0.000      0  1.00
   23  148 A   0   0   0   0   4   0  90   0   0   0   1   0   1   1   2   2   0   0   0   0   113    0    0   0.479     15  0.82
   24  149 A   2  74   3   3   0   0   0   0   0   0   0   1  11   1   3   2   1   1   0   0   113    0    0   1.058     35  0.44
   25  150 A  15   0   0   0   0   0   0   0  81   0   2   0   3   0   0   0   0   0   0   0   113    0    0   0.627     20  0.68
   26  151 A   2   0   0   0   1   0   0   0   0   0   1   2   1   0  82   9   2   1   0   0   113    0    0   0.756     25  0.70
   27  152 A   3   5   0   0   0   0   0   0   0   0   4   4   1  15   1   4   1  59   0   4   113    0    0   1.465     48  0.41
   28  153 A   4   2   2   0   0   0   0   0   4   1   0   0   1   1  27  57   3   0   0   0   113    0    0   1.278     42  0.51
   29  154 A   1   1   0   0   0   0   1   2   3   1  15   5   4   4   7  23  16  13   1   4   113    0    0   2.278     76  0.21
   30  155 A   0   1   1   0   0   0   0   2   0   2  58  29   0   1   0   0   0   2   4   1   113    0    0   1.173     39  0.50
   31  156 A   0   0   0   0   0   0   0  38   0   0   2   0   0  11   3  29   5   2  10   0   112    0    0   1.592     53  0.30
   32  157 A   1   5   2   2  58   0  17   0   0   0   2   1   0   3   3   0   3   2   0   3   115    0    0   1.533     51  0.46
   33  158 A  18   6  61   3   0   0   1   0   0   0   1   3   0   2   1   1   1   3   0   0   115    0    0   1.367     45  0.56
   34  159 A  50  13   2   3   3   1   4   0   1   0   0   0  23   0   0   0   0   0   0   0   115    0    0   1.455     48  0.40
   35  160 A   1   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   115    0    0   0.050      1  0.98
   36  161 A   2  81  10   4   0   0   0   0   2   0   0   0   1   0   0   0   0   0   0   0   115    0    0   0.726     24  0.78
   37  162 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   115    0    0   0.000      0  1.00
   38  163 A  75   2   7   1   0   0   0   0   5   0   0   7   1   0   0   3   0   0   0   0   115    0    0   0.990     33  0.66
   39  164 A   1  69  12  15   0   0   3   0   0   0   0   1   0   0   0   0   0   0   0   0   115    0    0   0.975     32  0.76
   40  165 A   1   1   0   0  52   0   5   0   0   1   2   0   0  11   3   6   1   9   2   7   115    0    0   1.709     57  0.12
   41  166 A   0   1   1   0   0   0   0   0   0   0   0   0   0   0   3  95   0   0   0   1   115    0    0   0.270      9  0.90
   42  167 A   1   0   1   0   0   0   1   0   9   0  39   9   0   1   4  10   3  14   8   0   115    0    0   1.920     64  0.29
   43  168 A   0   1   0   0   0   0   1   0   1   2   3   2   0   2   2   4  49  29   1   5   115    0    0   1.541     51  0.46
   44  169 A   2  62  32   3   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   115    0    0   0.891     29  0.75
   45  170 A  11   5  15   2   0   0   1   1   4   0   0   2   0   3   3   5  16  29   1   3   115    0    0   2.194     73  0.18
   46  171 A   1   0   0   0   1   0   1   0   2   1   3   1   0   3   5  47  26   5   3   2   115    0    0   1.668     55  0.40
   47  172 A   0   3   0   1   3   0  15  16  18   0  17   1   1   4   0   3   1  15   1   3   115    0    0   2.208     73  0.13
   48  173 A   1   0   0   1   0   0   0  38   0   0   2   1   2   2   7  21   8   0  18   1   106    0    0   1.777     59  0.29
   49  174 A  61  11  13   5   2   0   0   2   3   0   0   0   1   0   0   1   1   1   1   0   110    0    0   1.404     46  0.59
   50  175 A   6   2   0   0   0   0   0   1   2   0   2   3   0   5   1   0  13  66   0   0   110    0    0   1.253     41  0.49
   51  176 A   1   0   0   0   1   0   0   0   2   1   3   0   0  50   6  28   4   0   2   3   110    0    0   1.470     49  0.37
   52  177 A   0   0   0   0   1   0   2   0   1   0   1   1   0   4   3   0  82   1   4   1   113    0    0   0.835     27  0.67
   53  178 A  19  60   4   6   9   0   0   0   1   0   0   1   0   0   0   0   0   0   0   0   115    0    0   1.224     40  0.72
   54  179 A   2   7   2   1   0   0   1   0   1   1   0   3   0   0  73   7   2   1   0   1   115    0    0   1.154     38  0.48
   55  180 A   0   0   0   0   1   0   0   0   1   0   3   0   0   0  87   2   1   2   3   1   115    0    0   0.639     21  0.71
   56  181 A   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   1   0  98   0   0   115    0    0   0.100      3  0.96
   57  182 A  36   0  56   3   0   0   0   0   0   0   0   0   0   0   3   2   0   0   0   0   115    0    0   0.998     33  0.70
   58  183 A   0   1   2   0   0   0   0   0   3   0   0   0   1   0   2   1   0  86   2   3   115    0    0   0.676     22  0.72
