Complet list of 2pks hssp fileClick here to see the 3D structure Complete list of 2pks.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      2PKS
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-05-24
HEADER     HYDROLASE/HYDROLASE INHIBITOR           18-APR-07   2PKS
COMPND     MOL_ID: 1; MOLECULE: THROMBIN LIGHT CHAIN; CHAIN: A; FRAGMENT: RESIDUE
SOURCE     MOL_ID: 1; ORGANISM_SCIENTIFIC: HOMO SAPIENS; ORGANISM_COMMON: HUMAN; 
AUTHOR     Y.XUE
DBREF      2PKS A    7    33  UNP    P00734   THRB_HUMAN     334    360
DBREF      2PKS B   37   183  UNP    P00734   THRB_HUMAN     364    510
DBREF      2PKS C  185   286  UNP    P00734   THRB_HUMAN     518    619
DBREF      2PKS D  355   364  UNP    P28504   HIR2_HIRME      55     64
SEQLENGTH   276
NCHAIN        3 chain(s) in 2PKS data set
NALIGN     3002
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : B4DDT3_HUMAN        1.00  1.00    1   27  183  209   27    0    0  471  B4DDT3     cDNA FLJ54622, highly similar to Prothrombin (EC 3.4.21.5) OS=Homo sapiens PE=2 SV=1
    2 : B4DDT3_HUMAN        1.00  1.00   29  175  213  359  147    0    0  471  B4DDT3     cDNA FLJ54622, highly similar to Prothrombin (EC 3.4.21.5) OS=Homo sapiens PE=2 SV=1
    3 : E9PIT3_HUMAN        1.00  1.00    1   27  334  360   27    0    0  583  E9PIT3     Thrombin light chain OS=Homo sapiens GN=F2 PE=2 SV=1
    4 : G3QVP5_GORGO        1.00  1.00    1   27  338  364   27    0    0  626  G3QVP5     Prothrombin OS=Gorilla gorilla gorilla GN=101149905 PE=3 SV=1
    5 : G3QVP5_GORGO        1.00  1.00   29  175  368  514  147    0    0  626  G3QVP5     Prothrombin OS=Gorilla gorilla gorilla GN=101149905 PE=3 SV=1
    6 : H2NDK4_PONAB        1.00  1.00    1   27  335  361   27    0    0  623  H2NDK4     Prothrombin OS=Pongo abelii GN=F2 PE=3 SV=2
    7 : H2Q3I2_PANTR        1.00  1.00   29  175  364  510  147    0    0  622  H2Q3I2     Prothrombin OS=Pan troglodytes GN=F2 PE=3 SV=1
    8 : H2Q3I2_PANTR        1.00  1.00    1   27  334  360   27    0    0  622  H2Q3I2     Prothrombin OS=Pan troglodytes GN=F2 PE=3 SV=1
    9 : Q5NVS1_PONAB        1.00  1.00    1   27  335  361   27    0    0  427  Q5NVS1     Putative uncharacterized protein DKFZp470K2111 OS=Pongo abelii GN=DKFZp470K2111 PE=2 SV=1
   10 : Q69EZ8_HUMAN1WBG    1.00  1.00    1   27    7   33   27    0    0  295  Q69EZ8     Prothrombin (Fragment) OS=Homo sapiens PE=1 SV=1
   11 : Q69EZ8_HUMAN1WBG    1.00  1.00   29  175   37  183  147    0    0  295  Q69EZ8     Prothrombin (Fragment) OS=Homo sapiens PE=1 SV=1
   12 : THRB_HUMAN  3JZ1    1.00  1.00   29  175  364  510  147    0    0  622  P00734     Prothrombin OS=Homo sapiens GN=F2 PE=1 SV=2
   13 : THRB_HUMAN  3JZ1    1.00  1.00    1   27  334  360   27    0    0  622  P00734     Prothrombin OS=Homo sapiens GN=F2 PE=1 SV=2
   14 : THRB_PONAB          1.00  1.00    1   27  335  361   27    0    0  623  Q5R537     Prothrombin OS=Pongo abelii GN=F2 PE=2 SV=1
   15 : H2NDK4_PONAB        0.99  1.00   29  175  365  511  147    0    0  623  H2NDK4     Prothrombin OS=Pongo abelii GN=F2 PE=3 SV=2
   16 : THRB_PONAB          0.99  1.00   29  175  365  511  147    0    0  623  Q5R537     Prothrombin OS=Pongo abelii GN=F2 PE=2 SV=1
   17 : B4DDT3_HUMAN        0.98  0.98  177  278  367  468  103    2    2  471  B4DDT3     cDNA FLJ54622, highly similar to Prothrombin (EC 3.4.21.5) OS=Homo sapiens PE=2 SV=1
   18 : E9PIT3_HUMAN        0.98  0.98  177  278  479  580  103    2    2  583  E9PIT3     Thrombin light chain OS=Homo sapiens GN=F2 PE=2 SV=1
   19 : Q69EZ8_HUMAN1WBG    0.98  0.98  177  278  191  292  102    0    0  295  Q69EZ8     Prothrombin (Fragment) OS=Homo sapiens PE=1 SV=1
   20 : A0N064_MACMU        0.97  0.99   29  175  369  515  147    0    0  627  A0N064     Prothrombin OS=Macaca mulatta PE=2 SV=1
   21 : F7CHB6_MACMU        0.97  0.99   29  175  362  508  147    0    0  550  F7CHB6     Uncharacterized protein OS=Macaca mulatta GN=F2 PE=3 SV=1
   22 : G7NDG8_MACMU        0.97  0.99   29  175  362  508  147    0    0  620  G7NDG8     Prothrombin OS=Macaca mulatta GN=EGK_06305 PE=3 SV=1
   23 : G7PQA7_MACFA        0.97  0.99   29  175  362  508  147    0    0  620  G7PQA7     Prothrombin OS=Macaca fascicularis GN=EGM_05674 PE=3 SV=1
   24 : A0N064_MACMU        0.96  0.96    1   27  339  365   27    0    0  627  A0N064     Prothrombin OS=Macaca mulatta PE=2 SV=1
   25 : F7CHB6_MACMU        0.96  0.96    1   27  332  358   27    0    0  550  F7CHB6     Uncharacterized protein OS=Macaca mulatta GN=F2 PE=3 SV=1
   26 : G7NDG8_MACMU        0.96  0.96    1   27  332  358   27    0    0  620  G7NDG8     Prothrombin OS=Macaca mulatta GN=EGK_06305 PE=3 SV=1
   27 : G7PQA7_MACFA        0.96  0.96    1   27  332  358   27    0    0  620  G7PQA7     Prothrombin OS=Macaca fascicularis GN=EGM_05674 PE=3 SV=1
   28 : Q6R6N1_PIG          0.96  0.96  178  256   68  146   79    0    0  146  Q6R6N1     Coagulation factor II (Fragment) OS=Sus scrofa PE=2 SV=1
   29 : F6QU36_CALJA        0.94  0.99   29  175  213  359  147    0    0  470  F6QU36     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=F2 PE=3 SV=1
   30 : F6QU36_CALJA        0.94  0.96  179  278  368  467  101    2    2  470  F6QU36     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=F2 PE=3 SV=1
   31 : F6QU78_CALJA        0.94  0.99   29  175  364  510  147    0    0  621  F6QU78     Prothrombin OS=Callithrix jacchus GN=F2 PE=3 SV=1
   32 : G3GYJ4_CRIGR        0.94  0.99   29  175  361  507  147    0    0  618  G3GYJ4     Prothrombin OS=Cricetulus griseus GN=I79_002873 PE=3 SV=1
   33 : E2RRM2_CANFA        0.93  0.98   29  175  363  509  147    0    0  600  E2RRM2     Uncharacterized protein OS=Canis familiaris GN=F2 PE=3 SV=2
   34 : F1SIB1_PIG          0.93  0.99   29  175  365  511  147    0    0  623  F1SIB1     Prothrombin OS=Sus scrofa GN=F2 PE=3 SV=2
   35 : I3M5J3_SPETR        0.93  0.99   29  175  365  511  147    0    0  622  I3M5J3     Prothrombin OS=Spermophilus tridecemlineatus GN=F2 PE=3 SV=1
   36 : J9NSF9_CANFA        0.93  0.98   29  175  363  509  147    0    0  621  J9NSF9     Prothrombin OS=Canis familiaris GN=F2 PE=3 SV=1
   37 : THRB_PIG            0.93  0.99   29  175  365  511  147    0    0  623  Q19AZ8     Prothrombin OS=Sus scrofa GN=F2 PE=2 SV=1
   38 : B3STX9_PIG          0.92  0.99   29  175  365  511  147    0    0  623  B3STX9     Prothrombin OS=Sus scrofa PE=2 SV=1
   39 : D2HHJ1_AILME        0.91  0.98   29  174  364  509  146    0    0  626  D2HHJ1     Prothrombin (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_010583 PE=3 SV=1
   40 : G1LK81_AILME        0.91  0.98   29  174  370  515  146    0    0  628  G1LK81     Uncharacterized protein OS=Ailuropoda melanoleuca GN=F2 PE=3 SV=1
   41 : G3V843_RAT          0.91  0.98   29  175  360  506  147    0    0  617  G3V843     Prothrombin OS=Rattus norvegicus GN=F2 PE=3 SV=1
   42 : THRB_RAT            0.91  0.98   29  175  360  506  147    0    0  617  P18292     Prothrombin OS=Rattus norvegicus GN=F2 PE=1 SV=1
   43 : U6DFN0_NEOVI        0.91  0.97   29  174  361  506  146    0    0  619  U6DFN0     Prothrombin (Fragment) OS=Neovison vison GN=THRB PE=2 SV=1
   44 : H7BX99_MOUSE        0.90  0.98   29  175  360  506  147    0    0  617  H7BX99     Prothrombin OS=Mus musculus GN=F2 PE=2 SV=1
   45 : M3WSI8_FELCA        0.90  0.96   29  175  364  510  147    0    0  622  M3WSI8     Prothrombin OS=Felis catus GN=F2 PE=3 SV=1
   46 : Q3TJ94_MOUSE        0.90  0.98   29  175  361  507  147    0    0  618  Q3TJ94     Prothrombin OS=Mus musculus GN=F2 PE=2 SV=1
   47 : THRB_MOUSE  3HKI    0.90  0.98   29  175  361  507  147    0    0  618  P19221     Prothrombin OS=Mus musculus GN=F2 PE=1 SV=1
   48 : B3STX9_PIG          0.89  0.96    1   27  335  361   27    0    0  623  B3STX9     Prothrombin OS=Sus scrofa PE=2 SV=1
   49 : F1SIB1_PIG          0.89  0.96    1   27  335  361   27    0    0  623  F1SIB1     Prothrombin OS=Sus scrofa GN=F2 PE=3 SV=2
   50 : F7BFJ1_HORSE        0.89  1.00    1   27  335  361   27    0    0  623  F7BFJ1     Prothrombin OS=Equus caballus GN=F2 PE=3 SV=1
   51 : G3T5I1_LOXAF        0.89  0.96    1   27  335  361   27    0    0  619  G3T5I1     Prothrombin OS=Loxodonta africana GN=F2 PE=3 SV=1
   52 : G3T5I1_LOXAF        0.89  0.97   29  175  365  511  147    0    0  619  G3T5I1     Prothrombin OS=Loxodonta africana GN=F2 PE=3 SV=1
   53 : G3V843_RAT          0.89  0.96    1   27  330  356   27    0    0  617  G3V843     Prothrombin OS=Rattus norvegicus GN=F2 PE=3 SV=1
   54 : H0WQ57_OTOGA        0.89  0.93    1   27  334  360   27    0    0  622  H0WQ57     Prothrombin OS=Otolemur garnettii GN=F2 PE=3 SV=1
   55 : L5KXF6_PTEAL        0.89  0.93    1   27  340  366   27    0    0  644  L5KXF6     Prothrombin OS=Pteropus alecto GN=PAL_GLEAN10018124 PE=3 SV=1
   56 : L9JIA5_TUPCH        0.89  0.96    1   27  417  443   27    0    0  707  L9JIA5     Prothrombin OS=Tupaia chinensis GN=TREES_T100014328 PE=3 SV=1
   57 : M3WSI8_FELCA        0.89  0.93    1   27  334  360   27    0    0  622  M3WSI8     Prothrombin OS=Felis catus GN=F2 PE=3 SV=1
   58 : THRB_PIG            0.89  0.96    1   27  335  361   27    0    0  623  Q19AZ8     Prothrombin OS=Sus scrofa GN=F2 PE=2 SV=1
   59 : THRB_RAT            0.89  0.96    1   27  330  356   27    0    0  617  P18292     Prothrombin OS=Rattus norvegicus GN=F2 PE=1 SV=1
   60 : H0WQ57_OTOGA        0.88  0.97   29  174  364  509  147    2    2  622  H0WQ57     Prothrombin OS=Otolemur garnettii GN=F2 PE=3 SV=1
   61 : L5KXF6_PTEAL        0.88  0.96   29  175  370  516  147    0    0  644  L5KXF6     Prothrombin OS=Pteropus alecto GN=PAL_GLEAN10018124 PE=3 SV=1
   62 : L5LC83_MYODS        0.88  0.96   29  175  366  512  147    0    0  639  L5LC83     Prothrombin OS=Myotis davidii GN=MDA_GLEAN10019057 PE=3 SV=1
   63 : S7N3A9_MYOBR        0.88  0.96   29  175  366  512  147    0    0  640  S7N3A9     Prothrombin OS=Myotis brandtii GN=D623_10025513 PE=3 SV=1
   64 : G5ATC4_HETGA        0.87  0.97   29  174  339  484  146    0    0  652  G5ATC4     Prothrombin OS=Heterocephalus glaber GN=GW7_01180 PE=3 SV=1
   65 : Q28731_RABIT        0.87  0.98  178  278  133  233  101    0    0  235  Q28731     Thrombin (Fragment) OS=Oryctolagus cuniculus GN=thrombin PE=2 SV=1
   66 : Q28731_RABIT        0.87  0.93   52  174    1  123  123    0    0  235  Q28731     Thrombin (Fragment) OS=Oryctolagus cuniculus GN=thrombin PE=2 SV=1
   67 : S7N3U0_MYOBR        0.87  0.95  178  278   82  182  101    0    0  185  S7N3U0     Prothrombin OS=Myotis brandtii GN=D623_10020789 PE=3 SV=1
   68 : F7BFJ1_HORSE        0.86  0.97   29  175  365  511  147    0    0  623  F7BFJ1     Prothrombin OS=Equus caballus GN=F2 PE=3 SV=1
   69 : G1PXB6_MYOLU        0.86  0.96   29  175  366  512  147    0    0  624  G1PXB6     Prothrombin OS=Myotis lucifugus GN=F2 PE=3 SV=1
   70 : G1TB36_RABIT        0.86  0.92   29  174  360  505  146    0    0  617  G1TB36     Prothrombin OS=Oryctolagus cuniculus GN=F2 PE=3 SV=1
   71 : L8IEX7_9CETA        0.86  0.97   29  175  367  513  147    0    0  633  L8IEX7     Prothrombin OS=Bos mutus GN=M91_11654 PE=3 SV=1
   72 : THRB_BOVIN  1TBQ    0.86  0.97   29  175  367  513  147    0    0  625  P00735     Prothrombin OS=Bos taurus GN=F2 PE=1 SV=2
   73 : W5P1L7_SHEEP        0.86  0.96   29  175  408  554  147    0    0  666  W5P1L7     Uncharacterized protein OS=Ovis aries GN=F2 PE=3 SV=1
   74 : C8BKD1_SHEEP        0.85  0.93    1   27  335  361   27    0    0  623  C8BKD1     Prothrombin OS=Ovis aries GN=F2 PE=2 SV=1
   75 : C8BKD1_SHEEP        0.85  0.96   29  175  365  511  147    0    0  623  C8BKD1     Prothrombin OS=Ovis aries GN=F2 PE=2 SV=1
   76 : E2RRM2_CANFA        0.85  0.93    1   27  333  359   27    0    0  600  E2RRM2     Uncharacterized protein OS=Canis familiaris GN=F2 PE=3 SV=2
   77 : F6QU36_CALJA        0.85  0.93    1   27  183  209   27    0    0  470  F6QU36     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=F2 PE=3 SV=1
   78 : F6QU78_CALJA        0.85  0.93    1   27  334  360   27    0    0  621  F6QU78     Prothrombin OS=Callithrix jacchus GN=F2 PE=3 SV=1
   79 : G1PXB6_MYOLU        0.85  0.93    1   27  336  362   27    0    0  624  G1PXB6     Prothrombin OS=Myotis lucifugus GN=F2 PE=3 SV=1
   80 : G1TB36_RABIT        0.85  0.85    1   27  330  356   27    0    0  617  G1TB36     Prothrombin OS=Oryctolagus cuniculus GN=F2 PE=3 SV=1
   81 : G3GYJ4_CRIGR        0.85  0.93    1   27  331  357   27    0    0  618  G3GYJ4     Prothrombin OS=Cricetulus griseus GN=I79_002873 PE=3 SV=1
   82 : H0VZS4_CAVPO        0.85  0.94   29  174  362  507  146    0    0  619  H0VZS4     Prothrombin OS=Cavia porcellus GN=F2 PE=3 SV=1
   83 : H7BX99_MOUSE        0.85  0.93    1   27  330  356   27    0    0  617  H7BX99     Prothrombin OS=Mus musculus GN=F2 PE=2 SV=1
   84 : J9NSF9_CANFA        0.85  0.93    1   27  333  359   27    0    0  621  J9NSF9     Prothrombin OS=Canis familiaris GN=F2 PE=3 SV=1
   85 : L9JIA5_TUPCH        0.85  0.94   29  175  447  593  147    0    0  707  L9JIA5     Prothrombin OS=Tupaia chinensis GN=TREES_T100014328 PE=3 SV=1
   86 : Q3TJ94_MOUSE        0.85  0.93    1   27  331  357   27    0    0  618  Q3TJ94     Prothrombin OS=Mus musculus GN=F2 PE=2 SV=1
   87 : S7N3A9_MYOBR        0.85  0.93    1   27  336  362   27    0    0  640  S7N3A9     Prothrombin OS=Myotis brandtii GN=D623_10025513 PE=3 SV=1
   88 : THRB_MOUSE  3HKI    0.85  0.93    1   27  331  357   27    0    0  618  P19221     Prothrombin OS=Mus musculus GN=F2 PE=1 SV=1
   89 : U6DFN0_NEOVI        0.85  0.93    1   27  331  357   27    0    0  619  U6DFN0     Prothrombin (Fragment) OS=Neovison vison GN=THRB PE=2 SV=1
   90 : W5P1L7_SHEEP        0.85  0.93    1   27  378  404   27    0    0  666  W5P1L7     Uncharacterized protein OS=Ovis aries GN=F2 PE=3 SV=1
   91 : I3M5J3_SPETR        0.81  0.93    1   27  335  361   27    0    0  622  I3M5J3     Prothrombin OS=Spermophilus tridecemlineatus GN=F2 PE=3 SV=1
   92 : L5LC83_MYODS        0.81  0.93    1   27  336  362   27    0    0  639  L5LC83     Prothrombin OS=Myotis davidii GN=MDA_GLEAN10019057 PE=3 SV=1
   93 : L8IEX7_9CETA        0.81  0.96    1   27  337  363   27    0    0  633  L8IEX7     Prothrombin OS=Bos mutus GN=M91_11654 PE=3 SV=1
   94 : R0LYC0_ANAPL        0.81  0.89    1   27  296  322   27    0    0  580  R0LYC0     Prothrombin (Fragment) OS=Anas platyrhynchos GN=Anapl_06581 PE=3 SV=1
   95 : U3J210_ANAPL        0.81  0.89    1   27  322  348   27    0    0  609  U3J210     Prothrombin OS=Anas platyrhynchos GN=F2 PE=3 SV=1
   96 : F6XQI6_XENTR        0.80  0.96    3   27  322  346   25    0    0  607  F6XQI6     Uncharacterized protein OS=Xenopus tropicalis GN=f2 PE=3 SV=1
   97 : F7C7I7_XENTR        0.80  0.96    3   27  330  354   25    0    0  615  F7C7I7     Prothrombin (Fragment) OS=Xenopus tropicalis GN=f2 PE=3 SV=1
   98 : Q5FVW1_XENTR        0.80  0.96    3   27  322  346   25    0    0  607  Q5FVW1     Prothrombin OS=Xenopus tropicalis GN=f2 PE=2 SV=1
   99 : D2HHJ1_AILME        0.78  0.89    1   27  334  360   27    0    0  626  D2HHJ1     Prothrombin (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_010583 PE=3 SV=1
  100 : G1LK81_AILME        0.78  0.89    1   27  340  366   27    0    0  628  G1LK81     Uncharacterized protein OS=Ailuropoda melanoleuca GN=F2 PE=3 SV=1
  101 : G3WV15_SARHA        0.78  0.93    1   27  244  270   27    0    0  542  G3WV15     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=F2 PE=3 SV=1
  102 : K7FBJ4_PELSI        0.78  0.91   29  172  352  495  144    0    0  611  K7FBJ4     Prothrombin OS=Pelodiscus sinensis GN=F2 PE=3 SV=1
  103 : M7BDU8_CHEMY        0.78  0.90   29  175  301  447  147    0    0  558  M7BDU8     Prothrombin OS=Chelonia mydas GN=UY3_16531 PE=3 SV=1
  104 : Q6DFJ5_XENLA        0.78  1.00    1   27  319  345   27    0    0  607  Q6DFJ5     Prothrombin OS=Xenopus laevis GN=lpa-prov PE=2 SV=1
  105 : Q90WP0_TRASC        0.78  0.90   29  175  180  326  147    0    0  378  Q90WP0     Putative thrombin (Fragment) OS=Trachemys scripta elegans GN=thrombin PE=2 SV=1
  106 : Q90WT4_CRONI        0.78  0.96    1   27  154  180   27    0    0  382  Q90WT4     Putative thrombin (Fragment) OS=Crocodylus niloticus GN=thrombin PE=2 SV=1
  107 : Q9PTW7_STRCA        0.78  0.93    1   27  321  347   27    0    0  608  Q9PTW7     Prothrombin OS=Struthio camelus GN=OSPT PE=2 SV=1
  108 : THRB_BOVIN  1TBQ    0.78  0.96    1   27  337  363   27    0    0  625  P00735     Prothrombin OS=Bos taurus GN=F2 PE=1 SV=2
  109 : V8P295_OPHHA        0.78  0.89  179  278   95  192  100    1    2  195  V8P295     Prothrombin (Fragment) OS=Ophiophagus hannah GN=F2 PE=3 SV=1
  110 : H0ZJZ8_TAEGU        0.77  0.88    1   26  322  347   26    0    0  608  H0ZJZ8     Prothrombin OS=Taeniopygia guttata GN=F2 PE=3 SV=1
  111 : U3JUU7_FICAL        0.77  0.88    1   26  322  347   26    0    0  608  U3JUU7     Prothrombin OS=Ficedula albicollis GN=F2 PE=3 SV=1
  112 : Q4QR53_XENLA        0.76  0.96    3   27  321  345   25    0    0  607  Q4QR53     Prothrombin OS=Xenopus laevis GN=f2 PE=2 SV=1
  113 : Q6GNK4_XENLA        0.76  0.96    3   27  329  353   25    0    0  615  Q6GNK4     Prothrombin (Fragment) OS=Xenopus laevis GN=LOC443652 PE=2 SV=1