   59  184 A   1   3  93   1   0   0   0   0   1   0   1   0   1   0   0   0   0   0   0   0   115    0    0   0.369     12  0.88
   60  185 A   0   5   0   2   0   0   0   0   1   0   0   0   0   5   0   0  85   1   1   0   115    0    0   0.639     21  0.71
   61  186 A   1   3   2   0   1   0   2   2  14   0  57  10   1   1   2   1   4   0   2   0   115    0    0   1.611     53  0.37
   62  187 A   1   3   1   2   1   0   0   2   0   0  14   0   0  49   7   0   2   2  17   1   115    0    0   1.656     55  0.29
   63  188 A   2  88   3   2   1   0   0   0   3   0   0   2   0   0   0   0   0   1   0   0   115    0    0   0.598     19  0.80
   64  189 A   1   0   0   0   0   0   0   1   2   0   2   1   1   2  53  10  15   1   7   5   115    0    0   1.612     53  0.42
   65  190 A   0   0   0   0   0   0   0   0   0   0   1   0   0  96   0   0   1   0   3   0   115    0    0   0.220      7  0.92
   66  191 A   1   0   0   0   0   0   0   0   1  87   1   0   0   1   0   5   1   2   0   2   115    0    0   0.623     20  0.76
   67  192 A   0   1   0   0   3   0   2   1   1   0   2   0   0   9   0   0   0   0  82   0   115    0    0   0.759     25  0.65
   68  193 A  13  10  76   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   115    0    0   0.754     25  0.83
   69  194 A   7  75   8   1   0   0   0   0   1   0   1   8   0   0   0   0   0   0   0   0   115    0    0   0.925     30  0.65
   70  195 A   0   0   0   0   0   0   0   3   2   1   0   2   1   2  66  13   8   2   1   1   116    0    0   1.273     42  0.53
   71  196 A   0  82   0   9   6   0   0   0   0   0   3   1   0   0   0   0   0   0   0   0   116    0    0   0.680     22  0.86
   72  197 A   1   5   0   0  13   0  76   0   0   0   0   0   1   4   0   0   0   0   0   0   116    0    0   0.845     28  0.79
   73  198 A   0   0   0   0   0   0   4  60   8   0   1   7   1   0   0   1   0   1  16   2   116    0    0   1.346     44  0.47
   74  199 A   2   0   1   0   4  10  58   0   3   0   4   3   2  14   0   0   0   0   0   0   116    0    0   1.466     48  0.43
   75  200 A   0   1   1   0  94   2   2   0   0   0   0   0   1   0   0   0   0   0   0   0   116    0    0   0.321     10  0.95
   76  201 A   0   0   0   0   1   2  19   0   3   0   0   3   0  61   0   2   4   3   0   2   116    0    0   1.329     44  0.42
   77  202 A   0   0   0   0   0   0   0   1   0   0   3   2   0   0   0   0   0   1   1  92   116    0    0   0.384     12  0.85
   78  203 A   0   2   1   0   0   0   0   1  16   2  15   3   0   2   9   2   6  29   0  14   116    0    0   2.053     68  0.30
   79  204 A   2   0   0   0   0   0   0   0   3   0   9  15   0   3  14  39   3   8   5   2   116    0    0   1.908     63  0.33
   80  205 A   0   0   0   0   1   0   5   0   1   0   0   2   3   2  78   5   0   0   3   1   116    0    0   0.977     32  0.52
   81  206 A  59   7  33   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.933     31  0.78
   82  207 A   2   0   1   0  21   0  76   0   0   0   0   0   0   1   0   0   0   0   0   0   116    0    0   0.688     22  0.90
   83  208 A   2  92   3   1   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.372     12  0.93
   84  209 A  23   8  59   5   0   0   0   0   5   0   0   0   0   0   0   0   0   0   0   0   116    0    0   1.157     38  0.69
   85  210 A   2  76   2  15   0   0   0   0   0   0   1   2   0   0   0   0   3   0   0   0   116    0    0   0.858     28  0.77
   86  211 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0  96   0   3   116    0    0   0.199      6  0.96
   87  212 A   0   6   2   2  24   2  63   0   0   1   0   0   0   1   0   0   0   0   0   0   116    0    0   1.096     36  0.77
   88  213 A   3   8   3   1   0   0   0   1  79   0   1   0   5   0   0   0   0   0   0   0   116    0    0   0.847     28  0.59
   89  214 A   6   1   3   0   0   0   1  15  14  38   9   0   1   5   0   1   1   3   3   1   116    0    0   2.007     67  0.27
   90  215 A   0   7   0   0   1   0   3  23   1   0   0   0   0   2  23  20   5   3  14   0   115    0    0   1.951     65  0.18
   91  216 A   0   0   0   0   0   1   0  98   0   0   0   0   0   0   0   1   0   0   0   0   115    0    0   0.100      3  0.94
   92  217 A   0   0   0   1   0   0   0   0   4   1   1   6   1   0   0   0   1  77   1   7   115    0    0   0.938     31  0.70
   93  218 A   9  77   0  10   1   0   0   1   0   0   0   0   3   0   0   0   0   0   0   0   115    0    0   0.813     27  0.78
   94  219 A   0   1   0   0  15   0  81   0   0   0   2   0   0   0   0   0   0   1   0   1   115    0    0   0.649     21  0.84
   95  220 A   0   1   0   0   0   0   0   4   2   0   9   1   1   1  12  62   1   1   3   3   115    0    0   1.433     47  0.47
   96  221 A   3  15   1   1   2   0   0   0   0   0   1   2   0  15   3   5  10  42   0   0   106    0    0   1.797     59  0.23
   97  222 A   1  83   1   1   0   0   0   1   5   0   2   1   0   0   1   3   0   0   2   0   107    0    0   0.807     26  0.65
   98  223 A   2   1   0   0   0   0   0   1   4   0   7   3   0   0  23   8  48   2   2   0   107    0    0   1.613     53  0.36
   99  224 A   0   3   2   1   0   0   0   2   6  10   3   0   0   0  17  51   2   1   4   0   108    0    0   1.665     55  0.38
  100  225 A   5   9   0   2   2   0   2   6   5   0   8   1  16   8   4   7   3  14   9   0   108    0    0   2.544     84  0.06
  101  226 A   0   0   0   0   0   0   0  40   0   0  10   5   0   7   6  16   3   4   9   0   108    0    0   1.845     61  0.31
  102  227 A   0   1   0   1   2   0   5   0   2   9   4   7   5  12  37  17   0   0   0   0   111    0    0   1.956     65  0.26
  103  228 A   1  19   2   1  76   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   113    0    0   0.747     24  0.88
  104  229 A   1   0   1   1   0   0   0   2   4  18  16   6   1   0   0   2   0   2  12  36   113    0    0   1.888     63  0.31
  105  230 A   0   1   0   0   0   0   0   1   1   2   0   0   0   0   0   0   2  80   1  13   113    0    0   0.759     25  0.80
  106  231 A   4   1   4   1   0  10   0   0   6   7   1   2   0   0  16  10  24  11   0   4   113    0    0   2.277     76  0.15
  107  232 A   9   9   3   0   1   0   0   0   1   0   0   8   0   3  42  13  10   3   0   0   114    0    0   1.854     61  0.22
  108  233 A   2   0   0   0   1   0   0   1  47   0  21  24   2   0   0   0   0   2   0   1   114    0    0   1.361     45  0.46
  109  234 A   2   0   0   0   0   0   1   4  70   1  16   1   1   0   4   0   0   0   1   0   116    0    0   1.086     36  0.54
  110  235 A   1   3   2   1   1   0   3   2   2   1   1  40   0   4  12   9  12   1   3   4   116    0    0   2.121     70  0.19
  111  236 A   3   1  12   0   7   0  75   0   0   0   0   0   0   1   1   0   0   0   0   1   115    0    0   0.919     30  0.67
  112  237 A  17   4  50  16   2   0   0   0   3   0   1   5   1   1   0   0   1   0   0   0   115    0    0   1.554     51  0.54
  113  238 A   1   3   0   3   3   1  21   2  32   0   1   7   1   1   4   5   2  13   1   1   115    0    0   2.148     71  0.11
  114  239 A   0   0   1   2   0   0   0   1   1   3  14   0   0   0   0   0  50  29   0   0   115    0    0   1.267     42  0.48
  115  240 A  10  48  17  21   1   0   0   0   1   0   1   2   0   0   0   0   0   0   0   0   115    0    0   1.407     46  0.66
  116  241 A   6   3   5   2   1   0   1   1  70   0   6   3   2   0   0   0   0   0   0   0   115    0    0   1.218     40  0.49
  117  242 A   0   4   0   0   0   0   0   5  10   0  10   2   0   1   8   3   3   7  16  31   115    0    0   2.113     70  0.29
  118  243 A   0   0   0   1   0   0   0   3  95   0   0   0   0   0   1   0   0   0   0   0   116    0    0   0.248      8  0.91
  119  244 A   3  89   3   1   1   0   0   0   1   0   0   0   1   0   0   0   1   0   0   0   116    0    0   0.543     18  0.85
  120  245 A   0  13  12   3   0   0   0   1   8   0  13   4   0   5   3  12   2   6   7  10   116    0    0   2.458     82  0.12
  121  246 A   2   0   0   0   3   0  93   0   1   0   0   0   0   1   0   0   0   0   0   1   116    0    0   0.354     11  0.88
  122  247 A   0  31   2   9   0   0   0   0   0   0   0   0  58   0   0   0   0   0   0   0   116    0    0   0.974     32  0.21
  123  248 A   0   0   0   0   0   0   0   0   0   1   1   0   0  98   0   0   0   0   0   0   116    0    0   0.099      3  0.97
  124  249 A   1   2   1   0   0   0   0   9   6   0  24   2   0   2   7  19   9  15   0   3   116    0    0   2.149     71  0.25
  125  250 A   0   2   0   1   1   1   0   0   0   0   0   0   3   4  13  66   4   0   6   0   116    0    0   1.270     42  0.50
  126  251 A   0   0   0   0   0   0   0  10   0   0   2   0   3  30   9  22   3   0  19   3   116    0    0   1.829     61  0.28
  127  252 A  72   1  24   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.712     23  0.83
  128  253 A   3   6  78   9   0   0   0   0   2   0   0   0   2   0   0   0   0   0   0   0   116    0    0   0.846     28  0.75
  129  254 A   0   0   0   0   0   0   1   0   0   0   0   0   0  99   0   0   0   0   0   0   116    0    0   0.050      1  0.98
  130  255 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   116    0    0   0.000      0  1.00
  131  256 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   116    0    0   0.000      0  1.00