  114 : F6W5T9_MONDO        0.75  0.89  179  278  211  310  101    2    2  312  F6W5T9     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=F2 PE=3 SV=1
  115 : Q90WT4_CRONI        0.75  0.88   29  175  184  330  147    0    0  382  Q90WT4     Putative thrombin (Fragment) OS=Crocodylus niloticus GN=thrombin PE=2 SV=1
  116 : Q91004_GECGE        0.75  0.91  179  278  133  232  101    2    2  235  Q91004     Thrombin (Fragment) OS=Gecko gecko GN=thrombin PE=2 SV=1
  117 : Q91218_ONCMY        0.75  0.92  179  278  133  232  101    2    2  239  Q91218     Thrombin (Fragment) OS=Oncorhynchus mykiss GN=thrombin PE=2 SV=1
  118 : Q9DFD1_ONCMY        0.75  0.93  177  278   64  165  102    0    0  172  Q9DFD1     Thrombin B chain variant 1 (Fragment) OS=Oncorhynchus mykiss PE=2 SV=1
  119 : H0VZS4_CAVPO        0.74  0.85    1   27  332  358   27    0    0  619  H0VZS4     Prothrombin OS=Cavia porcellus GN=F2 PE=3 SV=1
  120 : Q90WS2_9SAUR        0.74  0.85    1   27  157  183   27    0    0  385  Q90WS2     Putative thrombin (Fragment) OS=Elaphe sp. GN=thrombin PE=2 SV=1
  121 : Q91004_GECGE        0.74  0.90   52  175    1  124  124    0    0  235  Q91004     Thrombin (Fragment) OS=Gecko gecko GN=thrombin PE=2 SV=1
  122 : Q9PTW7_STRCA        0.74  0.86   29  175  351  497  149    4    4  608  Q9PTW7     Prothrombin OS=Struthio camelus GN=OSPT PE=2 SV=1
  123 : F6W5T9_MONDO        0.73  0.88   29  175   56  202  147    0    0  312  F6W5T9     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=F2 PE=3 SV=1
  124 : F6XQI6_XENTR        0.73  0.88   29  175  350  496  148    2    2  607  F6XQI6     Uncharacterized protein OS=Xenopus tropicalis GN=f2 PE=3 SV=1
  125 : F7C7I7_XENTR        0.73  0.88   29  175  358  504  148    2    2  615  F7C7I7     Prothrombin (Fragment) OS=Xenopus tropicalis GN=f2 PE=3 SV=1
  126 : F7CZN2_MONDO        0.73  0.88   29  175  203  349  147    0    0  484  F7CZN2     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=F2 PE=3 SV=1
  127 : G1KCA5_ANOCA        0.73  0.87   29  172  355  498  146    4    4  612  G1KCA5     Prothrombin OS=Anolis carolinensis GN=F2 PE=3 SV=1
  128 : Q5FVW1_XENTR        0.73  0.88   29  175  350  496  148    2    2  607  Q5FVW1     Prothrombin OS=Xenopus tropicalis GN=f2 PE=2 SV=1
  129 : Q6DFJ5_XENLA        0.73  0.88   29  175  349  495  148    2    2  607  Q6DFJ5     Prothrombin OS=Xenopus laevis GN=lpa-prov PE=2 SV=1
  130 : F1NXV6_CHICK        0.72  0.87   29  175  351  497  149    4    4  607  F1NXV6     Prothrombin OS=Gallus gallus GN=F2 PE=3 SV=1
  131 : G1NEM6_MELGA        0.72  0.87   29  175  351  497  149    4    4  607  G1NEM6     Prothrombin OS=Meleagris gallopavo GN=F2 PE=3 SV=1
  132 : G5DZC6_9PIPI        0.72  0.96    3   27  270  294   25    0    0  471  G5DZC6     Putative coagulation factor 2 (Fragment) OS=Hymenochirus curtipes PE=2 SV=1
  133 : H0ZJZ8_TAEGU        0.72  0.87   29  175  351  497  149    4    4  608  H0ZJZ8     Prothrombin OS=Taeniopygia guttata GN=F2 PE=3 SV=1
  134 : Q4QR53_XENLA        0.72  0.89   29  175  349  495  148    2    2  607  Q4QR53     Prothrombin OS=Xenopus laevis GN=f2 PE=2 SV=1
  135 : Q6GNK4_XENLA        0.72  0.89   29  175  357  503  148    2    2  615  Q6GNK4     Prothrombin (Fragment) OS=Xenopus laevis GN=LOC443652 PE=2 SV=1
  136 : Q90387_CYNPY        0.72  0.88  179  278  133  232  101    2    2  235  Q90387     Thrombin (Fragment) OS=Cynops pyrrhogaster GN=thrombin PE=2 SV=1
  137 : Q90WS2_9SAUR        0.72  0.87   29  175  187  333  147    0    0  385  Q90WS2     Putative thrombin (Fragment) OS=Elaphe sp. GN=thrombin PE=2 SV=1
  138 : R0LYC0_ANAPL        0.72  0.87   29  175  326  472  149    4    4  580  R0LYC0     Prothrombin (Fragment) OS=Anas platyrhynchos GN=Anapl_06581 PE=3 SV=1
  139 : U3J210_ANAPL        0.72  0.87   29  175  352  498  149    4    4  609  U3J210     Prothrombin OS=Anas platyrhynchos GN=F2 PE=3 SV=1
  140 : U3JUU7_FICAL        0.72  0.87   29  175  351  497  149    4    4  608  U3JUU7     Prothrombin OS=Ficedula albicollis GN=F2 PE=3 SV=1
  141 : M3ZVI8_XIPMA        0.71  0.83    3   26  329  352   24    0    0  617  M3ZVI8     Prothrombin OS=Xiphophorus maculatus PE=3 SV=1
  142 : Q90387_CYNPY        0.71  0.89   52  175    1  124  124    0    0  235  Q90387     Thrombin (Fragment) OS=Cynops pyrrhogaster GN=thrombin PE=2 SV=1
  143 : H3BHN3_LATCH        0.70  0.89    1   27  335  361   27    0    0  618  H3BHN3     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  144 : M3XJR1_LATCH        0.70  0.89    1   27  323  349   27    0    0  606  M3XJR1     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
  145 : M7BDU8_CHEMY        0.70  0.93    1   27  271  297   27    0    0  558  M7BDU8     Prothrombin OS=Chelonia mydas GN=UY3_16531 PE=3 SV=1
  146 : Q90WP0_TRASC        0.70  0.89    1   27  150  176   27    0    0  378  Q90WP0     Putative thrombin (Fragment) OS=Trachemys scripta elegans GN=thrombin PE=2 SV=1
  147 : Q91001_CHICK        0.70  0.86   29  175  351  497  149    4    4  607  Q91001     Prothrombin OS=Gallus gallus PE=2 SV=1
  148 : V8PHX7_OPHHA        0.70  0.81    1   27  281  307   27    0    0  380  V8PHX7     Prothrombin (Fragment) OS=Ophiophagus hannah GN=F2 PE=3 SV=1
  149 : G1KCA5_ANOCA        0.69  0.92    1   26  325  350   26    0    0  612  G1KCA5     Prothrombin OS=Anolis carolinensis GN=F2 PE=3 SV=1
  150 : H2MZX3_ORYLA        0.69  0.81    1   26   11   36   26    0    0   82  H2MZX3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170246 PE=4 SV=1
  151 : H3CM77_TETNG        0.69  0.69    1   26  325  350   26    0    0  615  H3CM77     Prothrombin OS=Tetraodon nigroviridis PE=3 SV=1
  152 : I3JQX8_ORENI        0.69  0.73    1   26  329  354   26    0    0  617  I3JQX8     Prothrombin OS=Oreochromis niloticus GN=LOC100700143 PE=3 SV=1
  153 : K7FBJ4_PELSI        0.69  0.92    1   26  322  347   26    0    0  611  K7FBJ4     Prothrombin OS=Pelodiscus sinensis GN=F2 PE=3 SV=1
  154 : Q4SUA7_TETNG        0.69  0.69    1   26  307  332   26    0    0  586  Q4SUA7     Chromosome 3 SCAF13974, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00012553001 PE=3 SV=1
  155 : E7FAN5_DANRE        0.68  0.76    2   26  345  369   25    0    0  635  E7FAN5     Uncharacterized protein OS=Danio rerio GN=f2 PE=3 SV=1
  156 : F1R704_DANRE        0.68  0.86   29  175  278  424  148    2    2  539  F1R704     Uncharacterized protein OS=Danio rerio GN=f2 PE=3 SV=1
  157 : F1R704_DANRE        0.68  0.76    2   26  249  273   25    0    0  539  F1R704     Uncharacterized protein OS=Danio rerio GN=f2 PE=3 SV=1
  158 : H3BHN3_LATCH        0.68  0.83   29  175  365  511  149    4    4  618  H3BHN3     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  159 : M3XJR1_LATCH        0.68  0.83   29  175  353  499  149    4    4  606  M3XJR1     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
  160 : Q7SXH8_DANRE        0.68  0.86   29  175  263  409  148    2    2  524  Q7SXH8     Coagulation factor II (Thrombin) OS=Danio rerio GN=f2 PE=2 SV=1
  161 : Q7SXH8_DANRE        0.68  0.76    2   26  234  258   25    0    0  524  Q7SXH8     Coagulation factor II (Thrombin) OS=Danio rerio GN=f2 PE=2 SV=1
  162 : T1RTV1_CARAU        0.68  0.80    2   26   37   61   25    0    0  296  T1RTV1     Coagulation factor II (Fragment) OS=Carassius auratus PE=2 SV=1
  163 : W8FYF8_CTEID        0.68  0.76    2   26  234  258   25    0    0  524  W8FYF8     Blood coagulation factor II OS=Ctenopharyngodon idella PE=2 SV=1
  164 : G1NEM6_MELGA        0.67  0.89    1   27  321  347   27    0    0  607  G1NEM6     Prothrombin OS=Meleagris gallopavo GN=F2 PE=3 SV=1
  165 : G3PRY9_GASAC        0.67  0.71    3   26  328  351   24    0    0  615  G3PRY9     Prothrombin (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  166 : G3PRZ3_GASAC        0.67  0.71    3   26  331  354   24    0    0  618  G3PRZ3     Prothrombin (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  167 : J7M5E6_OPLFA        0.67  0.79    3   26  328  351   24    0    0  617  J7M5E6     Prothrombin OS=Oplegnathus fasciatus PE=2 SV=1
  168 : Q90244_ACITR        0.67  0.87  179  276  133  230   99    2    2  234  Q90244     Thrombin (Fragment) OS=Acipenser transmontanus GN=thrombin PE=2 SV=1
  169 : E7FAN5_DANRE        0.66  0.81   29  175  374  520  150    4    6  635  E7FAN5     Uncharacterized protein OS=Danio rerio GN=f2 PE=3 SV=1
  170 : Q90244_ACITR        0.66  0.87   52  175    1  124  124    0    0  234  Q90244     Thrombin (Fragment) OS=Acipenser transmontanus GN=thrombin PE=2 SV=1
  171 : Q91218_ONCMY        0.66  0.88   52  175    1  124  124    0    0  239  Q91218     Thrombin (Fragment) OS=Oncorhynchus mykiss GN=thrombin PE=2 SV=1
  172 : T1RTV1_CARAU        0.66  0.88   29  175   66  212  147    0    0  296  T1RTV1     Coagulation factor II (Fragment) OS=Carassius auratus PE=2 SV=1
  173 : W8FYF8_CTEID        0.66  0.85   29  175  263  409  148    2    2  524  W8FYF8     Blood coagulation factor II OS=Ctenopharyngodon idella PE=2 SV=1
  174 : H2MZX2_ORYLA        0.65  0.77    1   26  211  236   26    0    0  245  H2MZX2     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170246 PE=4 SV=1
  175 : H3CM77_TETNG        0.65  0.86   29  175  355  501  150    5    6  615  H3CM77     Prothrombin OS=Tetraodon nigroviridis PE=3 SV=1
  176 : I1SRF3_9SMEG        0.65  0.85    1   26  243  268   26    0    0  291  I1SRF3     Coagulin factor II (Fragment) OS=Oryzias melastigma PE=2 SV=1
  177 : I3JQX8_ORENI        0.65  0.85   29  175  359  505  149    4    4  617  I3JQX8     Prothrombin OS=Oreochromis niloticus GN=LOC100700143 PE=3 SV=1
  178 : Q4SUA7_TETNG        0.65  0.86   29  175  337  483  150    5    6  586  Q4SUA7     Chromosome 3 SCAF13974, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00012553001 PE=3 SV=1
  179 : W5LPW9_ASTMX        0.65  0.73    1   26  329  354   26    0    0  619  W5LPW9     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
  180 : D9U8F9_PLEAT        0.64  0.83   29  175  356  502  150    4    6  616  D9U8F9     Prothrombin OS=Plecoglossus altivelis GN=thrombin PE=2 SV=1
  181 : J7M5E6_OPLFA        0.64  0.86   29  175  356  502  150    5    6  617  J7M5E6     Prothrombin OS=Oplegnathus fasciatus PE=2 SV=1
  182 : W5LPW9_ASTMX        0.64  0.83   29  175  358  504  149    4    4  619  W5LPW9     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
  183 : F1NXV6_CHICK        0.63  0.89    1   27  321  347   27    0    0  607  F1NXV6     Prothrombin OS=Gallus gallus GN=F2 PE=3 SV=1
  184 : M3ZVI8_XIPMA        0.63  0.84   29  175  357  503  150    5    6  617  M3ZVI8     Prothrombin OS=Xiphophorus maculatus PE=3 SV=1
  185 : Q5NKF9_ONCMY        0.63  0.82   29  172  361  504  147    4    6  622  Q5NKF9     Prothrombin OS=Oncorhynchus mykiss PE=2 SV=1
  186 : Q91001_CHICK        0.63  0.89    1   27  321  347   27    0    0  607  Q91001     Prothrombin OS=Gallus gallus PE=2 SV=1
  187 : S9X027_9CETA        0.63  0.71  178  278  516  640  126    8   26  643  S9X027     Prothrombin preproprotein OS=Camelus ferus GN=CB1_000515008 PE=3 SV=1
  188 : W5MEW6_LEPOC        0.63  0.85    1   27  343  369   27    0    0  634  W5MEW6     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
  189 : W5MF31_LEPOC        0.63  0.85    1   27  330  356   27    0    0  621  W5MF31     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
  190 : W5MF55_LEPOC        0.63  0.85    1   27  294  320   27    0    0  585  W5MF55     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
  191 : L5KXF6_PTEAL        0.62  0.68  177  278  524  641  119    6   18  644  L5KXF6     Prothrombin OS=Pteropus alecto GN=PAL_GLEAN10018124 PE=3 SV=1
  192 : S7N3A9_MYOBR        0.62  0.69  178  278  521  637  119    7   20  640  S7N3A9     Prothrombin OS=Myotis brandtii GN=D623_10025513 PE=3 SV=1
  193 : H2SPL1_TAKRU        0.61  0.86   29  175  236  382  150    5    6  516  H2SPL1     Uncharacterized protein OS=Takifugu rubripes GN=f2 PE=3 SV=1
  194 : H2SPL2_TAKRU        0.61  0.86   29  175  242  388  150    5    6  507  H2SPL2     Uncharacterized protein OS=Takifugu rubripes GN=f2 PE=3 SV=1
  195 : H2SPL3_TAKRU        0.61  0.86   29  175  236  382  150    5    6  509  H2SPL3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f2 PE=3 SV=1
  196 : H2SPL4_TAKRU        0.61  0.86   29  175  239  385  150    5    6  512  H2SPL4     Uncharacterized protein OS=Takifugu rubripes GN=f2 PE=3 SV=1
  197 : H2SPL6_TAKRU        0.61  0.86   29  175  244  390  150    5    6  496  H2SPL6     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f2 PE=3 SV=1
  198 : H2SPL8_TAKRU        0.61  0.86   29  175  233  379  150    5    6  483  H2SPL8     Uncharacterized protein OS=Takifugu rubripes GN=f2 PE=3 SV=1
  199 : I3JR01_ORENI        0.61  0.86   43  174    1  132  132    0    0  224  I3JR01     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=3 SV=1
  200 : G5DZC6_9PIPI        0.60  0.72   29  175  298  436  147    3    8  471  G5DZC6     Putative coagulation factor 2 (Fragment) OS=Hymenochirus curtipes PE=2 SV=1
  201 : F6W5T9_MONDO        0.59  0.85    1   27   26   52   27    0    0  312  F6W5T9     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=F2 PE=3 SV=1
  202 : H2SPL5_TAKRU        0.58  0.77    1   26  335  360   26    0    0  619  H2SPL5     Prothrombin (Fragment) OS=Takifugu rubripes GN=f2 PE=3 SV=1
  203 : H2SPL7_TAKRU        0.58  0.77    1   26  325  350   26    0    0  609  H2SPL7     Prothrombin (Fragment) OS=Takifugu rubripes GN=f2 PE=3 SV=1
  204 : H2SPL9_TAKRU        0.58  0.77    1   26  334  359   26    0    0  618  H2SPL9     Prothrombin (Fragment) OS=Takifugu rubripes GN=f2 PE=3 SV=1
  205 : H2SPM0_TAKRU        0.58  0.77    1   26  342  367   26    0    0  626  H2SPM0     Prothrombin (Fragment) OS=Takifugu rubripes GN=f2 PE=3 SV=1
  206 : Q804W7_TAKRU        0.58  0.77    1   26  328  353   26    0    0  612  Q804W7     Prothrombin OS=Takifugu rubripes GN=F2 PE=2 SV=1
  207 : T1JL62_STRMM        0.52  0.65  178  274  121  212   97    2    5  222  T1JL62     Uncharacterized protein OS=Strigamia maritima PE=3 SV=1
  208 : H9FG59_MACMU        0.50  0.72  178  265   38  120   88    2    5  122  H9FG59     Coagulation factor X preproprotein (Fragment) OS=Macaca mulatta GN=F10 PE=2 SV=1
  209 : B7P8G5_IXOSC        0.49  0.63  179  276  157  250   99    5    6  252  B7P8G5     Serine protease, putative OS=Ixodes scapularis GN=IscW_ISCW002979 PE=3 SV=1
  210 : W4Z545_STRPU        0.48  0.64  177  275   66  163  102    3    7  281  W4Z545     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=4 SV=1
  211 : E9PIT3_HUMAN        0.47  0.56   29  175  364  471  150    4   45  583  E9PIT3     Thrombin light chain OS=Homo sapiens GN=F2 PE=2 SV=1
  212 : Q4SB50_TETNG        0.46  0.61  182  278  120  211   98    4    7  211  Q4SB50     Chromosome undetermined SCAF14677, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00021131001 PE=3 SV=1
  213 : G3HB48_CRIGR        0.45  0.61  178  277  106  200  101    4    7  202  G3HB48     Coagulation factor IX (Fragment) OS=Cricetulus griseus GN=I79_007664 PE=3 SV=1
  214 : H2L6L5_ORYLA        0.45  0.57  177  278  174  271  103    4    6  275  H2L6L5     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
  215 : H2L6L9_ORYLA        0.45  0.57  177  278  138  235  103    4    6  237  H2L6L9     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
  216 : E3WHS8_TRYDI        0.44  0.67  177  277  166  258  102    4   10  259  E3WHS8     Ejaculate serine protease OS=Trypoxylus dichotomus GN=ejac-sp PE=2 SV=1
  217 : H2L6I5_ORYLA        0.44  0.59  177  277  161  257  102    4    6  259  H2L6I5     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156738 PE=3 SV=1
  218 : H2L6I6_ORYLA        0.44  0.59  177  277  161  257  102    4    6  259  H2L6I6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156738 PE=3 SV=1
  219 : H2L6J6_ORYLA        0.44  0.55  177  278  147  244  103    4    6  277  H2L6J6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156975 PE=3 SV=1
  220 : H2L6N7_ORYLA        0.44  0.59  177  277  160  256  102    4    6  258  H2L6N7     Uncharacterized protein OS=Oryzias latipes GN=LOC101158197 PE=3 SV=1
  221 : H2S2H5_TAKRU        0.44  0.57  178  272  154  252  104    7   14  258  H2S2H5     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=MASP1 PE=3 SV=1
  222 : H3C511_TETNG        0.44  0.58  179  276  161  251  100    3   11  261  H3C511     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  223 : H3D0U7_TETNG        0.44  0.59  182  278  157  253  102    3   10  256  H3D0U7     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  224 : H3D4F3_TETNG        0.44  0.58  179  276  160  250  100    3   11  260  H3D4F3     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  225 : M4AS70_XIPMA        0.44  0.65  180  272    7   95   93    2    4   95  M4AS70     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
  226 : V5H8H3_IXORI        0.44  0.65  177  277   13  111  102    3    4  112  V5H8H3     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
  227 : C3YIV9_BRAFL        0.43  0.65  182  278  136  228   99    4    8  229  C3YIV9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_86658 PE=3 SV=1