  132  257 A   4  14  82   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.572     19  0.84
  133  258 A   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0  98   0   0   0   0   116    0    0   0.087      2  0.96
  134  259 A   0   5   0   0   0   0   0   0   0  95   0   0   0   0   0   0   0   0   0   0   116    0    0   0.204      6  0.85
  135  260 A   0   0   0   0   0   0   0   0   1   0   2   0   0   0   0   0   1  92   0   4   116    0    0   0.362     12  0.89
  136  261 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   116    0    0   0.000      0  1.00
  137  262 A   3  63  31   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.865     28  0.76
  138  263 A   0  95   2   2   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.260      8  0.97
  139  264 A  14  57  22   4   3   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   116    0    0   1.196     39  0.71
  140  265 A   0   0   0   0   0   0   0  70   3   1   3   8   0   0   0   0   0   0   3  13   116    0    0   1.060     35  0.64
  141  266 A   0  12  18   1  14   0   4   3  16   2  11   1   1  10   1   2   2   0   2   1   114    0    0   2.334     77  0.12
  142  267 A   0   0   0   0   1   0   2   2   7   0   3   3   1  12   9   8  11   8  23   9   116    0    0   2.322     77  0.27
  143  268 A   0   1   1   2   1   0   0  78   0   0   0   0   1   0   0   1   2   0  11   3   116    0    0   0.875     29  0.63
  144  269 A   8   0   0   0   0   0   0   0   1   0   1  11   0   4   6   0   2  53   7   7   116    0    0   1.604     53  0.37
  145  270 A  16  55  28   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   116    0    0   1.021     34  0.71
  146  271 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  98   1   0   0   0   116    0    0   0.099      3  0.98
  147  272 A   1  32  67   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.672     22  0.77
  148  273 A   1   0   0   0   0   0   0   6  63   0  15  15   1   0   0   0   0   0   0   0   116    0    0   1.106     36  0.56
  149  274 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   116    0    0   0.000      0  1.00
  150  275 A   0   1   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.050      1  1.00
  151  276 A   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   1   0   0   116    0    0   0.050      1  0.99
  152  277 A   0   9   1   1   3  83   2   0   0   0   1   0   1   0   0   0   0   0   0   0   116    0    0   0.708     23  0.74
  153  278 A   0   0   1   0   0   0   0   2  11   0  85   1   0   0   0   0   0   0   0   0   116    0    0   0.532     17  0.77
  154  279 A   7  35   3  39   7   0   0   1   2   0   2   1   0   0   3   0   0   0   1   0   114    0    0   1.565     52  0.57
  155          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  156  290 A   4   2   0   0   0   0   0   0   0   0   0   0  93   0   1   1   0   0   0   0   114    0    0   0.339     11  0.79
  157  291 A   1   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   115    0    0   0.050      1  0.99
  158  292 A   0   0   0   0   0   0   0   0   0   0   3  97   0   1   0   0   0   0   0   0   115    0    0   0.171      5  0.93
  159  293 A   3  71  10   2   1   0   0   0   2  11   0   0   0   0   0   0   0   0   0   0   115    0    0   1.011     33  0.56
  160  294 A   0   0   0   0   0   0   1   2   1   1   0   0   0   0   0   0   0   3   3  90   115    0    0   0.505     16  0.85
  161  295 A   0   0   0   0   0   1  98   0   0   0   0   0   0   0   0   0   0   0   1   0   115    0    0   0.100      3  0.98
  162  296 A   3  89   2   3   2   0   0   0   1   0   1   0   0   0   0   0   0   0   1   0   115    0    0   0.561     18  0.86
  163  297 A   0   0   0   0   0   1   0   0  17  64  17   0   0   0   0   1   0   0   0   0   116    0    0   0.975     32  0.54
  164  298 A   0   0   0   0   0   0   0   0   0  98   0   0   0   1   1   0   0   0   0   0   116    0    0   0.099      3  0.96
  165  299 A   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   1  98   0   0   116    0    0   0.099      3  0.96
  166  300 A   8   6   7  77   0   0   0   1   0   0   0   0   0   1   0   0   0   0   0   1   116    0    0   0.878     29  0.73
  167  301 A  39  17  39   1   0   0   1   0   2   0   0   1   0   1   0   0   0   0   0   0   116    0    0   1.272     42  0.67
  168  302 A   1   5   1   3   0   0   0   0   3   1   5   3   0   0   7   9   3  50   3   5   116    0    0   1.884     62  0.30
  169  303 A   2   1   0   0   0   0   1  47   3   9  12   0   2   1   5   4   2   1  10   0   116    0    0   1.824     60  0.34
  170  304 A   3   0   0   1   1   0   0  13   0   2   3   3   0   3  32  23   4   8   3   1   116    0    0   2.032     67  0.27
  171  305 A   1   0   2  10   2   2  10   6   7  10   4  17   0   0   2   3   0  22   0   3   115    0    0   2.363     78  0.10
  172  306 A   0   0   0   0   0   0  44   0   0   0   0   0   0  54   0   0   0   0   1   1   115    0    0   0.776     25  0.55
  173  307 A   0   0   0   0   0   0   0  11   1   0   9   8   0   0   0   0   0   0  17  54   115    0    0   1.337     44  0.53
  174  308 A   0   3   2   2   2   0   9   1   9   3   1   3   0   6   1   5   1  46   3   5   115    0    0   2.039     68  0.23
  175  309 A   0   0   0   3   0   0   2   1  14   1  10   8   0   2   4  45   1   4   6   0   115    0    0   1.860     62  0.30
  176  310 A  86   0   6   0   0   0   0   0   3   0   1   3   0   0   0   0   0   0   0   0   116    0    0   0.571     19  0.81
  177  311 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   116    0    0   0.000      0  1.00
  178  312 A  11  46  14   1   0   4   3   0   4   0   2   0   2   3   0   0   3   0   7   0   116    0    0   1.840     61  0.31
  179  313 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.000      0  1.00
  180  314 A   0   0   0   0   0   0   0   0  23   0  51   7  19   0   0   0   0   0   0   0   116    0    0   1.183     39  0.53
  181  315 A   3  76  16   0   0   0   1   0   3   0   0   0   1   0   0   0   0   0   0   0   116    0    0   0.798     26  0.73
  182  316 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.000      0  1.00
  183  317 A  76   0  19   0   0   0   0   0   1   0   0   1   3   0   0   0   0   0   0   0   116    0    0   0.723     24  0.81
  184  318 A   4  84   9   2   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.648     21  0.83
  185  319 A   2   8   4   3   1   0   0   1   9   0   0  22  50   0   0   0   0   0   0   0   116    0    0   1.495     49  0.27
  186  320 A   0   0   0   0  15   0  85   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.417     13  0.98
  187  321 A   1   0   2   1   0   0   0   0   2   0   0   1   0   0   0   0   0  94   0   0   116    0    0   0.321     10  0.84
  188  322 A   1  35   0   4  58   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   116    0    0   0.931     31  0.81
  189  323 A   6  91   3   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.395     13  0.91
  190  324 A  67   0   1   1   3   0  12   1   2   0   2   9   2   0   0   0   0   0   0   0   116    0    0   1.195     39  0.47
  191  325 A   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   1   0   116    0    0   0.050      1  0.99
  192  326 A   6   1   2   3   2   0   5   1   7   0  10   1   2   3   6  22   3  12  14   0   116    0    0   2.435     81  0.13
  193  327 A   0   1   0   0   0   0   0   0  18  77   2   3   0   0   0   0   0   0   0   0   116    0    0   0.718     23  0.71
  194  328 A   0   0   0   0   0   0   0   0   1  99   0   0   0   0   0   0   0   0   0   0   116    0    0   0.050      1  0.99
  195  329 A   0   0   0   0  99   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   116    0    0   0.050      1  1.00
  196  330 A   1   3   0   0   3   0   3   0   3   0   1   1   0   2   0   0   3  75   3   3   116    0    0   1.135     37  0.54
  197  331 A   0   0   0   0   0   0   0   1  31   0  25   8   2   0   1   0   0  12   2  18   115    0    0   1.701     56  0.36
  198  332 A   1   2   0   1   0   0   0   0   9   7   8  11   0   1   2  16   4  19   7  14   116    0    0   2.300     76  0.27
  199  333 A   1   0   0   3   1   0   0   6   1   9  28  24   1   1   1   2   1   9   6   6   116    0    0   2.117     70  0.27
  200  334 A   2   0   0   3   2   0   9   1   0   7   5   3   0  32   2  12  14   2   4   3   102    0    0   2.227     74  0.17
  201  335 A  11   1   2   2   1   0   0   0   4   0  13   9   0   0   1   9  12  16   9  12   112    0    0   2.339     78  0.21
  202  336 A   1   6   1  13   0   0   1   1   3   0   4   4   0   2   1   5   1  43   3  13   114    0    0   1.970     65  0.27
  203  337 A   1   2   6   2   0   0   0   0   0   0   0  87   0   0   1   0   2   0   0   0   115    0    0   0.586     19  0.71
  204  338 A   0   6   3   1  11   0  62   0   0   1   1   1   1   3   3   0   6   0   0   1   116    0    0   1.453     48  0.48
  205  339 A   1   1   0   1   0   0   0   0   6   0   2   1   0   1  42  28   5   6   3   3   116    0    0   1.699     56  0.38
  206  340 A   0   3   0   1   0   0   0   0   5   0   0   1   0   0  66  18   0   0   7   0   116    0    0   1.101     36  0.52
  207  341 A   3   1  95   0   0   0   0   1   0   0   0   0   0   0   0   0   0   1   0   0   115    0    0   0.270      9  0.92