  228 : C3YQH0_BRAFL        0.43  0.61  177  278  122  221  105    4    8  227  C3YQH0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_241809 PE=3 SV=1
  229 : C3ZW47_BRAFL        0.43  0.61  177  278  149  248  105    4    8  255  C3ZW47     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_241477 PE=3 SV=1
  230 : E9J0R5_SOLIN        0.43  0.54  177  272    2   90   98    3   11   90  E9J0R5     Putative uncharacterized protein (Fragment) OS=Solenopsis invicta GN=SINV_12473 PE=3 SV=1
  231 : F7HD86_CALJA        0.43  0.57  179  278  156  247  102    5   12  248  F7HD86     Uncharacterized protein OS=Callithrix jacchus GN=KLK11 PE=3 SV=1
  232 : Q17035_ANOGA        0.43  0.59  182  278  135  228   99    5    7  237  Q17035     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
  233 : Q171W4_AEDAE        0.43  0.60  182  278  121  214   99    5    7  222  Q171W4     AAEL007517-PA OS=Aedes aegypti GN=AAEL007517 PE=3 SV=1
  234 : Q9GQ03_BIOGL        0.43  0.60  177  277  142  238  102    3    6  240  Q9GQ03     Serine protease alpha (Fragment) OS=Biomphalaria glabrata GN=SP-alpha PE=2 SV=1
  235 : U3I6T6_ANAPL        0.43  0.59  182  274   53  141   93    2    4  141  U3I6T6     Uncharacterized protein (Fragment) OS=Anas platyrhynchos PE=3 SV=1
  236 : W5Q1Y9_SHEEP        0.43  0.57  179  278  155  245  100    3    9  246  W5Q1Y9     Uncharacterized protein OS=Ovis aries GN=LOC101111795 PE=3 SV=1
  237 : W5Q219_SHEEP        0.43  0.57  179  278  161  251  100    3    9  252  W5Q219     Uncharacterized protein (Fragment) OS=Ovis aries PE=3 SV=1
  238 : E7FAW1_DANRE        0.42  0.61  179  276  163  253  100    3   11  263  E7FAW1     Uncharacterized protein OS=Danio rerio GN=LOC560086 PE=3 SV=1
  239 : F6W6S4_MOUSE        0.42  0.54  177  278   46  148  106    5    7  179  F6W6S4     Serine protease hepsin (Fragment) OS=Mus musculus GN=Hpn PE=2 SV=1
  240 : F6XB42_ORNAN        0.42  0.63  177  278  157  254  103    4    6  256  F6XB42     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PRSS55 PE=3 SV=1
  241 : F6XEI3_MACMU        0.42  0.55  177  277  146  247  105    5    7  259  F6XEI3     Uncharacterized protein OS=Macaca mulatta GN=HPN PE=3 SV=1
  242 : F6XIS9_MACMU        0.42  0.61  179  278   46  137  102    4   12  138  F6XIS9     Uncharacterized protein OS=Macaca mulatta GN=KLK12 PE=3 SV=1
  243 : G3H0K5_CRIGR        0.42  0.59  178  278   18  114  102    3    6  144  G3H0K5     Testicular-specific serine protease 3 OS=Cricetulus griseus GN=I79_003666 PE=3 SV=1
  244 : H2RLS3_TAKRU        0.42  0.55  180  276   37  134  101    4    7  149  H2RLS3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
  245 : H2S855_TAKRU        0.42  0.58  178  278  154  245  101    3    9  247  H2S855     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071324 PE=3 SV=1
  246 : H2S856_TAKRU        0.42  0.58  178  278  156  247  101    3    9  249  H2S856     Uncharacterized protein OS=Takifugu rubripes GN=LOC101071324 PE=3 SV=1
  247 : H2T0C3_TAKRU        0.42  0.57  179  276  146  236  100    3   11  239  H2T0C3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
  248 : H3BXE3_TETNG        0.42  0.56  179  278  142  237  101    3    6  238  H3BXE3     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  249 : I3JIS8_ORENI        0.42  0.59  177  277  169  267  103    3    6  269  I3JIS8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=TMPRSS9 (6 of 18) PE=3 SV=1
  250 : I3L6R5_PIG          0.42  0.55  177  277   73  174  105    5    7  186  I3L6R5     Uncharacterized protein OS=Sus scrofa GN=HPN PE=3 SV=1
  251 : L9L667_TUPCH        0.42  0.56  179  278  110  201  102    5   12  216  L9L667     Kallikrein-12 OS=Tupaia chinensis GN=TREES_T100006298 PE=3 SV=1
  252 : M0QZ63_HUMAN        0.42  0.55  177  277  146  247  105    5    7  259  M0QZ63     Serine protease hepsin OS=Homo sapiens GN=HPN PE=2 SV=1
  253 : M4AGR4_XIPMA        0.42  0.59  177  277   88  184  102    4    6  210  M4AGR4     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
  254 : M7AKS9_CHEMY        0.42  0.57  181  272   36  123   93    3    6  128  M7AKS9     Plasma kallikrein OS=Chelonia mydas GN=UY3_17886 PE=3 SV=1
  255 : Q19UG1_HUMAN        0.42  0.61  182  277   90  180   97    4    7  182  Q19UG1     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  256 : Q19UG3_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UG3     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  257 : Q19UG5_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UG5     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  258 : Q19UG9_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UG9     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  259 : Q19UI1_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UI1     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  260 : Q19UI3_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UI3     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  261 : Q19UI4_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UI4     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  262 : Q19UI5_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UI5     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  263 : Q19UJ0_HUMAN        0.42  0.60  182  277   90  180   97    4    7  182  Q19UJ0     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  264 : Q66PG9_TAKRU        0.42  0.58  178  278  154  245  101    3    9  247  Q66PG9     Trypsinogen OS=Takifugu rubripes PE=3 SV=1
  265 : Q9PUF3_BOTJA        0.42  0.58  177  277   24  115  101    2    9  117  Q9PUF3     Trypsinogen homolog (Fragment) OS=Bothrops jararaca PE=2 SV=1
  266 : R0K0C9_ANAPL        0.42  0.60  178  274  100  191   98    4    7  191  R0K0C9     Coagulation factor IX (Fragment) OS=Anas platyrhynchos GN=Anapl_11776 PE=3 SV=1
  267 : R0L4B5_ANAPL        0.42  0.64  183  277  133  227   99    5    8  230  R0L4B5     Complement-activating component of Ra-reactive factor OS=Anas platyrhynchos GN=Anapl_13653 PE=3 SV=1
  268 : T1DJQ1_ANOAQ        0.42  0.56  181  278  128  225  101    4    6  231  T1DJQ1     Putative serine protease aedes aegypti serine protease (Fragment) OS=Anopheles aquasalis PE=2 SV=1
  269 : U3HYQ2_ANAPL        0.42  0.60  178  274   86  177   98    4    7  182  U3HYQ2     Uncharacterized protein (Fragment) OS=Anas platyrhynchos PE=3 SV=1
  270 : V4BM24_LOTGI        0.42  0.60  178  278  141  240  108    5   15  244  V4BM24     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_218353 PE=3 SV=1
  271 : A7RXZ9_NEMVE        0.41  0.62  180  277  130  232  105    5    9  232  A7RXZ9     Predicted protein OS=Nematostella vectensis GN=v1g164017 PE=3 SV=1
  272 : A7S0M2_NEMVE        0.41  0.60  177  277  122  217  101    2    5  218  A7S0M2     Predicted protein OS=Nematostella vectensis GN=v1g229125 PE=3 SV=1
  273 : B3MF98_DROAN        0.41  0.62  178  277  171  262  102    5   12  262  B3MF98     GF12405 OS=Drosophila ananassae GN=Dana\GF12405 PE=3 SV=1
  274 : B3RY71_TRIAD        0.41  0.62  179  277  137  236  103    3    7  238  B3RY71     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25686 PE=3 SV=1
  275 : E1BE09_BOVIN        0.41  0.56  179  278  156  247  102    5   12  248  E1BE09     Uncharacterized protein OS=Bos taurus GN=KLK12 PE=3 SV=1
  276 : E9FBE3_METAR        0.41  0.57  177  276  161  255  105    5   15  255  E9FBE3     Trypsin-protease OS=Metarhizium anisopliae (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_09592 PE=3 SV=1
  277 : F6TEA6_CALJA        0.41  0.55   29  170   23  154  143    5   12  273  F6TEA6     Uncharacterized protein OS=Callithrix jacchus GN=PROC PE=3 SV=1
  278 : F6XIS0_MACMU        0.41  0.58  179  278  156  247  102    5   12  248  F6XIS0     Uncharacterized protein OS=Macaca mulatta GN=KLK12 PE=3 SV=1
  279 : F8U087_EPIBR        0.41  0.56  178  278  154  245  101    3    9  247  F8U087     Trypsinogen 3 (Fragment) OS=Epinephelus bruneus PE=2 SV=1
  280 : G3NYA9_GASAC        0.41  0.55  177  278  161  259  104    3    7  261  G3NYA9     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  281 : G3TLT0_LOXAF        0.41  0.60  179  277   89  178   99    3    9  180  G3TLT0     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=3 SV=1
  282 : H2RSR0_TAKRU        0.41  0.54  182  272    1   88   93    3    7   88  H2RSR0     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
  283 : H2RT72_TAKRU        0.41  0.54  180  278   99  198  103    5    7  211  H2RT72     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101065721 PE=3 SV=1
  284 : H3CKC2_TETNG        0.41  0.57  178  278  105  196  101    3    9  198  H3CKC2     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  285 : H9KCG4_APIME        0.41  0.53  182  274   68  153   95    4   11  157  H9KCG4     Uncharacterized protein (Fragment) OS=Apis mellifera GN=SP47 PE=3 SV=1
  286 : I3NBY6_SPETR        0.41  0.57  179  277   89  178   99    3    9  180  I3NBY6     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=3 SV=1
  287 : K7FAY9_PELSI        0.41  0.56  179  278   83  173  100    2    9  174  K7FAY9     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=3 SV=1
  288 : L8ID92_9CETA        0.41  0.56  179  278  156  247  102    5   12  248  L8ID92     Kallikrein-12 OS=Bos mutus GN=M91_05455 PE=3 SV=1
  289 : M4AWU3_XIPMA        0.41  0.60  179  276  159  249  100    3   11  260  M4AWU3     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
  290 : P79131_BOVIN        0.41  0.60  182  272   38  124   92    3    6  131  P79131     Blood coagulation factor XI (Fragment) OS=Bos taurus PE=3 SV=1
  291 : Q19UG2_HUMAN        0.41  0.59  182  277   90  180   97    4    7  182  Q19UG2     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  292 : Q19UG4_HUMAN        0.41  0.60  182  277   90  180   97    4    7  182  Q19UG4     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  293 : Q19UG6_HUMAN        0.41  0.59  182  277   90  179   97    4    8  181  Q19UG6     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=2 SV=1
  294 : Q19UG8_HUMAN        0.41  0.60  182  277   90  180   97    4    7  182  Q19UG8     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  295 : Q19UH5_HUMAN        0.41  0.60  182  277   90  180   97    4    7  182  Q19UH5     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  296 : Q19UH8_HUMAN        0.41  0.59  182  277   90  180   97    4    7  182  Q19UH8     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  297 : Q19UH9_HUMAN        0.41  0.60  182  277   90  180   97    4    7  182  Q19UH9     Coagulation factor IX (Fragment) OS=Homo sapiens GN=F9 PE=3 SV=1
  298 : Q4RK29_TETNG        0.41  0.71  181  277    1   93   97    2    4   93  Q4RK29     Chromosome 9 SCAF15033, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00033163001 PE=3 SV=1
  299 : Q9Y7A9_METAN        0.41  0.57  177  276  161  255  105    5   15  255  Q9Y7A9     Trypsin-related protease OS=Metarhizium anisopliae GN=try2 PE=2 SV=1
  300 : S9XNW3_9CETA        0.41  0.60  178  277   95  189  101    4    7  197  S9XNW3     Uncharacterized protein OS=Camelus ferus GN=CB1_012758004 PE=3 SV=1
  301 : TRY1_BOVIN  2D8W    0.41  0.56  179  278  155  245  100    3    9  246  P00760     Cationic trypsin OS=Bos taurus PE=1 SV=3
  302 : W4XCK5_STRPU        0.41  0.60  179  274   27  122   99    3    6  138  W4XCK5     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
  303 : A7RKX8_NEMVE        0.40  0.60  177  273  144  240  101    5    8  240  A7RKX8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85345 PE=3 SV=1
  304 : B3RY72_TRIAD        0.40  0.61  179  277  139  238  103    5    7  240  B3RY72     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25111 PE=3 SV=1
  305 : B4IUC6_DROYA        0.40  0.66  177  272   61  152   96    2    4  158  B4IUC6     GE23213 OS=Drosophila yakuba GN=Dyak\GE23213 PE=3 SV=1
  306 : B9EGA9_HUMAN        0.40  0.60  179  278   46  137  102    4   12  138  B9EGA9     KLK12 protein OS=Homo sapiens GN=KLK12 PE=2 SV=1
  307 : C3YDH9_BRAFL        0.40  0.62  177  278  143  242  104    4    6  244  C3YDH9     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_218432 PE=3 SV=1
  308 : C3Z685_BRAFL        0.40  0.63  177  278  161  260  104    4    6  264  C3Z685     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_235498 PE=3 SV=1
  309 : D3ZD22_RAT          0.40  0.57  179  278   88  179  102    6   12  180  D3ZD22     Glandular kallikrein-12, submandibular/renal OS=Rattus norvegicus GN=Klk12 PE=3 SV=2
  310 : E9GQS9_DAPPU        0.40  0.56  177  274   97  187   98    4    7  189  E9GQS9     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_305246 PE=3 SV=1
  311 : F6VNT7_HORSE        0.40  0.57  179  277  157  246  100    5   11  246  F6VNT7     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100050047 PE=3 SV=1
  312 : F7DST6_HORSE        0.40  0.57  179  277  155  244  100    5   11  246  F7DST6     Uncharacterized protein OS=Equus caballus GN=LOC100049983 PE=3 SV=1
  313 : G1R1I8_NOMLE        0.40  0.57  179  278  156  247  102    5   12  248  G1R1I8     Uncharacterized protein OS=Nomascus leucogenys GN=KLK12 PE=3 SV=1
  314 : G3HUC1_CRIGR        0.40  0.60  179  278  102  192  100    3    9  193  G3HUC1     Anionic trypsin-2 OS=Cricetulus griseus GN=I79_014529 PE=3 SV=1
  315 : G7NMD9_MACMU        0.40  0.58  179  278  156  247  102    5   12  248  G7NMD9     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_10954 PE=3 SV=1
  316 : G7PYG7_MACFA        0.40  0.58  179  278  156  247  102    5   12  248  G7PYG7     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_10034 PE=3 SV=1
  317 : H0V4F4_CAVPO        0.40  0.53  179  278  142  233  102    5   12  234  H0V4F4     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=KLK12 PE=3 SV=1
  318 : H2XPX5_CIOIN        0.40  0.56  179  278   49  141  102    3   11  142  H2XPX5     Uncharacterized protein OS=Ciona intestinalis GN=LOC100185014 PE=3 SV=1
  319 : H9GEM5_ANOCA        0.40  0.58  179  278   83  173  100    2    9  174  H9GEM5     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100566067 PE=3 SV=1
  320 : I3N0R7_SPETR        0.40  0.55  179  278  138  229  102    5   12  230  I3N0R7     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=KLK12 PE=3 SV=1
  321 : K1PJU5_CRAGI        0.40  0.65  177  277  127  227  104    4    6  227  K1PJU5     Prothrombin (Fragment) OS=Crassostrea gigas GN=CGI_10009615 PE=3 SV=1
  322 : K7ECS2_ORNAN        0.40  0.60  179  278  132  224  102    8   11  225  K7ECS2     Uncharacterized protein OS=Ornithorhynchus anatinus GN=CTRL PE=3 SV=1
  323 : K9J7X6_XENTR        0.40  0.59  179  277  101  190   99    3    9  192  K9J7X6     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
  324 : L8YCS6_TUPCH        0.40  0.59  179  272   36  127   96    3    6  133  L8YCS6     Transmembrane protease serine 11B OS=Tupaia chinensis GN=TREES_T100008182 PE=3 SV=1
  325 : Q171W0_AEDAE        0.40  0.58  181  278  148  245  101    4    6  251  Q171W0     AAEL007511-PA (Fragment) OS=Aedes aegypti GN=AAEL007511 PE=3 SV=1
  326 : Q4S8J5_TETNG        0.40  0.57  182  276    4   95   97    3    7   95  Q4S8J5     Chromosome 2 SCAF14705, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00022311001 PE=3 SV=1
  327 : Q8IXB4_HUMAN        0.40  0.61  182  278   94  185   98    5    7  195  Q8IXB4     Protein C (Fragment) OS=Homo sapiens GN=PROC1 PE=3 SV=1
  328 : Q8J007_HUMAN        0.40  0.61  182  278   94  185   98    5    7  195  Q8J007     Protein C (Fragment) OS=Homo sapiens GN=PROC PE=3 SV=1
  329 : Q8J008_HUMAN        0.40  0.61  182  278   94  185   98    5    7  195  Q8J008     Protein C (Fragment) OS=Homo sapiens GN=PROC PE=3 SV=1
  330 : Q9CV76_MOUSE        0.40  0.56  179  278  142  233  102    6   12  234  Q9CV76     MCG144712 (Fragment) OS=Mus musculus GN=Klk12 PE=2 SV=1
  331 : S7PPI4_MYOBR        0.40  0.58  177  278  170  273  111    5   16  275  S7PPI4     Tryptase OS=Myotis brandtii GN=D623_10017230 PE=3 SV=1
  332 : T1PJA1_MUSDO        0.40  0.56  182  277   72  159   96    2    8  162  T1PJA1     Trypsin OS=Musca domestica PE=2 SV=1
  333 : V4B609_LOTGI        0.40  0.66  179  276  112  207  100    3    6  210  V4B609     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_184009 PE=3 SV=1
  334 : V4BAS1_LOTGI        0.40  0.53  182  278  142  242  106    5   14  247  V4BAS1     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_135842 PE=3 SV=1
  335 : V8N5N6_OPHHA        0.40  0.54  180  276  125  225  105    7   12  237  V8N5N6     Mannan-binding lectin serine protease 2 (Fragment) OS=Ophiophagus hannah GN=Masp2 PE=3 SV=1
  336 : VDP_BOMMO           0.40  0.55  177  278  160  254  105    5   13  264  Q07943     Vitellin-degrading protease OS=Bombyx mori PE=1 SV=1
  337 : W4YMC8_STRPU        0.40  0.60  177  278  107  209  107    6    9  210  W4YMC8     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
  338 : W5KNR9_ASTMX        0.40  0.55  177  276   44  136  102    3   11  147  W5KNR9     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=3 SV=1
  339 : A5HBA2_PANTR        0.39  0.54  177  272   92  189  105    5   16  197  A5HBA2     Tryptase (Fragment) OS=Pan troglodytes PE=3 SV=1
  340 : A7T3C0_NEMVE        0.39  0.58  177  278  144  240  102    3    5  241  A7T3C0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g144191 PE=3 SV=1