  208  342 A  19  20   2   4   0   0   0   0  19   0  13   6   0   1   6   5   0   3   0   1   115    0    0   2.121     70  0.18
  209  343 A   0   3   0   0   0   0   0   1   7   1   3   3   0   1  35  35   3   3   3   3   115    0    0   1.775     59  0.37
  210  344 A  49   8   3   2   0   0   0  17   7   0   0   0   5   0   6   1   0   0   2   0   115    0    0   1.663     55  0.31
  211  345 A   3   1   2   0   1   0   0   0   0   0   1   0   0   0   7   3   3  25   5  51   114    0    0   1.513     50  0.48
  212  346 A   8  36  14  11  12   0  17   0   1   1   0   0   0   0   0   0   0   0   0   0   114    0    0   1.731     57  0.52
  213  347 A   4   2   2   0   1   0   2   1   2   2   4  25   0   4  10  28   5   4   4   3   114    0    0   2.226     74  0.21
  214  348 A  10   4  10   4  55   4  11   0   0   2   0   0   0   0   0   0   0   0   0   1   114    0    0   1.511     50  0.58
  215  349 A   1   1   0   0   0   0   0   0   2  95   0   0   0   0   0   0   0   2   0   0   114    0    0   0.276      9  0.89
  216  350 A   2   3   2   0   0   0   0   4   5  27  22   1   1   3   3   4   1   9   2  12   113    0    0   2.203     73  0.25
  217  351 A   4   2   2   1  23   2   8   3   3   2  13   5   2  15   0   0   3   2   9   4   114    0    0   2.466     82  0.09
  218  352 A  55  11  19  10   1   0   0   0   2   0   0   1   0   0   1   0   0   0   0   0   114    0    0   1.314     43  0.68
  219  353 A   0   0   0   0   0   0   0   1   1  18  69   9   0   0   0   1   0   0   0   2   114    0    0   0.969     32  0.63
  220  354 A   3   7   0   0   1   0   0   1  13  18  11   4   1   1   2   5   4  16   1  13   114    0    0   2.344     78  0.20
  221  355 A   0   0   1   0   0   0   0  35   9   2   2   3   0   0   0   0   1  34   1  13   114    0    0   1.577     52  0.49
  222  356 A   4   0   0   0   0   0   0   4  85   1   3   0   4   0   0   0   0   0   0   0   114    0    0   0.647     21  0.78
  223  357 A   2   2   0   0   0   0   0   0   4   0   1   0   0   0  35  45  12   0   0   0   114    0    0   1.286     42  0.53
  224  358 A   0   0   0   0   0   0   0   1   1   0   4   0   0   6   0   0   1   2   4  82   114    0    0   0.788     26  0.76
  225  359 A   0  85   1   1  12   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   114    0    0   0.520     17  0.93
  226  360 A   9   3  88   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   114    0    0   0.466     15  0.91
  227  361 A   1   4   0   0   0   0   1   3   6   0  40   6   2   3  10  16   2   1   3   4   114    0    0   2.034     67  0.24
  228  362 A   0   0   1   0   0   0   0   5   2   0   2   0   0   0  32  48  10   0   1   0   114    0    0   1.321     44  0.51
  229  363 A   3  87   4   5   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   112    0    0   0.559     18  0.89
  230  364 A   0  96   3   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   111    0    0   0.175      5  0.97
  231  365 A  35   0   3   0   0   0   0   0   1   0   0   4   1   3  16  24  11   2   0   1   110    0    0   1.764     58  0.21
  232  366 A   5  16   2   0   1   0  14   0   0   5   2   2   0  23  11  21   0   0   0   0   110    0    0   2.016     67  0.11
  233  367 A   0   1   1   0   0   0   0   0   0   0   2   1   1   2   1   5   5  11  26  44   110    0    0   1.632     54  0.52
  234  368 A   1   1   0   0   0   0   0   1   3  79  15   1   0   0   0   0   0   0   0   0   110    0    0   0.735     24  0.72
  235  369 A   0   5   1   3   1   0   0   4   7   2  35   5   0   2   3   9   4  17   4   0   110    0    0   2.150     71  0.24
  236  370 A   0   1   0   0   0   0   0   2   2   0   1   1   0  11   4  29  23  14   2  12   110    0    0   1.929     64  0.38
  237  371 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   110    0    0   0.000      0  1.00
  238  372 A   2  48  23  12   0   0   0   1   1  13   0   0   0   0   1   0   0   0   0   0   109    0    0   1.410     47  0.48
  239  373 A   0   0   0   2   0   0   0   6   6  39  27  14   1   0   4   0   0   0   3   1   109    0    0   1.692     56  0.38
  240  374 A   2  85   5   0   1   0   0   1   6   0   0   0   0   0   0   0   0   1   0   0   109    0    0   0.639     21  0.74
  241  375 A   6   0   0   0   0   0   0   6  14   3   2   6   0   6   5  14   7  16   3  16   109    0    0   2.368     79  0.25
  242  376 A   0   1   0   0   0   0   0   8   3   0   2   1   0   1   2   8  21  28   2  24   109    0    0   1.885     62  0.47
  243  377 A  69   5  18   1   0   0   0   0   7   0   0   0   0   0   0   0   0   0   0   0   109    0    0   0.944     31  0.73
  244  378 A   1  37   6  17   0   0   0   0   4   0   4   0   0   0   5  14   9   5   1   0   109    0    0   1.928     64  0.27
  245  379 A   3   2   1   4   0   0   0   2  13   0   6   7   2   0   7  13  12  22   4   4   109    0    0   2.383     79  0.21
  246  380 A   0   0   0   0   0   0   0   0   0   0   0   0   0  97   0   0   0   0   2   1   109    0    0   0.144      4  0.96
  247  381 A   0   0   0   0   2   0   2   0   4  85   3   1   0   0   1   0   2   1   0   0   109    0    0   0.705     23  0.73
  248  382 A   0   0   0   0   8  92   0   0   0   0   0   0   0   0   0   0   0   0   0   0   109    0    0   0.285      9  0.97
  249  383 A  21   5  64   3   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   109    0    0   1.045     34  0.75
  250  384 A  19  19  15   0   1   0   0   0   2   0   0   7   0   0   9  15  11   1   1   0   100    0    0   2.062     68  0.21
  251  385 A   0   1   0   0   0   0   0   1  29   0   2   3   0   0   6  38   6   6   3   3    95    0    0   1.756     58  0.31
  252  386 A   0   0   0   0   0   0   4   0   0   0   4   0   0  39   0   2   0   0  50   1    84    0    0   1.093     36  0.54
  253  387 A   3   0   3   0   0   0   0   0  27   0  41   3   0   0   6  14   2   0   0   2    64    0    0   1.622     54  0.28
  254  388 A   0   0   0   0   0   0   0   4   7  44  37   7   0   0   0   0   0   0   0   0    27    0    0   1.236     41  0.46
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     1   154   279    10 sVHAPSSRRTTl
     2   154   278    10 sVHAPSSRRTTl
     3   154   279    10 sVHAPSSRRTTl
     4   154   266    10 sVHAPSSRRTTl
     5    96   221     3 rELRe
     5   154   282    10 sVHAPSSRRTTl
     6   154   278    10 sVHAPSSRRTTl
     7   154   261    10 sVHAPSSRRTTl
     8   154   286    10 sVHAPSSRRTTl
     9   154   292    10 sVHAPSSRRTTl
    10   153   155    10 sVHTPSSRRSTl
    10   214   226     2 pAHt
    11   154   300    10 sVHTPSSRRSTl
    11   215   371     2 pTQa
    12   154   296    10 sVHTPSSRRSTl
    12   215   367     2 pTQa
    13    96   235     2 kEMq
    13   154   295    10 sVHAPSSRRATl
    14   154   223    10 sVHAPSLRRKTm
    15   154   160    10 sVHTPSLRRKTm
    16   154   218    10 sVHAPSLRRKTm
    17   154   172    10 sVHTLSLRRKTm
    18   154   189    10 sVHTPSLRRKTm
    19   153   188    10 sVHAPSSKRQTl
    20   154   181     9 sVHTFNRRRTm
    21   154   223    10 sVHAPSLRRKTm
    22   154   222    10 sVHAPSLRRKTm
    23   154   189    10 sVHTPSLRRKTm
    24   154   239    10 sVHAPSLRRRTm
    25   154   193    10 sVHAPSSRRETm
    26   154   271    10 sVHAPNSRRKTl
    26   215   342     2 pPTp
    27   154   156    10 sVHAPSLRRRTm
    28   154   187    10 sVHTPSLRRKTa
    29   111   119     2 tVRi
    29   154   164    10 sVHTLSLRRKTm
    30   154   181     9 sVHTFSRRRTm
    30   215   251     2 pPTp
    31   154   183     9 sVHTFDRRRTm
    31   215   253     2 pPRp
    32   154   175     9 sVHTFNRRRTm
    32   215   245     2 pLKp
    33   154   176     9 sVHTFNRRRTm
    33   215   246     2 pPKp
    34   154   192    10 aVHAPSSRRKTl
    34   215   263     2 pEHi
    35   154   211    10 sVHAPSLRRRTm
    36   154   185     9 sVHTFNRRRTm
    36   215   255     2 pAKp
    37   154   210    10 sVHAPSLRRRTm
    38   154   170     9 sVHTFNRRRTm
    38   215   240     2 pLKp
    39   154   210    10 sVHAPSNRRRTl
    39   215   281     2 pDTp
    40    95   164     2 sTLm
    40   153   224    10 sVHAPSSRRTTl
    41   154   227    10 aVHAPTSRRKTl
    42   154   160    10 sVHEPSSKRQTi
    42   215   231     2 pSDi
    43   154   235    10 sVHAPSNRRTTl
    43   199   290     1 sGh
    44    96   209     2 sKLq
    44   154   269    10 sVHEPTSTRTTl
    45    96   235     2 nALq
    45   154   295    10 sVHEPNSMRMTl
    46   154   259    10 sVHAPNNRRKTm
    46   170   285     4 gSQDNy
    47   154   168     9 sVQSSNKRKTm
    47   215   238     2 pLTp
    48   153   180    10 sVHAPSNKRQTm
    49   154   165     9 sVQSRSKRQTm
    49   215   235     2 pSAp
    50    96   252     2 nALq
    50   154   312    10 sVHEPNSMRMTl
    51   153   204    10 sVHAPSNKRRTm
    52   147   148    10 sVHAPNKRRNTm
    52   163   174     4 gSSENf
    53   154   168     9 sVQSSNKRKTm
    53   215   238     2 pTTp
    54    31   183     1 ePr
    54   154   307    10 sVHAPGNRRMTl
    54   199   362     1 nSv
    55   123   143     9 sVQSRSKRHTm
    55   184   213     2 pSHp
    56    48   174     1 gTg
    56   154   281    10 sVHAPNNRRKTl
    56   170   307     4 gSRDNw
    57   154   262    10 sVHAPNGRRNTm
    57   170   288     2 nSNy
    58    31   150     1 pPq
    58   154   274    10 sVHAPGNRRTTl