  341 : B0WAJ1_CULQU        0.39  0.56  182  278   89  185  100    4    6  191  B0WAJ1     Serine protease OS=Culex quinquefasciatus GN=CpipJ_CPIJ004095 PE=3 SV=1
  342 : B0WIS1_CULQU        0.39  0.57  179  278  129  220  102    5   12  225  B0WIS1     Trypsin-4 OS=Culex quinquefasciatus GN=CpipJ_CPIJ007076 PE=3 SV=1
  343 : B3V3M8_HYPMO        0.39  0.59  177  278  150  242  103    5   11  243  B3V3M8     Myofibril-bound serine proteinase OS=Hypophthalmichthys molitrix GN=MBSP PE=2 SV=1
  344 : B7PAT9_IXOSC        0.39  0.61  177  274   60  153   99    3    6  156  B7PAT9     Serine protease, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW002998 PE=3 SV=1
  345 : C1BKZ0_OSMMO        0.39  0.57  178  278  154  245  101    3    9  246  C1BKZ0     Anionic trypsin-1 OS=Osmerus mordax GN=TRY1 PE=2 SV=1
  346 : C1FIY1_MICSR        0.39  0.55  177  272  146  244  103    4   11  244  C1FIY1     Predicted protein (Fragment) OS=Micromonas sp. (strain RCC299 / NOUM17) GN=MICPUN_76323 PE=3 SV=1
  347 : C3Y9E5_BRAFL        0.39  0.56   29  174  177  310  148    7   16  310  C3Y9E5     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_118633 PE=3 SV=1
  348 : C3YUT5_BRAFL        0.39  0.58  177  278  145  244  105    4    8  245  C3YUT5     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_212227 PE=3 SV=1
  349 : E2BDT6_HARSA        0.39  0.60  179  278  148  242  102    6    9  248  E2BDT6     Trypsin-1 OS=Harpegnathos saltator GN=EAI_13614 PE=3 SV=1
  350 : E3TCU7_9TELE        0.39  0.55  179  278   47  137  100    2    9  138  E3TCU7     Trypsin-3 OS=Ictalurus furcatus GN=TRY3 PE=2 SV=1
  351 : E6ZFE9_DICLA        0.39  0.57  177  276  140  232  102    3   11  242  E6ZFE9     Trypsin OS=Dicentrarchus labrax GN=DLA_It03240 PE=3 SV=1
  352 : E9GTT5_DAPPU        0.39  0.50  178  278  136  238  108    8   12  239  E9GTT5     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_54608 PE=3 SV=1
  353 : E9H0G8_DAPPU        0.39  0.57  177  277  133  233  106    4   10  235  E9H0G8     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_56705 PE=3 SV=1
  354 : E9H2M8_DAPPU        0.39  0.54  179  277  141  239  105    6   12  263  E9H2M8     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_57647 PE=3 SV=1
  355 : F1NP19_CHICK        0.39  0.54  179  277   89  178   99    3    9  180  F1NP19     Uncharacterized protein (Fragment) OS=Gallus gallus GN=PRSS2 PE=3 SV=2
  356 : F1RUS0_PIG          0.39  0.57  181  272   47  136   94    3    6  142  F1RUS0     Uncharacterized protein OS=Sus scrofa GN=LOC100513671 PE=3 SV=2
  357 : F7DMQ4_ORNAN        0.39  0.53   29  175   29  165  148    6   12  271  F7DMQ4     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100086942 PE=3 SV=1
  358 : F7FFE9_MONDO        0.39  0.55  177  278  179  284  111    6   14  305  F7FFE9     Uncharacterized protein OS=Monodelphis domestica GN=PRSS48 PE=3 SV=2
  359 : G1U3L5_RABIT        0.39  0.55  177  277  156  247  102    5   11  249  G1U3L5     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339606 PE=3 SV=1
  360 : G3P437_GASAC        0.39  0.60  182  277   92  184   98    5    7  184  G3P437     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  361 : G3P442_GASAC        0.39  0.61  182  278  114  207   99    5    7  211  G3P442     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  362 : G7NQR3_MACMU        0.39  0.55  177  278  152  255  111    6   16  257  G7NQR3     Tryptase alpha-1 (Fragment) OS=Macaca mulatta GN=EGK_12329 PE=3 SV=1
  363 : H0ZSH5_TAEGU        0.39  0.55  179  278  137  227  100    3    9  228  H0ZSH5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  364 : H2LX01_ORYLA        0.39  0.56   29  171   25  153  144    5   16  257  H2LX01     Uncharacterized protein OS=Oryzias latipes GN=LOC101158310 PE=3 SV=1
  365 : H9F3Y3_MACMU        0.39  0.57  178  277  107  199  101    6    9  201  H9F3Y3     Chymotrypsin-like protease CTRL-1 (Fragment) OS=Macaca mulatta GN=CTRL PE=2 SV=1
  366 : H9GRN0_ANOCA        0.39  0.54   29  170   23  154  144    7   14  291  H9GRN0     Uncharacterized protein OS=Anolis carolinensis GN=LOC100551756 PE=3 SV=2
  367 : Q0P3S9_XENLA        0.39  0.58  179  277   47  136   99    2    9  138  Q0P3S9     LOC733345 protein OS=Xenopus laevis GN=prss2 PE=2 SV=1
  368 : Q4RFF8_TETNG        0.39  0.56  180  278   99  198  103    5    7  211  Q4RFF8     Chromosome 8 SCAF15119, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00035339001 PE=3 SV=1
  369 : Q5XUG4_OREAU        0.39  0.58  177  278  108  200  102    3    9  201  Q5XUG4     Trypsin (Fragment) OS=Oreochromis aureus PE=2 SV=1
  370 : Q5XUG5_ORENI        0.39  0.58  177  278  110  202  102    3    9  203  Q5XUG5     Trypsin (Fragment) OS=Oreochromis niloticus PE=2 SV=1
  371 : Q6SPC0_HUMAN        0.39  0.60  182  278   94  185   98    5    7  195  Q6SPC0     Protein C (Fragment) OS=Homo sapiens PE=3 SV=1
  372 : Q86VI7_HUMAN        0.39  0.55  179  278  100  191  101    4   10  204  Q86VI7     Kallikrein 13 splicing variant 2 OS=Homo sapiens GN=KLK13 PE=2 SV=1
  373 : Q86VI8_HUMAN        0.39  0.55  179  278   21  112  101    3   10  125  Q86VI8     Kallikrein 13 splicing variant 3 OS=Homo sapiens GN=KLK13 PE=2 SV=1
  374 : Q8J006_HUMAN        0.39  0.61  182  278   94  185   98    5    7  195  Q8J006     Protein C (Fragment) OS=Homo sapiens GN=PROC PE=3 SV=1
  375 : Q9DC82_MOUSE        0.39  0.59  179  277   71  162  100    5    9  164  Q9DC82     Putative uncharacterized protein OS=Mus musculus GN=Ctrl PE=2 SV=1
  376 : S4RRW9_PETMA        0.39  0.53  177  277  141  232  101    3    9  234  S4RRW9     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  377 : S4RVQ7_PETMA        0.39  0.58  180  277   93  181   98    3    9  183  S4RVQ7     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  378 : TRYA_RAT            0.39  0.59  177  278  153  245  103    5   11  246  P32821     Trypsin V-A OS=Rattus norvegicus PE=2 SV=1
  379 : TRYB_RAT            0.39  0.59  177  277  153  244  102    5   11  246  P32822     Trypsin V-B OS=Rattus norvegicus PE=2 SV=1
  380 : V5H6H2_IXORI        0.39  0.61  177  274   60  153   99    3    6  156  V5H6H2     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
  381 : V9IBU5_APICE        0.39  0.56  179  273   17  104   97    3   11  109  V9IBU5     Trypsin-2 OS=Apis cerana GN=ACCB01183.1 PE=3 SV=1
  382 : W5JNL8_ANODA        0.39  0.61  182  278  105  200  100    4    7  211  W5JNL8     Scavenger receptor class A-like, serine protease OS=Anopheles darlingi GN=AND_002482 PE=3 SV=1
  383 : W5LYK3_LEPOC        0.39  0.57  179  277  158  255  105    6   13  260  W5LYK3     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
  384 : A7S8Y5_NEMVE        0.38  0.62  177  278  142  238  102    3    5  240  A7S8Y5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109239 PE=3 SV=1
  385 : A7SNZ6_NEMVE        0.38  0.55  178  277  164  263  104    6    8  268  A7SNZ6     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g125541 PE=3 SV=1
  386 : A8QL65_LOCMI        0.38  0.56  177  277  148  244  105    4   12  244  A8QL65     Trypsin-like serine protease (Fragment) OS=Locusta migratoria manilensis GN=TSP PE=2 SV=1
  387 : B2BHH6_MACFA        0.38  0.55  177  278  170  273  111    6   16  275  B2BHH6     Delta tryptase OS=Macaca fascicularis PE=3 SV=1
  388 : B4IUI9_DROYA        0.38  0.56  177  277  176  268  104    6   14  273  B4IUI9     GE22728 OS=Drosophila yakuba GN=Dyak\GE22728 PE=3 SV=1
  389 : B4MHA1_DROVI        0.38  0.57  179  272   52  137   97    4   14  144  B4MHA1     GJ18579 OS=Drosophila virilis GN=Dvir\GJ18579 PE=3 SV=1
  390 : B4PEN0_DROYA        0.38  0.56  177  277  176  268  104    6   14  273  B4PEN0     GE22370 OS=Drosophila yakuba GN=Dyak\GE22370 PE=3 SV=1
  391 : B7QAF1_IXOSC        0.38  0.58  179  276  140  239  104    4   10  241  B7QAF1     Serine protease, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW012149 PE=3 SV=1
  392 : B8Q220_MACFA        0.38  0.55  177  278  163  266  111    6   16  268  B8Q220     Delta tryptase 1 (Fragment) OS=Macaca fascicularis PE=2 SV=1
  393 : B8Q221_MACFA        0.38  0.55  177  278  163  266  111    6   16  268  B8Q221     Delta tryptase 2 (Fragment) OS=Macaca fascicularis PE=2 SV=1
  394 : C3Y9E4_BRAFL        0.38  0.54   29  175   24  158  149    7   16  269  C3Y9E4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_57333 PE=3 SV=1
  395 : C3YE72_BRAFL        0.38  0.61  177  277  128  227  104    4    7  242  C3YE72     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_74194 PE=3 SV=1
  396 : C3Z681_BRAFL        0.38  0.63  177  272   11  104   98    3    6  104  C3Z681     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_235449 PE=3 SV=1
  397 : D4A7D9_RAT          0.38  0.55  177  278  150  242  102    3    9  243  D4A7D9     Uncharacterized protein OS=Rattus norvegicus GN=Prss2 PE=3 SV=1
  398 : E0R7R1_DROME        0.38  0.56  177  272   90  181   99    5   10  193  E0R7R1     MIP21157p OS=Drosophila melanogaster GN=CG4613-RA PE=2 SV=1
  399 : E2BS73_HARSA        0.38  0.64  178  275  116  206  100    5   11  209  E2BS73     Trypsin-7 OS=Harpegnathos saltator GN=EAI_16636 PE=3 SV=1
  400 : E6ZH35_DICLA        0.38  0.59   29  172    8  143  145    6   10  300  E6ZH35     Polyserase-2 OS=Dicentrarchus labrax GN=POLS2 PE=3 SV=1
  401 : E9GY92_DAPPU        0.38  0.58  177  272  110  204  100    3    9  209  E9GY92     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_299571 PE=3 SV=1
  402 : F6PV82_CIOIN        0.38  0.57  177  264   26  114   92    3    7  114  F6PV82     Uncharacterized protein OS=Ciona intestinalis PE=3 SV=2
  403 : F6XD47_MACMU        0.38  0.55  177  278  115  218  111    6   16  220  F6XD47     Uncharacterized protein OS=Macaca mulatta GN=TPSD1 PE=3 SV=1
  404 : F6XVK2_CIOIN        0.38  0.56  177  278  118  218  104    3    5  224  F6XVK2     Uncharacterized protein (Fragment) OS=Ciona intestinalis GN=Cin.32617 PE=3 SV=1
  405 : F7AFK1_HORSE        0.38  0.55  179  278  136  227  102    5   12  228  F7AFK1     Uncharacterized protein (Fragment) OS=Equus caballus GN=KLK12 PE=3 SV=1
  406 : F7C6H1_ORNAN        0.38  0.58  180  278  164  262  109    9   20  264  F7C6H1     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=C1RL PE=3 SV=1
  407 : F7CC75_MACMU        0.38  0.55  177  278  176  279  111    6   16  281  F7CC75     Uncharacterized protein OS=Macaca mulatta GN=TPSD1 PE=3 SV=1
  408 : F7DD53_ORNAN        0.38  0.59  179  277   91  180   99    3    9  182  F7DD53     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100088582 PE=3 SV=1
  409 : F7EWZ8_CALJA        0.38  0.56  177  278  140  243  111    7   16  245  F7EWZ8     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=TPSD1 PE=3 SV=1
  410 : F7GSU5_MACMU        0.38  0.54  179  277   45  135  100    3   10  137  F7GSU5     Uncharacterized protein OS=Macaca mulatta GN=KLK6 PE=3 SV=1
  411 : G1PBU5_MYOLU        0.38  0.54  177  278  149  246  105    4   10  247  G1PBU5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
  412 : G1QC94_MYOLU        0.38  0.56  179  276   88  177   99    4   10  180  G1QC94     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
  413 : G1RAY7_NOMLE        0.38  0.56  177  277   92  188  105    5   12  239  G1RAY7     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=TPSG1 PE=3 SV=1
  414 : G3R522_GORGO        0.38  0.55  179  277   65  156  101    7   11  158  G3R522     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101141122 PE=3 SV=1
  415 : G3VNE5_SARHA        0.38  0.58  177  278  177  282  111    5   14  283  G3VNE5     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=LOC100919921 PE=3 SV=1
  416 : G9KIV2_MUSPF        0.38  0.58  179  277  104  193   99    3    9  194  G9KIV2     Protease, serine, 3 (Fragment) OS=Mustela putorius furo PE=2 SV=1
  417 : H2SKI0_TAKRU        0.38  0.55   29  175   30  164  148    7   14  261  H2SKI0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  418 : H2SKI4_TAKRU        0.38  0.52   29  170   12  141  143    6   14  239  H2SKI4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  419 : H2ZYP9_LATCH        0.38  0.51  177  277  131  225  104    8   12  227  H2ZYP9     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  420 : I3JSK8_ORENI        0.38  0.57   29  175   34  167  148    6   15  352  I3JSK8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=3 SV=1
  421 : I3JZT1_ORENI        0.38  0.57  177  278  155  251  104    4    9  252  I3JZT1     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100700058 PE=3 SV=1
  422 : I3LW39_SPETR        0.38  0.51   29  175   66  205  152    6   17  336  I3LW39     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=TMPRSS12 PE=3 SV=1
  423 : I3NH98_SPETR        0.38  0.51   29  175   79  218  152    6   17  349  I3NH98     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=TMPRSS12 PE=3 SV=1
  424 : L5KJX7_PTEAL        0.38  0.54  177  272   57  148   99    6   10  169  L5KJX7     Mastin OS=Pteropus alecto GN=PAL_GLEAN10011749 PE=3 SV=1
  425 : L5MGD4_MYODS        0.38  0.58  177  278  166  269  111    6   16  271  L5MGD4     Tryptase OS=Myotis davidii GN=MDA_GLEAN10001094 PE=3 SV=1
  426 : L8Y7E6_TUPCH        0.38  0.61  179  277   71  167  102    5    8  168  L8Y7E6     Serine protease DESC4 OS=Tupaia chinensis GN=TREES_T100008183 PE=3 SV=1
  427 : L8YAR2_TUPCH        0.38  0.55  177  272   55  148   98    4    6  154  L8YAR2     Transmembrane protease serine 11B OS=Tupaia chinensis GN=TREES_T100008185 PE=3 SV=1
  428 : R4GM81_CHICK        0.38  0.54  177  272   88  181   98    4    6  187  R4GM81     Uncharacterized protein OS=Gallus gallus GN=TMPRSS11E PE=3 SV=1
  429 : S4RSR1_PETMA        0.38  0.61  178  277  159  251  102    4   11  253  S4RSR1     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  430 : U1NTP1_ASCSU        0.38  0.62  177  273  108  202  100    4    8  209  U1NTP1     Plasminogen OS=Ascaris suum GN=ASU_05864 PE=3 SV=1
  431 : U3JYF3_FICAL        0.38  0.60  177  277  127  220  103    7   11  222  U3JYF3     Uncharacterized protein (Fragment) OS=Ficedula albicollis PE=3 SV=1
  432 : U4U4Y7_DENPD        0.38  0.61  179  277  109  207  104    4   10  207  U4U4Y7     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=D910_02458 PE=3 SV=1
  433 : U5EXZ3_9DIPT        0.38  0.57  177  278  125  225  106    5    9  235  U5EXZ3     Putative trypsin-like serine protease (Fragment) OS=Corethrella appendiculata PE=2 SV=1
  434 : U6DRF1_NEOVI        0.38  0.52   29  170   40  171  143    5   12  285  U6DRF1     Protein C (Inactivator of coagulation factors Va and VIIIa) (Fragment) OS=Neovison vison GN=F5H880 PE=2 SV=1
  435 : V5HUF4_IXORI        0.38  0.58  180  277   26  118   99    4    7  154  V5HUF4     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
  436 : V5HYR5_IXORI        0.38  0.58  177  277   63  158  102    4    7  175  V5HYR5     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
  437 : V9L3W3_CALMI        0.38  0.59  177  277  166  260  104    4   12  267  V9L3W3     Granzyme A OS=Callorhynchus milii PE=2 SV=1
  438 : V9LF70_CALMI        0.38  0.56  177  277   72  166  104    4   12  173  V9LF70     Granzyme A-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
  439 : V9LIK4_CALMI        0.38  0.59  182  278   41  133   98    4    6  166  V9LIK4     Serine protease 55-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
  440 : V9LJ60_CALMI        0.38  0.59  182  278   48  140   98    4    6  171  V9LJ60     Serine protease 55-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
  441 : W4YUQ0_STRPU        0.38  0.60  178  278  102  198  102    3    6  199  W4YUQ0     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
  442 : X1YM34_ANODA        0.38  0.63  179  278   69  163  102    5    9  169  X1YM34     Uncharacterized protein OS=Anopheles darlingi PE=4 SV=1
  443 : A5HBA3_MACFA        0.37  0.54  177  278   92  195  111    5   16  197  A5HBA3     Tryptase (Fragment) OS=Macaca fascicularis PE=3 SV=1
  444 : A8C590_PANTR        0.37  0.54  177  278  170  273  111    5   16  275  A8C590     Tryptase beta OS=Pan troglodytes GN=LOC749958 PE=3 SV=1
  445 : A8C6G1_9PRIM        0.37  0.54  177  278  170  273  111    5   16  275  A8C6G1     Beta 1 tryptase OS=Gorilla gorilla PE=3 SV=1
  446 : A8C6G4_9PRIM        0.37  0.54  177  278  170  273  111    5   16  275  A8C6G4     Beta 2 tryptase OS=Gorilla gorilla PE=3 SV=1
  447 : A8C6G6_9PRIM        0.37  0.54  177  278  170  273  111    5   16  275  A8C6G6     Beta 3 tryptase OS=Gorilla gorilla PE=3 SV=1
  448 : A8CXJ3_PONAB        0.37  0.55  177  278  170  273  111    5   16  275  A8CXJ3     Beta tryptase 1 OS=Pongo abelii PE=3 SV=1
  449 : A8CXJ8_PONAB        0.37  0.55  177  278  170  273  111    5   16  275  A8CXJ8     Beta tryptase 4 OS=Pongo abelii GN=LOC100294628 PE=3 SV=1
  450 : A8E5D9_DANRE        0.37  0.58   29  175   34  169  149    7   15  328  A8E5D9     Zgc:101788 protein OS=Danio rerio GN=zgc:101788 PE=2 SV=1
  451 : B3NXK6_DROER        0.37  0.53   29  170   38  165  143    4   16  276  B3NXK6     GG19374 OS=Drosophila erecta GN=Dere\GG19374 PE=3 SV=1
  452 : B3RZF9_TRIAD        0.37  0.58  177  278  149  249  106    6    9  253  B3RZF9     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_26286 PE=3 SV=1
  453 : B4NJM4_DROWI        0.37  0.63  179  278  124  218  102    4    9  223  B4NJM4     GK13880 OS=Drosophila willistoni GN=Dwil\GK13880 PE=3 SV=1
  454 : B7PTD2_IXOSC        0.37  0.58  177  277   95  190  103    7    9  207  B7PTD2     Serine protease, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW007715 PE=3 SV=1
  455 : C3YS93_BRAFL        0.37  0.57  177  278    3  103  104    2    5  104  C3YS93     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_232486 PE=3 SV=1
  456 : C3ZQT8_BRAFL        0.37  0.61  177  278   64  164  105    4    7  169  C3ZQT8     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_213844 PE=3 SV=1
  457 : C3ZW47_BRAFL        0.37  0.56   29  170    1  141  145    5    7  255  C3ZW47     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_241477 PE=3 SV=1
  458 : D3Z3S5_MOUSE        0.37  0.59  177  278  126  218  103    5   11  219  D3Z3S5     Uncharacterized protein OS=Mus musculus GN=Gm4744 PE=3 SV=2
  459 : E2AFY8_CAMFO        0.37  0.61  179  278  139  233  102    6    9  238  E2AFY8     Trypsin-1 (Fragment) OS=Camponotus floridanus GN=EAG_11670 PE=3 SV=1
  460 : E2QZX5_CANFA        0.37  0.53   29  175   28  159  150    8   21  305  E2QZX5     Uncharacterized protein OS=Canis familiaris GN=PRSS48 PE=3 SV=2
  461 : E3NYI2_9NEOP        0.37  0.57  177  274  130  220  100    3   11  224  E3NYI2     Fibrinolytic enzyme (Fragment) OS=Eupolyphaga sinensis PE=2 SV=1
  462 : F1Q817_DANRE        0.37  0.58   29  175   34  169  149    7   15  328  F1Q817     Uncharacterized protein OS=Danio rerio GN=zgc:101788 PE=4 SV=1
  463 : F1QAL8_DANRE        0.37  0.55   29  173   34  167  148    9   17  387  F1QAL8     Uncharacterized protein OS=Danio rerio GN=zgc:162180 PE=4 SV=1
  464 : F7DDY1_MACMU        0.37  0.54  195  278    1   88   93    5   14  127  F7DDY1     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=LOC697965 PE=3 SV=1
  465 : F7DGA6_XENTR        0.37  0.50  179  278  140  244  110    5   15  258  F7DGA6     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC101734975 PE=3 SV=1
  466 : F7F9V1_CALJA        0.37  0.54  177  278  170  273  111    6   16  275  F7F9V1     Uncharacterized protein OS=Callithrix jacchus GN=LOC100409652 PE=3 SV=1
  467 : F8W8D0_HUMAN        0.37  0.54  177  278  169  272  111    5   16  274  F8W8D0     Tryptase beta-2 OS=Homo sapiens GN=TPSB2 PE=3 SV=1
  468 : G1M6R2_AILME        0.37  0.57  179  278  157  248  102    5   12  249  G1M6R2     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=KLK12 PE=3 SV=1
  469 : G1Q230_MYOLU        0.37  0.58  177  278  109  203  103    5    9  205  G1Q230     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
  470 : G3PPY1_GASAC        0.37  0.58   29  172   36  166  146    8   17  321  G3PPY1     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  471 : G3UXD0_MOUSE        0.37  0.56  177  276   45  135  100    2    9  135  G3UXD0     Protein Try5 (Fragment) OS=Mus musculus GN=Try5 PE=3 SV=1
  472 : G7NP47_MACMU        0.37  0.54  195  278    1   88   93    5   14  122  G7NP47     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_12398 PE=3 SV=1
  473 : G7PYG0_MACFA        0.37  0.56  179  277  109  198  101    7   13  200  G7PYG0     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_10027 PE=3 SV=1
  474 : G7Q0A0_MACFA        0.37  0.54  195  278    1   88   93    5   14  124  G7Q0A0     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_11376 PE=3 SV=1
  475 : H2L6J6_ORYLA        0.37  0.57   29  171   11  139  144    5   16  277  H2L6J6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156975 PE=3 SV=1
  476 : H2L6N7_ORYLA        0.37  0.53   29  172   24  153  145    5   16  258  H2L6N7     Uncharacterized protein OS=Oryzias latipes GN=LOC101158197 PE=3 SV=1
  477 : H2L6P3_ORYLA        0.37  0.54   29  172   37  166  145    5   16  264  H2L6P3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101158445 PE=3 SV=1
  478 : H2L6Y9_ORYLA        0.37  0.53   29  175   36  168  150    8   20  282  H2L6Y9     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101159194 PE=3 SV=1
  479 : H2LQ82_ORYLA        0.37  0.52  179  278   55  150  102    4    8  198  H2LQ82     Uncharacterized protein OS=Oryzias latipes GN=LOC101175029 PE=3 SV=1
  480 : H2MNE8_ORYLA        0.37  0.58  177  276  168  260  102    4   11  263  H2MNE8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101171987 PE=3 SV=1
  481 : H2NRZ7_PONAB        0.37  0.59  177  278  109  210  107    4   10  236  H2NRZ7     Uncharacterized protein (Fragment) OS=Pongo abelii GN=PRSS21 PE=3 SV=1
  482 : H2QVI9_PANTR        0.37  0.56  179  277    3   92   99    2    9   93  H2QVI9     Uncharacterized protein (Fragment) OS=Pan troglodytes PE=3 SV=1
  483 : H2SKH8_TAKRU        0.37  0.52   29  175   34  162  149    7   22  292  H2SKH8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  484 : H2SKI1_TAKRU        0.37  0.52   29  175   31  162  149    7   19  299  H2SKI1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  485 : H2SKI3_TAKRU        0.37  0.54   29  175   37  170  149    7   17  298  H2SKI3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  486 : H2UJF6_TAKRU        0.37  0.46   29  173   31  168  150    9   17  278  H2UJF6     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074028 PE=3 SV=1
  487 : H9KC33_APIME        0.37  0.58  177  278  120  219  105    6    8  220  H9KC33     Uncharacterized protein OS=Apis mellifera GN=SP29 PE=3 SV=2
  488 : I3JIS6_ORENI        0.37  0.54   29  175    1  129  147    5   18  146  I3JIS6     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=3 SV=1
  489 : I3JSK7_ORENI        0.37  0.56   29  175   46  179  148    6   15  307  I3JSK7     Uncharacterized protein OS=Oreochromis niloticus PE=3 SV=1
  490 : I3JSL1_ORENI        0.37  0.57   29  175   36  169  149    7   17  303  I3JSL1     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100696787 PE=3 SV=1
  491 : I3M3U1_SPETR        0.37  0.54  179  277  136  226  100    4   10  228  I3M3U1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=KLK14 PE=3 SV=1
  492 : I3MX64_SPETR        0.37  0.51   29  175    3  142  149    7   11  276  I3MX64     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=TMPRSS12 PE=3 SV=1
  493 : J9P5A1_CANFA        0.37  0.61  179  277   10  106  101    3    6  107  J9P5A1     Uncharacterized protein OS=Canis familiaris PE=3 SV=1
  494 : K7FI79_PELSI        0.37  0.60   30  175   71  204  148    7   16  273  K7FI79     Uncharacterized protein OS=Pelodiscus sinensis PE=3 SV=1
  495 : L8I934_9CETA        0.37  0.52   29  175   82  214  151    8   22  298  L8I934     Serine protease 42 (Fragment) OS=Bos mutus GN=M91_11275 PE=3 SV=1
  496 : M4AH70_XIPMA        0.37  0.54   29  175   36  173  150    5   15  303  M4AH70     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  497 : Q2F9N6_9PRIM        0.37  0.52  182  278  112  208  102    4   10  221  Q2F9N6     Cogulation factor VII (Fragment) OS=Gorilla gorilla GN=F7 PE=3 SV=1
  498 : Q2F9N9_9PRIM        0.37  0.52  182  278  112  208  102    4   10  221  Q2F9N9     Cogulation factor VII (Fragment) OS=Gorilla gorilla GN=F7 PE=3 SV=1
  499 : Q4T1C5_TETNG        0.37  0.53  179  276   88  176   98    3    9  176  Q4T1C5     Chromosome undetermined SCAF10672, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00008892001 PE=3 SV=1
  500 : Q5BL24_DANRE        0.37  0.58   29  175   34  169  149    7   15  328  Q5BL24     Zgc:101788 OS=Danio rerio GN=zgc:101788 PE=2 SV=1
  501 : Q6B051_HUMAN        0.37  0.54  177  278  170  273  111    5   16  275  Q6B051     Tryptase alpha/beta 1 OS=Homo sapiens GN=TPSAB1 PE=2 SV=1
  502 : Q6FHB8_HUMAN        0.37  0.54  177  278  170  273  111    5   16  275  Q6FHB8     TPSB2 protein (Fragment) OS=Homo sapiens GN=TPSB2 PE=2 SV=1
  503 : Q6GKZ6_DROME        0.37  0.54  179  272   52  137   97    4   14  141  Q6GKZ6     LP03006p OS=Drosophila melanogaster GN=CG30031 PE=2 SV=1
  504 : Q7PWE3_ANOGA        0.37  0.60  179  278  147  246  105    4   10  248  Q7PWE3     AGAP008997-PA (Fragment) OS=Anopheles gambiae GN=AGAP008997 PE=3 SV=4
  505 : R0JGZ4_ANAPL        0.37  0.51  179  278  137  228  102    6   12  229  R0JGZ4     Kallikrein-6 (Fragment) OS=Anas platyrhynchos GN=Anapl_17536 PE=3 SV=1
  506 : R4GCJ3_ANOCA        0.37  0.59  178  278   89  180  101    2    9  181  R4GCJ3     Uncharacterized protein OS=Anolis carolinensis GN=LOC100567111 PE=3 SV=1
  507 : S7MMR5_MYOBR        0.37  0.57  179  277   54  143   99    2    9  146  S7MMR5     Anionic trypsin OS=Myotis brandtii GN=D623_10026150 PE=3 SV=1
  508 : S7PYK1_MYOBR        0.37  0.57  179  276   97  186   99    3   10  191  S7PYK1     Kallikrein-6 OS=Myotis brandtii GN=D623_10017711 PE=3 SV=1
  509 : S9Y0E1_9CETA        0.37  0.61  179  277   71  167  102    5    8  168  S9Y0E1     Uncharacterized protein OS=Camelus ferus GN=CB1_000769002 PE=3 SV=1
  510 : T1GRG8_MEGSC        0.37  0.52  179  278  134  225  103    6   14  226  T1GRG8     Uncharacterized protein (Fragment) OS=Megaselia scalaris PE=3 SV=1
  511 : T1PB51_MUSDO        0.37  0.55  177  277   82  174  102    4   10  177  T1PB51     Trypsin OS=Musca domestica PE=2 SV=1
  512 : TRYB1_HUMAN 2ZEB    0.37  0.54  177  278  170  273  111    5   16  275  Q15661     Tryptase alpha/beta-1 OS=Homo sapiens GN=TPSAB1 PE=1 SV=1
  513 : TRYB2_HUMAN 2FXR    0.37  0.54  177  278  170  273  111    5   16  275  P20231     Tryptase beta-2 OS=Homo sapiens GN=TPSB2 PE=1 SV=2
  514 : U4V0Q5_DENPD        0.37  0.61  189  278   14  103   93    3    6  105  U4V0Q5     Uncharacterized protein OS=Dendroctonus ponderosae GN=D910_01678 PE=3 SV=1
  515 : U6CYT4_NEOVI        0.37  0.51  179  278    1  104  109    4   14  149  U6CYT4     Protease, serine 27 (Fragment) OS=Neovison vison GN=B3KP25 PE=2 SV=1
  516 : U6DPX2_NEOVI        0.37  0.59  177  278   63  157  103    5    9  158  U6DPX2     Chymotrypsin-like protease CTRL-1 (Fragment) OS=Neovison vison GN=CTRL PE=2 SV=1
  517 : V4AMS9_LOTGI        0.37  0.53  178  278  137  233  102    3    6  233  V4AMS9     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_66705 PE=3 SV=1
  518 : V9LFU3_CALMI        0.37  0.55  177  276   29  122  103    4   12  130  V9LFU3     Granzyme A-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
  519 : V9LJL0_CALMI        0.37  0.51  178  278   47  138  101    2    9  139  V9LJL0     Trypsin (Fragment) OS=Callorhynchus milii PE=2 SV=1
  520 : W4YVS2_STRPU        0.37  0.60  177  277   25  126  105    3    7  198  W4YVS2     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
  521 : W5M9F9_LEPOC        0.37  0.53  179  278  125  215  100    3    9  216  W5M9F9     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
  522 : A3KP90_DANRE        0.36  0.56   29  173   36  167  146    5   15  313  A3KP90     MGC163079 protein OS=Danio rerio GN=MGC163079 PE=2 SV=1
  523 : A4FVH9_DANRE        0.36  0.55   29  173   34  167  148    9   17  387  A4FVH9     Zgc:162180 protein OS=Danio rerio GN=zgc:162180 PE=2 SV=1
  524 : A7RR41_NEMVE        0.36  0.57  177  277  121  219  104    5    8  220  A7RR41     Predicted protein OS=Nematostella vectensis GN=v1g200868 PE=3 SV=1
  525 : A7SBW3_NEMVE        0.36  0.56  177  276  134  229  103    5   10  237  A7SBW3     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g112683 PE=3 SV=1
  526 : A7SGX2_NEMVE        0.36  0.53   29  175   65  200  148    5   13  299  A7SGX2     Predicted protein OS=Nematostella vectensis GN=v1g170524 PE=3 SV=1
  527 : A7SQE8_NEMVE        0.36  0.52   29  175    2  145  150    6    9  246  A7SQE8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127469 PE=3 SV=1
  528 : A8CXJ5_PONAB        0.36  0.54  177  278  170  273  111    5   16  275  A8CXJ5     Beta tryptase 2 OS=Pongo abelii PE=3 SV=1
  529 : B1PDJ1_CORCL        0.36  0.59  177  275   78  167   99    3    9  167  B1PDJ1     Anionic trypsin II (Fragment) OS=Coregonus clupeaformis PE=2 SV=1
  530 : B3RP98_TRIAD        0.36  0.53  177  276   99  190  101    4   10  191  B3RP98     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_21288 PE=3 SV=1
  531 : B3RZF9_TRIAD        0.36  0.54   29  172    4  144  151    7   17  253  B3RZF9     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_26286 PE=3 SV=1
  532 : B4DPC8_HUMAN        0.36  0.53   29  170   23  154  143    5   12  272  B4DPC8     cDNA FLJ51023, highly similar to Vitamin K-dependent protein C (EC 3.4.21.69) OS=Homo sapiens PE=2 SV=1
  533 : B4IAI0_DROSE        0.36  0.53  177  277   49  141  103    3   12  147  B4IAI0     GM19492 OS=Drosophila sechellia GN=Dsec\GM19492 PE=3 SV=1
  534 : B4LJ11_DROVI        0.36  0.51  179  278   52  143  103    4   14  144  B4LJ11     GJ20847 OS=Drosophila virilis GN=Dvir\GJ20847 PE=3 SV=1
  535 : B7Q2U2_IXOSC        0.36  0.50  179  278   75  178  109    6   14  212  B7Q2U2     Serine protease, putative OS=Ixodes scapularis GN=IscW_ISCW009051 PE=3 SV=1
  536 : B9V2Y5_EPICO        0.36  0.47   29  172   31  163  147    6   17  269  B9V2Y5     Elastase 4 (Fragment) OS=Epinephelus coioides PE=2 SV=1
  537 : C1BYQ9_ESOLU        0.36  0.56   29  175   39  172  148    6   15  299  C1BYQ9     Serine protease 27 OS=Esox lucius GN=PRS27 PE=2 SV=1
  538 : C3KJ30_ANOFI        0.36  0.59   29  175   33  166  149    8   17  320  C3KJ30     Polyserase-2 OS=Anoplopoma fimbria GN=POLS2 PE=2 SV=1
  539 : C3YIV9_BRAFL        0.36  0.54   42  175    3  129  134    4    7  229  C3YIV9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_86658 PE=3 SV=1
  540 : C3Z7V1_BRAFL        0.36  0.53   29  175   22  154  148    5   16  257  C3Z7V1     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_119044 PE=3 SV=1
  541 : C3ZUU1_BRAFL        0.36  0.51   29  175   21  154  148    6   15  262  C3ZUU1     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_92719 PE=3 SV=1
  542 : D2GXR9_AILME        0.36  0.53   29  174   31  161  148    9   19  308  D2GXR9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_001721 PE=3 SV=1
  543 : D3TKY5_GLOMM        0.36  0.57  183  278   84  174   96    2    5  174  D3TKY5     Proclotting enzyme (Fragment) OS=Glossina morsitans morsitans PE=2 SV=1
  544 : E0DBK1_9TELE        0.36  0.57  177  278  129  221  102    3    9  222  E0DBK1     Trypsin-1 (Fragment) OS=Gadus macrocephalus GN=tryp PE=2 SV=1
  545 : E0DBK2_9TELE        0.36  0.57  177  278  129  221  102    3    9  222  E0DBK2     Trypsin-2 (Fragment) OS=Gadus macrocephalus GN=tryp PE=2 SV=1
  546 : E2RSM7_CANFA        0.36  0.52   29  173   36  165  146    6   17  265  E2RSM7     Uncharacterized protein (Fragment) OS=Canis familiaris GN=CTRB2 PE=3 SV=2
  547 : E5T427_TRISP        0.36  0.54  182  277    3   99  101    5    9  148  E5T427     Serine protease, trypsin family OS=Trichinella spiralis GN=Tsp_13993 PE=3 SV=1
  548 : E7F2C1_DANRE        0.36  0.58   29  175   34  169  149    7   15  328  E7F2C1     Uncharacterized protein OS=Danio rerio GN=si:dkeyp-41g9.6 PE=4 SV=1
  549 : E9Q698_MOUSE        0.36  0.53  182  278   47  143  100    4    6  143  E9Q698     Coagulation factor XII OS=Mus musculus GN=F12 PE=3 SV=1
  550 : F1QS72_DANRE        0.36  0.56   29  173   36  167  146    5   15  313  F1QS72     Uncharacterized protein OS=Danio rerio GN=zgc:163079 PE=3 SV=1
  551 : F1QTV7_DANRE        0.36  0.57   29  175   36  170  150   10   18  310  F1QTV7     Uncharacterized protein OS=Danio rerio GN=zgc:123295 PE=3 SV=1
  552 : F6PGC6_ORNAN        0.36  0.58  179  277   98  188  100    4   10  190  F6PGC6     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=KLK14 PE=3 SV=1
  553 : F6QBU7_MACMU        0.36  0.56  179  277   27  116  100    3   11  119  F6QBU7     Uncharacterized protein OS=Macaca mulatta GN=KLK8 PE=3 SV=1
  554 : F6QXJ0_ORNAN        0.36  0.55   29  170  121  252  145    7   16  252  F6QXJ0     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PROC PE=3 SV=1
  555 : F6S6A4_MONDO        0.36  0.58   29  175   47  181  148    7   14  340  F6S6A4     Uncharacterized protein OS=Monodelphis domestica GN=PRSS8 PE=3 SV=2
  556 : F6SCN4_MONDO        0.36  0.59  177  277  147  251  110    6   14  271  F6SCN4     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=PRSS42 PE=3 SV=1
  557 : F6TBJ4_MACMU        0.36  0.51  178  276  124  214  101    6   12  218  F6TBJ4     Prostate-specific antigen OS=Macaca mulatta GN=KLK3 PE=3 SV=1
  558 : F6TMC3_MACMU        0.36  0.55   29  175   45  179  148    6   14  343  F6TMC3     Uncharacterized protein OS=Macaca mulatta GN=PRSS8 PE=3 SV=1
  559 : F6TUE2_XENTR        0.36  0.53   29  175   41  175  148    5   14  362  F6TUE2     Uncharacterized protein OS=Xenopus tropicalis GN=LOC595077 PE=3 SV=1
  560 : F6UMK0_CIOIN        0.36  0.56  178  276  157  256  105    5   11  256  F6UMK0     Uncharacterized protein OS=Ciona intestinalis GN=LOC100176264 PE=3 SV=2
  561 : F6XW77_XENTR        0.36  0.53   29  175   44  178  148    5   14  365  F6XW77     Uncharacterized protein OS=Xenopus tropicalis GN=LOC595077 PE=3 SV=1
  562 : F7B2A5_HORSE        0.36  0.57  177  277  133  225  103    5   12  227  F7B2A5     Uncharacterized protein OS=Equus caballus GN=KLK4 PE=3 SV=1
  563 : F7C5M9_MONDO        0.36  0.51  182  277  111  206  104    8   16  209  F7C5M9     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=C1RL PE=3 SV=1