    58   199   329     1 sGq
    59   154   262    10 sVHAPNNRRNTm
    59   170   288     4 gLQDNy
    60   154   262    10 sVHAPNNRRNTm
    60   170   288     4 gLQDNy
    61   154   262    10 sVHAPNNRRNTm
    61   170   288     4 gLQDNy
    62   154   231    10 sVHAPNTKRNTf
    63   168   284     3 sSDNy
    64   154   276    10 sVHAPNSRRKTm
    64   170   302     4 gSSDNt
    65   154   261    10 sVHAPNNRRNTm
    65   170   287     4 gSQDNy
    66   154   265    10 sVHAPNNRRNTm
    66   170   291     4 gGKDNf
    67   152   158     9 aARSNAKRHTl
    67   213   228     2 pSSp
    68   154   253    10 sVHAPNNRRQTm
    68   170   279     4 gSQENy
    69   151   211    11 sVYSNQSMKRTTm
    70    31   170     1 ePn
    70   154   294    10 sVHAPSNRRTTl
    70   199   349     1 sSm
    71    95   142     2 kHLq
    71   153   202    10 sVHSPSLQRDTm
    72   153   157     9 aVRSNAKRHTl
    72   214   227     2 pKTh
    73   128   216    10 sVHAPNNRRQTm
    73   144   242     4 gNSDKw
    74    94   132     2 nVLq
    74   152   192    10 sVVADHSKRHTl
    75    95   133     2 kELk
    75   153   193    10 sVHAPSTKRNTm
    76    95   140     2 kHLk
    76   153   200    10 sAHTNSNRRKTm
    77    95   141     2 kHLr
    77   153   201    10 sAHTPNNKRRTl
    78   154   251    10 sVHDPRPRRRTf
    78   199   306     1 dDt
    78   200   308     1 tVe
    79    42   111    39 tVGKGWAPGTPTVGLRLGAGRVLLAAGGLSRSDRLSLAFPd
    79    85   193    10 sVHAPSLRRKTm
    80    95   141     2 kHLr
    80   153   201    10 sAHTPNNKRKTl
    81   151   175    12 sSANVTAANRRDTl
    82   154   206    12 sVHAPTPNNVRKTf
    82   215   279     2 pSTp
    83   153   190    12 sVHAPKPYNLRKTf
    83   214   263     2 pSSp
    84   154   255    11 sVITPKGSKRKTl
    85   154   255    11 sIINPRGTKRKTm
    86   154   192    10 sVHAPSNRRGTl
    86   170   218     2 gRKk
    86   214   264     1 lPa
    87   154   254    11 sVINSKGFKRKTl
    88   154   246    11 sILNPEGSKRKTl
    89   154   259    11 sIINPKGLRRRTf
    90   154   250    11 sIINPPENRRKTv
    91   154   250    11 sIINPPENRRKTv
    92   154   250    11 sIINPPENRRKTv
    93   154   248    11 sIINPKGIRRKTl
    94   150   246    11 sVYNEDGQKRKTl
    95   154   250    11 sIINPPENRRKTi
    96    95   117     2 kHLt
    97   154   177    10 sVHDPLNRRKTs
    98   145   164    10 aKAIGAKRTYTl
    98   228   257     5 rYGCLAg
    99    89   101     1 rYl
    99   104   117     1 rQf
    99   147   161    12 aARLPLPGESRLTv
    99   205   231     2 eLPp
   100    87    89     2 aDLk
   100   144   148    11 tTAFQEDQMRKTf
   100   190   205     1 dMe
   101    65    90     2 kDLq
   101   122   149    10 sVYCPELKRQTf
   101   179   216    19 nIIIFYVFFFFFIINFYQNDl
   102   149   155    10 gNRQQDVLLQTv
   102   165   181     1 rGy
   103    49    49     4 eSVTNe
   103   147   151    11 sCVGVIDRTDNLn
   103   208   223     2 pDEd
   103   230   247     6 rLGHRCGv
   104    98   119     7 fSEDEARHf
   104   141   169    12 aTQLKLPTEKHFTm
   105    93    93     1 dFl
   105   108   109     1 rVv
   105   151   153    10 aIDQKFEQANTr
   106    97    98     6 tESEARDv
   106   123   130     1 nLl
   106   127   135     2 gKQc
   106   140   150    11 aRKAPAEDSLKTv
   106   201   222     4 vDKYWg
   107    49    50     4 eSVTNe
   107   145   150    28 gLSCSGSQHGGASGRVSVPGQALGAAASSl
   107   147   180    21 gLPPRPVVQHQRIVAPEHESRRa
   107   208   262     2 pDEd
   107   230   286     3 rLGHr
   108   143   143    12 aCHLPSPAARRHSt
   108   159   171     2 gPAg
   108   203   217     2 pEDv
   109    46    46     4 sQAMAe
   109   144   148    22 sNIGISRDQRHHGGGSGENSEAGg
   109   205   231     3 eEEDd
   109   227   256     4 rLGSRp
   110    94    94    18 iIKSNVANDNKELKKVAQFy
   110   137   155    10 aKKIDRPGPNTf
   111    40    57    13 rIKLNEIERHQAGIa
   111    53    83    10 fIHAPAAPVARe
   111    93   133     1 sYl
   111   108   149     1 pLi
   111   151   193    10 sIDSKQEIANTr
   111   167   219    14 pVKQHPEDHKDRPDTg
   111   196   262     1 tAq
   112    96   100     8 gVAEGTAKRh
   112   122   134     1 nVv
   112   139   152    11 sNLFKPGIMLATs
   112   155   179     1 eEy
   113   104   125     9 rADEATVVKTv
   113   147   177    10 aINMVEERPVSr
   113   163   203     5 gPTTPAr
   113   201   246     4 iAAAPp
   114    44    49     1 hKn
   114    52    58    11 nEPDLLAERTIMk
   114   101   118    10 gEAFDIDVVRHi
   114   144   171    11 sEIDEIEESEIQv
   114   201   239     7 rINWVDERl
   115    44    52     6 rECLEKEp
   115    80    94     1 gDd
   115    88   103    10 rGPLMEPEAAQi
   115   131   156    14 aEWFGMNCESGMMEGi
   115   192   231     4 pHRLFr
//