  564 : F7D8G9_HORSE        0.36  0.54   29  174    7  140  149    7   18  295  F7D8G9     Uncharacterized protein OS=Equus caballus GN=PRSS27 PE=3 SV=1
  565 : F7DJ78_HORSE        0.36  0.55   29  175    8  146  147    5    8  250  F7DJ78     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100147321 PE=3 SV=1
  566 : F7DSM1_CALJA        0.36  0.55   29  175   28  159  150    8   21  321  F7DSM1     Uncharacterized protein OS=Callithrix jacchus GN=PRSS48 PE=3 SV=1
  567 : F7E740_CALJA        0.36  0.55   29  175   43  174  150    8   21  336  F7E740     Uncharacterized protein OS=Callithrix jacchus GN=PRSS48 PE=3 SV=1
  568 : F7ESM3_MACMU        0.36  0.52  178  277  101  192  101    4   10  204  F7ESM3     Prostate-specific antigen OS=Macaca mulatta GN=KLK3 PE=3 SV=1
  569 : F7IDB2_CALJA        0.36  0.56  179  277   27  116  100    3   11  119  F7IDB2     Uncharacterized protein OS=Callithrix jacchus GN=KLK8 PE=3 SV=1
  570 : G1L660_AILME        0.36  0.50   29  175   81  220  152    6   17  351  G1L660     Uncharacterized protein OS=Ailuropoda melanoleuca GN=TMPRSS12 PE=3 SV=1
  571 : G1MJE8_AILME        0.36  0.53   29  174   40  170  148    9   19  311  G1MJE8     Uncharacterized protein OS=Ailuropoda melanoleuca GN=PRSS48 PE=3 SV=1
  572 : G1MX78_MELGA        0.36  0.64  180  277    4   97   98    2    4  100  G1MX78     Uncharacterized protein (Fragment) OS=Meleagris gallopavo PE=3 SV=2
  573 : G1NXP8_MYOLU        0.36  0.51   29  175   40  171  150    9   21  313  G1NXP8     Uncharacterized protein OS=Myotis lucifugus GN=PRSS48 PE=3 SV=1
  574 : G1QEN6_MYOLU        0.36  0.57  177  278  170  273  111    5   16  275  G1QEN6     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
  575 : G1TZK8_RABIT        0.36  0.53   29  175   40  171  153   11   27  328  G1TZK8     Uncharacterized protein OS=Oryctolagus cuniculus GN=PRSS48 PE=3 SV=1
  576 : G3HKG5_CRIGR        0.36  0.52   29  171   27  154  146   10   21  296  G3HKG5     Epidermis-specific serine protease-like protein OS=Cricetulus griseus GN=I79_011185 PE=3 SV=1
  577 : G3I4R8_CRIGR        0.36  0.58  179  277   67  157  101    6   12  167  G3I4R8     Kallikrein-4 OS=Cricetulus griseus GN=I79_018451 PE=3 SV=1
  578 : G3IMQ0_CRIGR        0.36  0.54  179  278   95  186  101    4   10  197  G3IMQ0     Kallikrein-13 OS=Cricetulus griseus GN=I79_025194 PE=3 SV=1
  579 : G3N1W6_BOVIN        0.36  0.55  179  278  120  211  101    4   10  212  G3N1W6     Uncharacterized protein (Fragment) OS=Bos taurus GN=KLK11 PE=3 SV=1
  580 : G3PPU0_GASAC        0.36  0.54   29  175   37  170  149    6   17  274  G3PPU0     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  581 : G3Q4K7_GASAC        0.36  0.53   29  175   10  143  150    6   19  333  G3Q4K7     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=TMPRSS9 (8 of 8) PE=3 SV=1
  582 : G3Q4L0_GASAC        0.36  0.53   29  175   36  169  150    6   19  306  G3Q4L0     Uncharacterized protein OS=Gasterosteus aculeatus GN=TMPRSS9 (8 of 8) PE=3 SV=1
  583 : G3QAX6_GASAC        0.36  0.55   29  175   97  243  156   12   18  345  G3QAX6     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  584 : G3TP78_LOXAF        0.36  0.57   29  175   44  178  148    6   14  337  G3TP78     Uncharacterized protein OS=Loxodonta africana GN=PRSS8 PE=3 SV=1
  585 : G3WZR1_SARHA        0.36  0.52   29  175   44  179  149    7   15  317  G3WZR1     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100915923 PE=3 SV=1
  586 : G3XL84_CYPCA        0.36  0.53   29  171   21  143  144    7   22  242  G3XL84     Trypsin 1 OS=Cyprinus carpio GN=tryp1 PE=2 SV=1
  587 : G3XL85_CYPCA        0.36  0.53   29  171   21  143  144    7   22  242  G3XL85     Trypsin 2 OS=Cyprinus carpio GN=tryp2 PE=2 SV=1
  588 : G5B1K5_HETGA        0.36  0.61  177  278  114  215  107    4   10  242  G5B1K5     Testisin OS=Heterocephalus glaber GN=GW7_03666 PE=3 SV=1
  589 : G9KIN6_MUSPF        0.36  0.52   29  170   33  164  143    5   12  278  G9KIN6     Protein C (Fragment) OS=Mustela putorius furo PE=2 SV=1
  590 : G9KIU7_MUSPF        0.36  0.56  177  278  111  212  108    4   12  230  G9KIU7     Protease, serine, 21 (Fragment) OS=Mustela putorius furo PE=2 SV=1
  591 : G9L5G2_MUSPF        0.36  0.56  182  278    9  102   99    4    7  109  G9L5G2     Transmembrane protease, serine 13 (Fragment) OS=Mustela putorius furo PE=2 SV=1
  592 : H0X811_OTOGA        0.36  0.56  177  278  170  273  111    5   16  275  H0X811     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  593 : H0Z7M3_TAEGU        0.36  0.58  177  277   90  183  103    7   11  185  H0Z7M3     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  594 : H1A420_TAEGU        0.36  0.56  182  277    5   97   98    3    7   99  H1A420     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  595 : H2L6J3_ORYLA        0.36  0.57   29  171   52  181  143    6   13  287  H2L6J3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156975 PE=3 SV=1
  596 : H2L6N5_ORYLA        0.36  0.55   29  175   30  161  148    5   17  263  H2L6N5     Uncharacterized protein OS=Oryzias latipes PE=3 SV=1
  597 : H2LPJ6_ORYLA        0.36  0.62   29  175   33  170  148    6   11  325  H2LPJ6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156443 PE=3 SV=1
  598 : H2LQ87_ORYLA        0.36  0.56   29  175   49  183  148    6   14  298  H2LQ87     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101175029 PE=3 SV=1
  599 : H2LQI1_ORYLA        0.36  0.54   29  174    3  135  146    6   13  235  H2LQI1     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101155223 PE=3 SV=1
  600 : H2LXT2_ORYLA        0.36  0.49   29  175   23  156  148    7   15  260  H2LXT2     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101159473 PE=3 SV=1
  601 : H2QA96_PANTR        0.36  0.54  177  278  170  273  111    5   16  275  H2QA96     Uncharacterized protein OS=Pan troglodytes GN=LOC468084 PE=3 SV=1
  602 : H2QAE3_PANTR        0.36  0.59  177  278  100  201  107    4   10  228  H2QAE3     Uncharacterized protein (Fragment) OS=Pan troglodytes GN=PRSS21 PE=3 SV=1
  603 : H2SKH6_TAKRU        0.36  0.51   29  175   38  171  148    6   15  277  H2SKH6     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  604 : H2SKH7_TAKRU        0.36  0.50   29  175   35  166  148    6   17  261  H2SKH7     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  605 : H2SKI2_TAKRU        0.36  0.51   29  175   31  164  148    6   15  279  H2SKI2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  606 : H2SXX4_TAKRU        0.36  0.55   29  173   99  236  152   11   21  347  H2SXX4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  607 : H2UK70_TAKRU        0.36  0.47   29  172   13  151  148    7   13  261  H2UK70     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074248 PE=3 SV=1
  608 : H2VCD6_TAKRU        0.36  0.55   31  171   38  167  143    7   15  285  H2VCD6     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
  609 : H2VCD8_TAKRU        0.36  0.55   31  171   41  170  143    7   15  289  H2VCD8     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
  610 : H3AA69_LATCH        0.36  0.56   29  175   32  166  149    8   16  327  H3AA69     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  611 : H3BMY1_HUMAN        0.36  0.50  178  277   82  166  102    6   19  168  H3BMY1     Chymotrypsin B2 chain A (Fragment) OS=Homo sapiens GN=CTRB2 PE=2 SV=1
  612 : H3CHI1_TETNG        0.36  0.53  179  277   92  181   99    3    9  184  H3CHI1     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  613 : H3CMH7_TETNG        0.36  0.55  177  278  131  223  102    3    9  224  H3CMH7     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  614 : H5ZW25_KRYMA        0.36  0.59  177  278   88  180  102    3    9  181  H5ZW25     Trypsin 4 (Fragment) OS=Kryptolebias marmoratus PE=2 SV=1
  615 : H9F5L2_MACMU        0.36  0.58  182  277   49  142   96    2    2  143  H9F5L2     Neurotrypsin (Fragment) OS=Macaca mulatta GN=PRSS12 PE=2 SV=1
  616 : H9GD94_ANOCA        0.36  0.56   29  172   19  152  147    8   16  289  H9GD94     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100566504 PE=3 SV=1
  617 : H9ZBC7_MACMU        0.36  0.55   29  175   45  179  148    6   14  343  H9ZBC7     Prostasin preproprotein OS=Macaca mulatta GN=PRSS8 PE=2 SV=1
  618 : I3JIS2_ORENI        0.36  0.54   29  171   10  139  145    7   17  302  I3JIS2     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=TMPRSS9 (4 of 18) PE=3 SV=1
  619 : I3JIS8_ORENI        0.36  0.53   29  175   37  167  148    5   18  269  I3JIS8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=TMPRSS9 (6 of 18) PE=3 SV=1
  620 : I3LGM9_PIG          0.36  0.52  182  274   84  176   96    4    6  180  I3LGM9     Uncharacterized protein (Fragment) OS=Sus scrofa PE=3 SV=1
  621 : I3LHI7_PIG          0.36  0.52   29  170   39  165  143    6   17  268  I3LHI7     Uncharacterized protein (Fragment) OS=Sus scrofa GN=LOC100621820 PE=3 SV=1
  622 : I3N073_SPETR        0.36  0.54  177  278  176  279  111    6   16  283  I3N073     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
  623 : J9NUY3_CANFA        0.36  0.53   29  175   28  159  148    7   17  273  J9NUY3     Uncharacterized protein (Fragment) OS=Canis familiaris GN=PRSS48 PE=3 SV=1
  624 : K5L0I8_VIBCL        0.36  0.58  177  274   18  116  106    4   15  155  K5L0I8     Trypsin family protein (Fragment) OS=Vibrio cholerae HC-50A2 GN=VCHC50A2_1738A PE=3 SV=1
  625 : K7F240_PELSI        0.36  0.55  179  277   99  189  100    4   10  191  K7F240     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=3 SV=1
  626 : L5KGQ5_PTEAL        0.36  0.52   29  175   51  186  151    8   19  338  L5KGQ5     Serine protease 27 OS=Pteropus alecto GN=PAL_GLEAN10011665 PE=3 SV=1
  627 : L5KVM7_PTEAL        0.36  0.52   29  173   34  163  146    6   17  263  L5KVM7     Chymotrypsinogen B2 OS=Pteropus alecto GN=PAL_GLEAN10011127 PE=3 SV=1
  628 : L5L629_PTEAL        0.36  0.49  179  278   97  188  101    5   10  189  L5L629     Kallikrein-15 OS=Pteropus alecto GN=PAL_GLEAN10004492 PE=3 SV=1
  629 : L5LNG8_MYODS        0.36  0.57  179  277   47  136   99    2    9  139  L5LNG8     Anionic trypsin OS=Myotis davidii GN=MDA_GLEAN10005348 PE=3 SV=1
  630 : L5MG91_MYODS        0.36  0.57  182  277  106  201  103    5   14  206  L5MG91     Tryptase OS=Myotis davidii GN=MDA_GLEAN10001096 PE=3 SV=1
  631 : L7N3E2_XENTR        0.36  0.56  179  278   88  180  102    5   11  188  L7N3E2     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
  632 : L8Y032_TUPCH        0.36  0.52   29  175    3  135  148    4   16  221  L8Y032     Serine protease 42 OS=Tupaia chinensis GN=TREES_T100002384 PE=3 SV=1
  633 : M1EFC8_MUSPF        0.36  0.54  185  277   51  143   99    5   12  146  M1EFC8     Complement component 1, r subcomponent (Fragment) OS=Mustela putorius furo PE=2 SV=1
  634 : M3WNI5_FELCA        0.36  0.50   29  175   81  220  152    7   17  350  M3WNI5     Uncharacterized protein OS=Felis catus GN=TMPRSS12 PE=3 SV=1
  635 : M4A834_XIPMA        0.36  0.54  179  278   57  147  101    4   11  147  M4A834     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
  636 : M4A900_XIPMA        0.36  0.60   29  173   40  170  146    7   16  305  M4A900     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=TMPRSS9 (3 of 7) PE=3 SV=1
  637 : M7BH31_CHEMY        0.36  0.55  177  277   63  156  103    7   11  158  M7BH31     Chymotrypsinogen B OS=Chelonia mydas GN=UY3_11487 PE=3 SV=1
  638 : M7BHH9_CHEMY        0.36  0.54  179  277  117  207  100    4   10  209  M7BHH9     Anionic trypsin OS=Chelonia mydas GN=UY3_15207 PE=3 SV=1
  639 : M7C7X6_CHEMY        0.36  0.53   29  175   28  162  151   10   20  317  M7C7X6     Serine protease 27 OS=Chelonia mydas GN=UY3_02082 PE=3 SV=1
  640 : PRS48_MOUSE         0.36  0.48   29  175   40  171  149    9   19  312  Q14B25     Serine protease 48 OS=Mus musculus GN=Prss48 PE=2 SV=2
  641 : Q2YDQ2_DANRE        0.36  0.58   29  175   36  170  149    9   16  310  Q2YDQ2     Zgc:123295 OS=Danio rerio GN=zgc:123295 PE=2 SV=1
  642 : Q4VB18_HUMAN        0.36  0.58  179  277    2   92  101    5   12   94  Q4VB18     KLK4 protein OS=Homo sapiens GN=KLK4 PE=3 SV=1
  643 : Q566K9_XENTR        0.36  0.53   29  175   41  175  148    5   14  362  Q566K9     Uncharacterized protein OS=Xenopus tropicalis GN=LOC595077 PE=2 SV=1
  644 : Q86TM8_HUMAN        0.36  0.54  177  278  170  273  111    5   16  275  Q86TM8     TPSAB1 protein OS=Homo sapiens GN=TPSAB1 PE=2 SV=1
  645 : S7MJ95_MYOBR        0.36  0.58  177  278   82  176  103    5    9  178  S7MJ95     Mastin OS=Myotis brandtii GN=D623_10000982 PE=3 SV=1
  646 : S7PHV8_MYOBR        0.36  0.57  177  278  170  273  111    5   16  275  S7PHV8     Tryptase beta-2 OS=Myotis brandtii GN=D623_10017231 PE=3 SV=1
  647 : T1IDC4_RHOPR        0.36  0.58  177  278   93  191  103    3    5  196  T1IDC4     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
  648 : TRYA3_LUCCU         0.36  0.52  179  272   73  158   97    5   14  165  P35043     Trypsin alpha-3 (Fragment) OS=Lucilia cuprina PE=3 SV=1
  649 : TRYT_PIG            0.36  0.54  177  278  170  273  111    6   16  275  Q9N2D1     Tryptase OS=Sus scrofa GN=MCT7 PE=2 SV=1
  650 : U6CY61_NEOVI        0.36  0.53  179  278   45  136  101    3   10  137  U6CY61     Kallikrein 11 isoform 3 OS=Neovison vison GN=Q8IXD7 PE=2 SV=1
  651 : U6CZE6_NEOVI        0.36  0.50  182  273   10  105  101    5   14  110  U6CZE6     Serine protease 33 (Fragment) OS=Neovison vison GN=PRS33 PE=2 SV=1
  652 : V3ZDN5_LOTGI        0.36  0.55  179  276    1   93   98    2    5   93  V3ZDN5     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_68977 PE=3 SV=1
  653 : V5IGW7_IXORI        0.36  0.61  177  278  130  228  103    3    5  230  V5IGW7     Putative serine protease 110 (Fragment) OS=Ixodes ricinus PE=2 SV=1
  654 : W4Y3B8_STRPU        0.36  0.54  177  274   69  168  105    7   12  195  W4Y3B8     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
  655 : W5K6K3_ASTMX        0.36  0.55   29  175   18  154  148    6   12  292  W5K6K3     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=3 SV=1
  656 : W5N3I8_LEPOC        0.36  0.57  180  278  164  256  104    8   16  263  W5N3I8     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
  657 : X1WCM7_DANRE        0.36  0.58   29  175   36  171  149    7   15  330  X1WCM7     Uncharacterized protein OS=Danio rerio GN=si:dkeyp-41g9.6 PE=4 SV=1
  658 : X1XJV4_ACYPI        0.36  0.58  182  276  111  206  100    4    9  209  X1XJV4     Uncharacterized protein OS=Acyrthosiphon pisum GN=LOC100161704 PE=4 SV=1
  659 : A0NAJ5_ANOGA        0.35  0.55  177  275   15  107  102    3   12  110  A0NAJ5     AGAP012842-PA OS=Anopheles gambiae str. PEST GN=AgaP_AGAP012842 PE=3 SV=1
  660 : A7SGX1_NEMVE        0.35  0.56   29  175   13  147  147    5   12  255  A7SGX1     Predicted protein OS=Nematostella vectensis GN=v1g170524 PE=3 SV=1
  661 : A7T2Y0_NEMVE        0.35  0.49  180  277   39  132   99    4    6  135  A7T2Y0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g143608 PE=3 SV=1
  662 : A9QQB1_LYCSI        0.35  0.53  177  272   47  136   96    2    6  152  A9QQB1     Serine protease (Fragment) OS=Lycosa singoriensis PE=2 SV=1
  663 : A9UMI2_XENTR        0.35  0.56  177  275  118  214  104    7   12  219  A9UMI2     Granzyme A (Granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) OS=Xenopus tropicalis GN=gzma PE=2 SV=1
  664 : B2ZA48_CTEID        0.35  0.47   29  172   28  160  147    6   17  266  B2ZA48     Pancreatic elastase OS=Ctenopharyngodon idella GN=Ela1 PE=2 SV=1
  665 : B3RY72_TRIAD        0.35  0.56   29  175    2  135  147    5   13  240  B3RY72     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25111 PE=3 SV=1
  666 : B4NY91_DROYA        0.35  0.57  178  277   63  166  108    5   12  175  B4NY91     GE21111 OS=Drosophila yakuba GN=Dyak\GE21111 PE=3 SV=1
  667 : B5XGF5_SALSA        0.35  0.55   29  175   31  163  147    6   14  260  B5XGF5     Chymotrypsin-like protease CTRL-1 OS=Salmo salar GN=CTRL PE=2 SV=1
  668 : B6VRV4_PYGNA        0.35  0.59  177  278  129  221  102    3    9  222  B6VRV4     Trypsin (Fragment) OS=Pygocentrus nattereri GN=tryp PE=2 SV=1
  669 : B7P8G5_IXOSC        0.35  0.55   29  175   11  152  150    6   11  252  B7P8G5     Serine protease, putative OS=Ixodes scapularis GN=IscW_ISCW002979 PE=3 SV=1
  670 : B7Q228_IXOSC        0.35  0.58  179  272   95  188   99    4   10  193  B7Q228     Serine protease, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW010211 PE=3 SV=1
  671 : B7QNU3_IXOSC        0.35  0.50   29  170   36  167  146    7   18  280  B7QNU3     Serin proteinase, putative OS=Ixodes scapularis GN=IscW_ISCW015172 PE=3 SV=1
  672 : B8Q222_MACFA        0.35  0.56  177  278  163  266  111    5   16  268  B8Q222     Alphabeta tryptase (Fragment) OS=Macaca fascicularis PE=2 SV=1
  673 : C3ZLV0_BRAFL        0.35  0.56   29  174  117  262  152    7   12  369  C3ZLV0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_109713 PE=3 SV=1
  674 : C3ZMV5_BRAFL        0.35  0.49   29  170   13  139  142    5   15  247  C3ZMV5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_59253 PE=3 SV=1
  675 : C3ZNE9_BRAFL        0.35  0.56   29  175   19  149  153    9   28  260  C3ZNE9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_59090 PE=3 SV=1
  676 : D1MYR2_ANGJA        0.35  0.53   29  171   21  145  144    7   20  244  D1MYR2     Trypsinogen OS=Anguilla japonica GN=try PE=2 SV=1
  677 : D2HHF4_AILME        0.35  0.50   29  175   16  155  151    6   15  284  D2HHF4     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_010535 PE=3 SV=1
  678 : D3ZXU4_RAT          0.35  0.57   29  175   84  215  149    8   19  340  D3ZXU4     Protein Prss42 OS=Rattus norvegicus GN=Prss42 PE=3 SV=1
  679 : E0W195_PEDHC        0.35  0.56  178  278  129  229  108    7   14  229  E0W195     Tripsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM571630 PE=3 SV=1
  680 : E9GEA9_DAPPU        0.35  0.54   29  175   11  153  152    7   14  282  E9GEA9     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_316896 PE=3 SV=1
  681 : E9GYA2_DAPPU        0.35  0.53  177  274  122  215  102    5   12  220  E9GYA2     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_55871 PE=3 SV=1
  682 : F1C762_PERFV        0.35  0.58  182  278  127  227  106    4   14  228  F1C762     Ca2+-dependent complex c1r/c1S subunit (Fragment) OS=Perca flavescens GN=c1r/c1s PE=2 SV=1
  683 : F1N7F5_BOVIN        0.35  0.52   29  174   38  171  149    7   18  313  F1N7F5     Uncharacterized protein OS=Bos taurus GN=PRSS27 PE=3 SV=2
  684 : F6RW38_XENTR        0.35  0.51   29  170   41  169  144    7   17  281  F6RW38     Uncharacterized protein OS=Xenopus tropicalis GN=LOC100491461 PE=3 SV=1
  685 : F6V5L0_CALJA        0.35  0.55  179  277   45  135  100    3   10  137  F6V5L0     Uncharacterized protein OS=Callithrix jacchus GN=KLK6 PE=3 SV=1
  686 : F7AWW6_MACMU        0.35  0.55  177  277   55  159  110    6   14  205  F7AWW6     Uncharacterized protein OS=Macaca mulatta GN=PRSS27 PE=3 SV=1
  687 : F7D3P7_MONDO        0.35  0.56   29  175   57  191  148    8   14  297  F7D3P7     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=PRSS33 PE=3 SV=1
  688 : F7D3R0_MONDO        0.35  0.56   29  175   43  177  148    8   14  290  F7D3R0     Uncharacterized protein OS=Monodelphis domestica GN=PRSS33 PE=3 SV=1
  689 : F7HPJ9_MACMU        0.35  0.51  182  278  145  242  104    5   13  262  F7HPJ9     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=3 SV=1
  690 : F8S121_CROAD        0.35  0.52  179  277    9  100  101    4   11  109  F8S121     Serine proteinase 9 (Fragment) OS=Crotalus adamanteus PE=2 SV=1
  691 : F8U086_EPIBR        0.35  0.58  177  277   15  106  101    2    9  108  F8U086     Trypsinogen 1a (Fragment) OS=Epinephelus bruneus PE=2 SV=1
  692 : G1MGT5_AILME        0.35  0.52   29  174   43  174  147    6   16  273  G1MGT5     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=CTRL PE=3 SV=1
  693 : G1S291_NOMLE        0.35  0.55   29  175   45  179  148    6   14  343  G1S291     Uncharacterized protein OS=Nomascus leucogenys GN=PRSS8 PE=3 SV=1
  694 : G1T2P7_RABIT        0.35  0.51   29  175   81  220  152    6   17  336  G1T2P7     Uncharacterized protein OS=Oryctolagus cuniculus GN=TMPRSS12 PE=3 SV=1
  695 : G1TRA2_RABIT        0.35  0.53   29  175    9  140  152    7   25  240  G1TRA2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=3 SV=1
  696 : G1TW58_RABIT        0.35  0.55  179  278   97  188  101    4   10  201  G1TW58     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=KLK13 PE=3 SV=1
  697 : G1TWY1_RABIT        0.35  0.53   29  174   49  179  147    7   17  318  G1TWY1     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100350250 PE=3 SV=1
  698 : G1U2Q8_RABIT        0.35  0.51   29  175   28  164  150    5   16  266  G1U2Q8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100339830 PE=3 SV=1
  699 : G3HKW8_CRIGR        0.35  0.51   29  174   43  174  146    6   14  273  G3HKW8     Chymotrypsin-like protease CTRL-1 OS=Cricetulus griseus GN=I79_011349 PE=3 SV=1
  700 : G3NGH9_GASAC        0.35  0.53   29  172   22  147  144    5   18  247  G3NGH9     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  701 : G3NY22_GASAC        0.35  0.61   29  175   34  169  148    5   13  315  G3NY22     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  702 : G3RLJ1_GORGO        0.35  0.53  178  278   13  115  105    3    6  117  G3RLJ1     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101142734 PE=3 SV=1
  703 : G3S2R2_GORGO        0.35  0.53  195  278    2   89   93    5   14  128  G3S2R2     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101132282 PE=3 SV=1
  704 : G3VEP3_SARHA        0.35  0.56   29  175   16  156  151    6   14  287  G3VEP3     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=TMPRSS12 PE=3 SV=1
  705 : G3VIV9_SARHA        0.35  0.50   29  175   28  162  149    7   16  321  G3VIV9     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=PRSS48 PE=3 SV=1
  706 : G3VNE5_SARHA        0.35  0.47   29  173   40  171  150    9   23  283  G3VNE5     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=LOC100919921 PE=3 SV=1
  707 : G5EMQ9_PAGMA        0.35  0.54   29  175   34  166  148    7   16  263  G5EMQ9     Chymotrypsinogen 1 OS=Pagrus major PE=2 SV=1
  708 : G7NQY6_MACMU        0.35  0.55   29  175   45  179  148    6   14  343  G7NQY6     Prostasin OS=Macaca mulatta GN=EGK_12715 PE=3 SV=1
  709 : G7NR23_MACMU        0.35  0.53  179  277   84  174  100    6   10  176  G7NR23     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_13004 PE=3 SV=1
  710 : G7NXX0_MACFA        0.35  0.51  182  278  145  242  104    5   13  262  G7NXX0     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_10700 PE=3 SV=1
  711 : G9F9L2_9NEOP        0.35  0.62  179  277    9  109  104    2    8  110  G9F9L2     Seminal fluid protein CSSFP062 (Fragment) OS=Chilo suppressalis PE=2 SV=1
  712 : G9KIV5_MUSPF        0.35  0.56   29  175   39  173  149    9   16  330  G9KIV5     Protease, serine, 8 (Fragment) OS=Mustela putorius furo PE=2 SV=1
  713 : H0FSX6_RHIML        0.35  0.54  182  278   66  157   98    4    7  160  H0FSX6     Trypsin OS=Sinorhizobium meliloti CCNWSX0020 GN=SM0020_01205 PE=3 SV=1
  714 : H0UTK4_CAVPO        0.35  0.52   29  175   39  169  150    9   22  311  H0UTK4     Uncharacterized protein OS=Cavia porcellus GN=PRSS48 PE=3 SV=1
  715 : H0VZE1_CAVPO        0.35  0.53  177  277  133  220  102    5   15  223  H0VZE1     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=KLK4 PE=3 SV=1
  716 : H0W6S3_CAVPO        0.35  0.56  177  278  152  257  111    5   14  267  H0W6S3     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=PRSS27 PE=3 SV=1
  717 : H0XG48_OTOGA        0.35  0.56   29  175   38  169  149    7   19  294  H0XG48     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=PRSS42 PE=3 SV=1
  718 : H2L3J3_ORYLA        0.35  0.56   29  175   17  153  150    7   16  295  H2L3J3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=TMPRSS9 (4 of 16) PE=3 SV=1
  719 : H2L6L5_ORYLA        0.35  0.53   29  175   37  170  147    6   13  275  H2L6L5     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
  720 : H2L6M6_ORYLA        0.35  0.54   29  175   25  157  149    8   18  299  H2L6M6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101157454 PE=3 SV=1
  721 : H2L6Z3_ORYLA        0.35  0.53   29  175   26  158  148    5   16  258  H2L6Z3     Uncharacterized protein OS=Oryzias latipes GN=LOC101159194 PE=3 SV=1
  722 : H2M4K0_ORYLA        0.35  0.50   29  172   34  168  150    6   21  274  H2M4K0     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101165737 PE=3 SV=1
  723 : H2M4K2_ORYLA        0.35  0.50   29  172   29  163  150    6   21  269  H2M4K2     Uncharacterized protein OS=Oryzias latipes GN=LOC101165737 PE=3 SV=1
  724 : H2NS16_PONAB        0.35  0.54   29  152   17  128  124    4   12  192  H2NS16     Uncharacterized protein (Fragment) OS=Pongo abelii GN=LOC100447221 PE=3 SV=1
  725 : H2NZU0_PONAB        0.35  0.53  178  277  113  204  101    4   10  207  H2NZU0     Uncharacterized protein OS=Pongo abelii GN=KLK2 PE=3 SV=1
  726 : H2Q5X2_PANTR        0.35  0.53   29  175   78  217  152    6   17  348  H2Q5X2     Uncharacterized protein OS=Pan troglodytes GN=TMPRSS12 PE=3 SV=1
  727 : H2R1U6_PANTR        0.35  0.54  178  277  107  199  102    7   11  201  H2R1U6     Uncharacterized protein OS=Pan troglodytes GN=CTRB1 PE=3 SV=1
  728 : H2RL89_TAKRU        0.35  0.58   29  175   36  169  147    5   13  314  H2RL89     Uncharacterized protein OS=Takifugu rubripes GN=LOC101076928 PE=3 SV=1
  729 : H2RL90_TAKRU        0.35  0.58   29  175   33  166  147    5   13  301  H2RL90     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101076928 PE=3 SV=1
  730 : H2T7F3_TAKRU        0.35  0.52   29  171   37  167  144    6   14  265  H2T7F3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
  731 : H2UK68_TAKRU        0.35  0.45   29  172   32  166  147    6   15  272  H2UK68     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074248 PE=3 SV=1
  732 : H2XVR8_CIOIN        0.35  0.56  182  276   20  114  100    5   10  114  H2XVR8     Uncharacterized protein OS=Ciona intestinalis GN=sp7 PE=3 SV=1
  733 : H3D0U7_TETNG        0.35  0.59   29  174   14  149  148    5   14  256  H3D0U7     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  734 : H3D346_TETNG        0.35  0.47   29  172   32  163  148    7   20  269  H3D346     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  735 : I3JIS4_ORENI        0.35  0.54   29  175   33  170  155    6   25  322  I3JIS4     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=TMPRSS9 (5 of 18) PE=3 SV=1
  736 : I3JSI0_ORENI        0.35  0.52   29  175   36  169  149    7   17  319  I3JSI0     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100700895 PE=3 SV=1
  737 : I3L0U2_HUMAN        0.35  0.53   29  152   35  153  124    3    5  218  I3L0U2     Testisin (Fragment) OS=Homo sapiens GN=PRSS21 PE=3 SV=1
  738 : I3L116_HUMAN        0.35  0.58  177  277   80  180  106    3   10  207  I3L116     Brain-specific serine protease 4 OS=Homo sapiens GN=PRSS22 PE=2 SV=1
  739 : I3LFP1_PIG          0.35  0.52   29  175   34  165  147    5   15  264  I3LFP1     Uncharacterized protein OS=Sus scrofa PE=3 SV=1
  740 : I3M1T8_SPETR        0.35  0.55  177  278  170  273  111    6   16  275  I3M1T8     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
  741 : J3QKZ2_HUMAN        0.35  0.54   29  152   58  169  124    4   12  182  J3QKZ2     Chymotrypsin B chain A (Fragment) OS=Homo sapiens GN=CTRB1 PE=3 SV=1
  742 : J9HTS3_AEDAE        0.35  0.51  177  275  101  192  102    5   13  195  J9HTS3     AAEL017520-PA OS=Aedes aegypti GN=AaeL_AAEL017520 PE=3 SV=1
  743 : K7E407_MONDO        0.35  0.51   29  175   49  184  149    8   15  324  K7E407     Uncharacterized protein OS=Monodelphis domestica GN=LOC100018359 PE=3 SV=1
  744 : K7GF87_PELSI        0.35  0.55   29  166   18  151  141    5   10  258  K7GF87     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis GN=TMPRSS12 PE=3 SV=1
  745 : K7J091_NASVI        0.35  0.60  177  277  139  233  104    4   12  233  K7J091     Uncharacterized protein OS=Nasonia vitripennis GN=LOC100114811 PE=3 SV=1
  746 : L5KJQ1_PTEAL        0.35  0.53   29  174   10  143  149    7   18  298  L5KJQ1     Serine protease 27 (Fragment) OS=Pteropus alecto GN=PAL_GLEAN10011669 PE=3 SV=1
  747 : L5LSQ4_MYODS        0.35  0.56  182  277   64  159  103    4   14  164  L5LSQ4     Mastin OS=Myotis davidii GN=MDA_GLEAN10000414 PE=3 SV=1
  748 : L5LVM0_MYODS        0.35  0.50  179  278   16  107  101    3   10  108  L5LVM0     Kallikrein-15 OS=Myotis davidii GN=MDA_GLEAN10005272 PE=3 SV=1
  749 : L5MG16_MYODS        0.35  0.55  178  278   25  127  110    5   16  129  L5MG16     Tryptase beta-2 OS=Myotis davidii GN=MDA_GLEAN10001095 PE=3 SV=1
  750 : L8J5J6_9CETA        0.35  0.54  177  278   92  195  111    6   16  197  L8J5J6     Tryptase-2 (Fragment) OS=Bos mutus GN=M91_08769 PE=3 SV=1
  751 : M0R151_HUMAN        0.35  0.52  179  278   17  108  101    3   10  109  M0R151     Kallikrein-11 OS=Homo sapiens GN=KLK11 PE=2 SV=1
  752 : M3W140_FELCA        0.35  0.52   29  175   38  172  150    7   18  326  M3W140     Uncharacterized protein OS=Felis catus GN=PRSS27 PE=3 SV=1
  753 : M3WHR1_FELCA        0.35  0.53   29  174   39  170  146    6   14  269  M3WHR1     Uncharacterized protein (Fragment) OS=Felis catus GN=CTRL PE=3 SV=1
  754 : M3Y1T7_MUSPF        0.35  0.49   29  175   92  232  153    6   18  363  M3Y1T7     Uncharacterized protein OS=Mustela putorius furo GN=TMPRSS12 PE=3 SV=1
  755 : M4ACH7_XIPMA        0.35  0.59   29  175   34  166  150    6   20  319  M4ACH7     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
  756 : M5FK93_BOVIN        0.35  0.52   29  174   38  171  149    7   18  313  M5FK93     Marapsin-like OS=Bos taurus GN=PRSS27 PE=3 SV=1
  757 : M7ALB7_CHEMY        0.35  0.56   30  175   60  193  149    9   18  343  M7ALB7     Serine protease 27 OS=Chelonia mydas GN=UY3_17694 PE=3 SV=1
  758 : PRS42_MOUSE         0.35  0.55   29  175   79  210  152    8   25  335  Q8VIF2     Serine protease 42 OS=Mus musculus GN=Prss42 PE=2 SV=1
  759 : Q0GYP6_SPAAU        0.35  0.54   29  175   32  164  149    8   18  261  Q0GYP6     Chymotrypsinogen I OS=Sparus aurata GN=CHTRI PE=2 SV=1
  760 : Q16RR3_AEDAE        0.35  0.48   29  175   63  199  153    6   22  306  Q16RR3     AAEL010867-PA OS=Aedes aegypti GN=AAEL010867 PE=3 SV=1
  761 : Q29464_BOVIN        0.35  0.53  177  278  132  235  111    6   16  237  Q29464     Tryptase (Fragment) OS=Bos taurus PE=2 SV=1
  762 : Q2KKT3_SINCH        0.35  0.55  185  277    2   85   93    2    9   87  Q2KKT3     Trypsinogen (Fragment) OS=Siniperca chuatsi PE=2 SV=1
  763 : Q2VPP0_XENLA        0.35  0.54   29  175   44  178  148    5   14  363  Q2VPP0     MGC68910 protein OS=Xenopus laevis GN=MGC68910 PE=2 SV=1
  764 : Q4QY77_SPAAU        0.35  0.54   29  175   32  164  149    8   18  261  Q4QY77     Chymotrypsinogen 1-like protein OS=Sparus aurata PE=2 SV=1
  765 : Q4S848_TETNG        0.35  0.47   29  172   28  159  148    7   20  265  Q4S848     Chromosome 9 SCAF14710, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00022511001 PE=3 SV=1
  766 : Q66HW9_DANRE        0.35  0.55   29  175   32  164  147    6   14  261  Q66HW9     Chymotrypsin-like OS=Danio rerio GN=ctrl PE=2 SV=1
  767 : Q6P6W8_RAT          0.35  0.55  177  278  168  271  111    6   16  273  Q6P6W8     Tryptase alpha/beta 1 OS=Rattus norvegicus GN=Tpsab1 PE=2 SV=1
  768 : Q7PWE5_ANOGA        0.35  0.55  179  275  149  246  102    4    9  250  Q7PWE5     AGAP008994-PA OS=Anopheles gambiae GN=AGAP008994 PE=3 SV=4
  769 : Q7T0X2_XENLA        0.35  0.54   29  175    6  140  148    5   14  320  Q7T0X2     MGC68910 protein OS=Xenopus laevis PE=2 SV=1
  770 : Q8CH29_MOUSE        0.35  0.58  182  278  113  209  104    7   14  211  Q8CH29     Complement component C1RB (Fragment) OS=Mus musculus GN=C1rb PE=3 SV=1
  771 : Q96JE1_HUMAN        0.35  0.59  179  277  112  202  101    5   12  204  Q96JE1     ARM1 OS=Homo sapiens PE=2 SV=1
  772 : Q9CQ78_MOUSE        0.35  0.57  185  276    1   84   93    3   10   87  Q9CQ78     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=Klk11 PE=2 SV=1
  773 : Q9W7Q4_PAROL        0.35  0.54   29  175   32  164  147    5   14  261  Q9W7Q4     Chymotrypsinogen 1 OS=Paralichthys olivaceus PE=2 SV=1
  774 : Q9W7Q5_PAROL        0.35  0.50   29  172   22  147  144    5   18  247  Q9W7Q5     Trypsinogen 3 OS=Paralichthys olivaceus PE=2 SV=2
  775 : R0JV69_ANAPL        0.35  0.54   29  171    2  134  143    4   10  238  R0JV69     Enteropeptidase (Fragment) OS=Anas platyrhynchos GN=Anapl_14159 PE=3 SV=1
  776 : R7URY6_CAPTE        0.35  0.51   29  170   32  160  143    7   15  264  R7URY6     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_18116 PE=3 SV=1
  777 : S4RN25_PETMA        0.35  0.56   29  175    1  137  147    4   10  235  S4RN25     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  778 : S7Q5F3_MYOBR        0.35  0.58  179  276   56  144  100    6   13  148  S7Q5F3     Kallikrein-5 OS=Myotis brandtii GN=D623_10017710 PE=3 SV=1
  779 : S9YNE6_9CETA        0.35  0.51  177  277   48  147  107    4   13  152  S9YNE6     Uncharacterized protein OS=Camelus ferus GN=CB1_000144003 PE=3 SV=1
  780 : SP4_MEGPE           0.35  0.51   29  173    1  143  153    7   18  243  Q7M4I3     Venom protease OS=Megabombus pennsylvanicus PE=1 SV=1
  781 : T1IJ44_STRMM        0.35  0.53   29  174   44  179  148    7   14  286  T1IJ44     Uncharacterized protein OS=Strigamia maritima PE=3 SV=1
  782 : T1JDK5_STRMM        0.35  0.58  182  273   37  124   93    3    6  135  T1JDK5     Uncharacterized protein OS=Strigamia maritima PE=3 SV=1
  783 : T1L3H4_TETUR        0.35  0.50   29  172   45  175  149    7   23  282  T1L3H4     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
  784 : TMPSC_HUMAN         0.35  0.53   29  175   78  217  152    6   17  348  Q86WS5     Transmembrane protease serine 12 OS=Homo sapiens GN=TMPRSS12 PE=1 SV=2
  785 : TRYB1_RAT           0.35  0.55  177  278  168  271  111    6   16  273  P27435     Tryptase OS=Rattus norvegicus GN=Tpsab1 PE=1 SV=2
  786 : TRYT_MERUN          0.35  0.54  177  278  165  268  111    6   16  270  P50342     Mast cell tryptase OS=Meriones unguiculatus PE=2 SV=1
  787 : U3IX11_ANAPL        0.35  0.52   29  174   18  153  147    5   12  260  U3IX11     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=PROC PE=3 SV=1
  788 : U6D1X7_NEOVI        0.35  0.56   29  175   11  145  148    7   14  303  U6D1X7     Prostasin (Fragment) OS=Neovison vison GN=PRSS8 PE=2 SV=1
  789 : U6D659_NEOVI        0.35  0.56  177  278  152  255  111    6   16  257  U6D659     Tryptase beta-2 (Fragment) OS=Neovison vison GN=TRYB2 PE=2 SV=1
  790 : U6DGS2_NEOVI        0.35  0.57  182  277    9  102   96    2    2  103  U6DGS2     Neurotrypsin (Fragment) OS=Neovison vison GN=NETR PE=2 SV=1
  791 : U6DUR5_NEOVI        0.35  0.55  182  278   88  181   99    5    7  188  U6DUR5     Transmembrane protease, serine 13 (Fragment) OS=Neovison vison GN=E9PRA0 PE=2 SV=1
  792 : V8NSI6_OPHHA        0.35  0.51   29  172   21  154  147    8   16  292  V8NSI6     Serine protease 27 (Fragment) OS=Ophiophagus hannah GN=PRSS27 PE=3 SV=1
  793 : V9LKD5_CALMI        0.35  0.54  179  278   25  115  100    2    9  116  V9LKD5     Trypsin-1-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
  794 : W4XL44_STRPU        0.35  0.56  177  278   93  192  104    3    6  197  W4XL44     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Tmprss3 PE=3 SV=1
  795 : W4XQG9_STRPU        0.35  0.55  179  276   97  192  100    4    6  198  W4XQG9     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
  796 : W4ZBP3_STRPU        0.35  0.50  177  278  126  231  109    8   10  235  W4ZBP3     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Srap PE=3 SV=1
  797 : W5JUZ5_ANODA        0.35  0.55  179  275  149  246  102    4    9  250  W5JUZ5     Serine protease OS=Anopheles darlingi GN=AND_001611 PE=3 SV=1
  798 : W5MNA4_LEPOC        0.35  0.56   29  150   34  143  122    3   12  185  W5MNA4     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
  799 : W5PB65_SHEEP        0.35  0.52   29  174    9  137  147    5   19  270  W5PB65     Uncharacterized protein (Fragment) OS=Ovis aries GN=LOC101102519 PE=3 SV=1
  800 : W5Q7U9_SHEEP        0.35  0.54   29  175   72  211  151    6   15  342  W5Q7U9     Uncharacterized protein OS=Ovis aries GN=TMPRSS12 PE=3 SV=1
  801 : W6MEP3_PAGBR        0.35  0.56  182  274   13  103   96    4    8  131  W6MEP3     Prophenoloxidase-activating-factor3 protein (Fragment) OS=Pagurus bernhardus PE=3 SV=1
  802 : A2VD99_XENLA        0.34  0.53   29  175   41  175  149    8   16  325  A2VD99     LOC100037197 protein OS=Xenopus laevis GN=LOC100037197 PE=2 SV=1
  803 : A5D6S2_DANRE        0.34  0.47   29  173  162  301  158   10   31  423  A5D6S2     Si:dkey-33i11.3 protein OS=Danio rerio GN=si:dkey-33i11.3 PE=2 SV=1
  804 : A5HBA4_MACMU        0.34  0.54  177  278   92  195  111    5   16  197  A5HBA4     Tryptase (Fragment) OS=Macaca mulatta PE=3 SV=1
  805 : A5HC64_RABIT        0.34  0.51   29  175  113  254  156    9   23  274  A5HC64     ST14 (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
  806 : A7DZ20_DROSI        0.34  0.51  179  278   50  138  101    5   13  143  A7DZ20     Serine protease (Fragment) OS=Drosophila simulans GN=CG17239 PE=3 SV=1
  807 : A7DZ21_DROSI        0.34  0.52  179  278   50  138  101    5   13  143  A7DZ21     Serine protease (Fragment) OS=Drosophila simulans GN=CG17239 PE=3 SV=1
  808 : A7RKX8_NEMVE        0.34  0.52   29  175    2  141  151    7   15  240  A7RKX8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85345 PE=3 SV=1
  809 : A7S8P7_NEMVE        0.34  0.55   29  170    1  134  144    7   12  240  A7S8P7     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g108942 PE=3 SV=1
  810 : A7SQF0_NEMVE        0.34  0.49   29  175    5  148  152    7   13  251  A7SQF0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127472 PE=3 SV=1
  811 : A7T2X9_NEMVE        0.34  0.49   54  175    1  117  125    5   11  182  A7T2X9     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g3218 PE=3 SV=1
  812 : A7T365_NEMVE        0.34  0.60  185  278    1   92   97    4    8   96  A7T365     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g143967 PE=3 SV=1
  813 : A7YWU4_BOVIN        0.34  0.49   29  175   29  166  151    6   17  269  A7YWU4     Chymotrypsin-like elastase family member 2A OS=Bos taurus GN=ELA2A PE=2 SV=1
  814 : A8DZG9_DANRE        0.34  0.47   29  173  164  303  158   10   31  425  A8DZG9     Novel protein similar to H.sapiens HPN, hepsin (Transmembrane protease, serine 1) (HPN) OS=Danio rerio GN=si:dkey-33i11.3 PE=3 SV=2
  815 : A8WGH3_XENTR        0.34  0.48   29  174   38  175  151    7   18  321  A8WGH3     LOC100127698 protein OS=Xenopus tropicalis GN=tmprss12 PE=2 SV=1
  816 : B0WD43_CULQU        0.34  0.50   29  174   32  166  149    6   17  277  B0WD43     Serine-type enodpeptidase OS=Culex quinquefasciatus GN=CpipJ_CPIJ004986 PE=3 SV=1
  817 : B0X8Z7_CULQU        0.34  0.54   29  172   76  208  145    5   13  256  B0X8Z7     Transmembrane protease OS=Culex quinquefasciatus GN=CpipJ_CPIJ016102 PE=3 SV=1
  818 : B3GC76_GRYPE        0.34  0.53  177  278  117  213  104    4    9  222  B3GC76     Accessory gland protein (Fragment) OS=Gryllus pennsylvanicus GN=AG-0308F PE=2 SV=1
  819 : B3GC92_GRYFI        0.34  0.53  177  278  117  213  104    4    9  222  B3GC92     Accessory gland protein (Fragment) OS=Gryllus firmus GN=AG-0308F PE=2 SV=1
  820 : B3GCA2_GRYFI        0.34  0.53  177  278   88  184  104    4    9  193  B3GCA2     Accessory gland protein (Fragment) OS=Gryllus firmus GN=AG-0308F PE=2 SV=1
  821 : B3KP25_HUMAN        0.34  0.55  177  278  137  242  111    6   14  254  B3KP25     cDNA FLJ31014 fis, clone HLUNG2000255, highly similar to Protease serine 27 (EC 3.4.21.-) OS=Homo sapiens PE=2 SV=1
  822 : B3RYJ8_TRIAD        0.34  0.55  177  274  131  230  105    8   12  230  B3RYJ8     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_5625 PE=3 SV=1
  823 : B4IKC7_DROSE        0.34  0.52   29  170   38  165  152    9   34  276  B4IKC7     GM22528 OS=Drosophila sechellia GN=Dsec\GM22528 PE=3 SV=1
  824 : B4KXH8_DROMO        0.34  0.53  179  276  121  213  102    7   13  218  B4KXH8     GI11954 OS=Drosophila mojavensis GN=Dmoj\GI11954 PE=3 SV=1
  825 : B4M5P8_DROVI        0.34  0.49   29  171   71  205  152   11   26  317  B4M5P8     GJ10535 OS=Drosophila virilis GN=Dvir\GJ10535 PE=3 SV=1
  826 : B4R5H6_DROSI        0.34  0.52   29  170   38  165  152    9   34  276  B4R5H6     GD15779 OS=Drosophila simulans GN=Dsim\GD15779 PE=3 SV=1
  827 : B7Q921_IXOSC        0.34  0.55   29  172   20  166  150    7    9  228  B7Q921     Proclotting enzyme, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW010999 PE=3 SV=1
  828 : B8BWE1_THAPS        0.34  0.54  177  276   14  108  100    1    5  108  B8BWE1     Predicted protein (Fragment) OS=Thalassiosira pseudonana GN=THAPSDRAFT_32596 PE=3 SV=1
  829 : C1JZF7_XIPHE        0.34  0.45   29  172   28  160  147    7   17  266  C1JZF7     Elastase 4 OS=Xiphophorus helleri PE=2 SV=1
  830 : C3KIL5_ANOFI        0.34  0.55   29  171   32  160  143    5   14  261  C3KIL5     Chymotrypsin-like protease CTRL-1 OS=Anoplopoma fimbria GN=CTRL PE=2 SV=1
  831 : C3YCI0_BRAFL        0.34  0.49   29  175   22  159  148    4   11  261  C3YCI0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_100914 PE=3 SV=1
  832 : C3ZPL4_BRAFL        0.34  0.53   29  171   22  145  143    6   19  242  C3ZPL4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_88359 PE=3 SV=1
  833 : C3ZRZ2_BRAFL        0.34  0.52   29  172   32  160  145    6   17  271  C3ZRZ2     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_287428 PE=3 SV=1
  834 : C3ZVK3_BRAFL        0.34  0.52  182  278  141  244  109    5   17  245  C3ZVK3     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_61430 PE=3 SV=1
  835 : CEL2A_BOVIN         0.34  0.49   29  175   29  166  151    6   17  269  Q29461     Chymotrypsin-like elastase family member 2A OS=Bos taurus GN=CELA2A PE=2 SV=1
  836 : CEL2A_HUMAN         0.34  0.51   29  175   29  166  151    6   17  269  P08217     Chymotrypsin-like elastase family member 2A OS=Homo sapiens GN=CELA2A PE=1 SV=1
  837 : CTR2_CANFA          0.34  0.51   29  175   34  165  148    6   17  263  P04813     Chymotrypsinogen 2 OS=Canis familiaris GN=CTRB1 PE=2 SV=1
  838 : CTRB1_HUMAN         0.34  0.53   29  173   34  163  146    6   17  263  P17538     Chymotrypsinogen B OS=Homo sapiens GN=CTRB1 PE=2 SV=1
  839 : CTRB1_MOUSE         0.34  0.53   29  173   34  163  148    9   21  263  Q9CR35     Chymotrypsinogen B OS=Mus musculus GN=Ctrb1 PE=2 SV=1
  840 : CTRB2_HUMAN         0.34  0.53   29  173   34  163  146    6   17  263  Q6GPI1     Chymotrypsinogen B2 OS=Homo sapiens GN=CTRB2 PE=2 SV=2
  841 : CTRL_HUMAN          0.34  0.52   29  174   34  165  146    6   14  264  P40313     Chymotrypsin-like protease CTRL-1 OS=Homo sapiens GN=CTRL PE=2 SV=1
  842 : D0V542_CTEFE        0.34  0.57  177  267    3   89   96    4   14  102  D0V542     Trypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
  843 : D2H9G3_AILME        0.34  0.52   29  172   17  146  145    6   16  247  D2H9G3     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_006957 PE=3 SV=1
  844 : D2HQM3_AILME        0.34  0.55   29  175   45  179  149    9   16  337  D2HQM3     Putative uncharacterized protein OS=Ailuropoda melanoleuca GN=PANDA_014204 PE=3 SV=1
  845 : D2HV80_AILME        0.34  0.52   29  175   10  144  148    7   14  264  D2HV80     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_016253 PE=3 SV=1
  846 : D3YVP0_MOUSE        0.34  0.55   29  174   74  208  146    6   11  272  D3YVP0     Serine protease 30 (Fragment) OS=Mus musculus GN=Prss30 PE=2 SV=2
  847 : D6PVS6_EPICO        0.34  0.53   29  175   31  163  148    7   16  260  D6PVS6     Chymotrypsinogen OS=Epinephelus coioides PE=2 SV=1
  848 : E0CXD8_MOUSE        0.34  0.56  178  278   64  160  105    6   12  172  E0CXD8     Tryptase gamma (Fragment) OS=Mus musculus GN=Tpsg1 PE=3 SV=1
  849 : E1BQL7_CHICK        0.34  0.46   29  175   30  167  151    7   17  270  E1BQL7     Uncharacterized protein OS=Gallus gallus GN=CELA2A PE=3 SV=1
  850 : E4WVM9_OIKDI        0.34  0.50  177  277   43  147  107    4    8  151  E4WVM9     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_3 OS=Oikopleura dioica GN=GSOID_T00008937001 PE=3 SV=1
  851 : E4XBK2_OIKDI        0.34  0.53  179  278   14  107  102    3   10  108  E4XBK2     Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_230 OS=Oikopleura dioica GN=GSOID_T00006504001 PE=3 SV=1
  852 : E4XP66_OIKDI        0.34  0.52  182  278   59  161  105    6   10  162  E4XP66     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_75 OS=Oikopleura dioica GN=GSOID_T00016828001 PE=3 SV=1
  853 : E5SCH0_TRISP        0.34  0.49   29  175   43  191  159    9   22  304  E5SCH0     Coagulation factor IX OS=Trichinella spiralis GN=Tsp_01441 PE=3 SV=1
  854 : E7F9I4_DANRE        0.34  0.57   29  175   36  171  152    7   21  325  E7F9I4     Uncharacterized protein OS=Danio rerio GN=zgc:123217 PE=3 SV=1
  855 : E9GE64_DAPPU        0.34  0.51   29  170    3  136  145    5   14  275  E9GE64     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_49241 PE=3 SV=1
  856 : E9I5I1_DAPPU        0.34  0.54   29  175   73  211  150    8   14  317  E9I5I1     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_230054 PE=3 SV=1
  857 : E9Q5P0_MOUSE        0.34  0.48   29  173  191  328  154    9   25  445  E9Q5P0     Serine protease hepsin OS=Mus musculus GN=Hpn PE=2 SV=1
  858 : E9Q7E3_MOUSE        0.34  0.56  178  278   21  117  105    6   12  165  E9Q7E3     Tryptase gamma OS=Mus musculus GN=Tpsg1 PE=3 SV=1
  859 : F1C748_PERFV        0.34  0.52   29  172   17  146  145    6   16  271  F1C748     Serine protease 27 (Fragment) OS=Perca flavescens GN=Prss27 PE=2 SV=1
  860 : F1LQU8_RAT          0.34  0.55   29  174   31  165  148    7   15  304  F1LQU8     Serine protease 30 OS=Rattus norvegicus GN=Prss30 PE=3 SV=1
  861 : F1LS97_RAT          0.34  0.48   29  173  162  299  154    9   25  416  F1LS97     Serine protease hepsin (Fragment) OS=Rattus norvegicus GN=Hpn PE=3 SV=2
  862 : F1PA60_CANFA        0.34  0.52   29  174   39  170  146    6   14  269  F1PA60     Uncharacterized protein (Fragment) OS=Canis familiaris GN=CTRL PE=3 SV=1
  863 : F1PD94_CANFA        0.34  0.56   29  175   39  173  148    7   14  331  F1PD94     Uncharacterized protein OS=Canis familiaris GN=PRSS8 PE=3 SV=2
  864 : F1Q5I4_DANRE        0.34  0.46   29  172   28  160  147    7   17  266  F1Q5I4     Uncharacterized protein OS=Danio rerio GN=ela2 PE=3 SV=1
  865 : F1Q657_DANRE        0.34  0.47   29  172   29  161  148    7   19  288  F1Q657     Uncharacterized protein OS=Danio rerio GN=ela2l PE=3 SV=1
  866 : F1QXD8_DANRE        0.34  0.57   29  175   37  172  152    7   21  326  F1QXD8     Uncharacterized protein OS=Danio rerio GN=zgc:123217 PE=3 SV=1
  867 : F2XFT5_DISMA        0.34  0.50   29  172   20  145  145    6   20  245  F2XFT5     Trypsinogen H1_3a1 OS=Dissostichus mawsoni PE=3 SV=1
  868 : F2XFT7_DISMA        0.34  0.50   29  172   20  145  145    7   20  245  F2XFT7     Trypsinogen H1_3a2 OS=Dissostichus mawsoni PE=3 SV=1
  869 : F6TU72_XENTR        0.34  0.52   29  175   26  159  147    5   13  277  F6TU72     Uncharacterized protein OS=Xenopus tropicalis GN=xepsin PE=3 SV=1
  870 : F6U6G0_XENTR        0.34  0.50   29  173  163  300  154   10   25  416  F6U6G0     Uncharacterized protein OS=Xenopus tropicalis GN=hpn PE=3 SV=1
  871 : F6X1S9_MACMU        0.34  0.49   29  171   38  160  144    7   22  261  F6X1S9     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
  872 : F6X231_MACMU        0.34  0.53   29  175   78  217  152    6   17  348  F6X231     Transmembrane protease serine 12 OS=Macaca mulatta GN=TMPRSS12 PE=3 SV=1
  873 : F6YAC9_MACMU        0.34  0.52   29  175   21  154  149    7   17  253  F6YAC9     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=TMPRSS9 PE=3 SV=1
  874 : F6YJM9_HORSE        0.34  0.52   29  175   16  155  151    6   15  286  F6YJM9     Uncharacterized protein (Fragment) OS=Equus caballus GN=TMPRSS12 PE=3 SV=1
  875 : F7AJC1_MACMU        0.34  0.53   29  174   35  168  149    7   18  323  F7AJC1     Uncharacterized protein OS=Macaca mulatta GN=PRSS27 PE=3 SV=1
  876 : F7ATP6_XENTR        0.34  0.48   29  174   38  175  151    7   18  321  F7ATP6     Uncharacterized protein OS=Xenopus tropicalis GN=tmprss12 PE=3 SV=1
  877 : F7BIQ2_MONDO        0.34  0.54   29  171   23  145  145    8   24  246  F7BIQ2     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010951 PE=3 SV=1
  878 : F7BMJ0_MACMU        0.34  0.50   29  174    8  138  149    7   21  271  F7BMJ0     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=PRSS42 PE=3 SV=1
  879 : F7D0J2_MONDO        0.34  0.51   29  174   38  167  146    5   16  270  F7D0J2     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=CTRL PE=3 SV=1
  880 : F7D219_ORNAN        0.34  0.48   29  175   38  170  148    6   16  234  F7D219     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100086112 PE=3 SV=1
  881 : F7D227_ORNAN        0.34  0.48   29  175   35  167  148    6   16  226  F7D227     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100086112 PE=3 SV=1
  882 : F7DDZ5_MACMU        0.34  0.53   29  174   36  169  149    7   18  324  F7DDZ5     Uncharacterized protein OS=Macaca mulatta GN=PRSS27 PE=3 SV=1
  883 : F7DGC9_XENTR        0.34  0.52   29  173   10  140  147    7   18  285  F7DGC9     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC100495333 PE=3 SV=1
  884 : F7F525_MACMU        0.34  0.49   29  175   29  166  152    7   19  269  F7F525     Uncharacterized protein OS=Macaca mulatta GN=ELA2B PE=3 SV=1
  885 : F7FD70_MACMU        0.34  0.51   29  174   34  165  146    6   14  264  F7FD70     Uncharacterized protein OS=Macaca mulatta GN=CTRL PE=3 SV=1
  886 : F7FFE9_MONDO        0.34  0.52   29  175   39  179  151    6   14  305  F7FFE9     Uncharacterized protein OS=Monodelphis domestica GN=PRSS48 PE=3 SV=2
  887 : F7FT49_MACMU        0.34  0.53   29  175   42  182  154   10   20  314  F7FT49     Uncharacterized protein OS=Macaca mulatta GN=PRSS21 PE=3 SV=1
  888 : F7FY19_MONDO        0.34  0.58   29  175    9  144  149    9   15  246  F7FY19     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=3 SV=2
  889 : F7G885_ORNAN        0.34  0.53   29  175   39  173  150    8   18  278  F7G885     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100087741 PE=3 SV=1
  890 : F7GPM6_CALJA        0.34  0.53   29  174   35  168  149    7   18  323  F7GPM6     Uncharacterized protein OS=Callithrix jacchus GN=PRSS27 PE=3 SV=1
  891 : F7GPN7_CALJA        0.34  0.53   29  174   36  169  149    7   18  292  F7GPN7     Uncharacterized protein OS=Callithrix jacchus GN=PRSS27 PE=3 SV=1
  892 : F7GSL4_CALJA        0.34  0.53   29  175   32  165  148    6   15  309  F7GSL4     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=TMPRSS9 PE=3 SV=1
  893 : F7H509_CALJA        0.34  0.54   29  175   78  217  152    6   17  348  F7H509     Uncharacterized protein OS=Callithrix jacchus GN=TMPRSS12 PE=3 SV=1
  894 : F7H799_MACMU        0.34  0.51   29  173   34  163  146    6   17  263  F7H799     Uncharacterized protein OS=Macaca mulatta GN=CTRB1 PE=3 SV=1
  895 : F7H7A1_MACMU        0.34  0.51   29  173   34  163  146    6   17  262  F7H7A1     Uncharacterized protein OS=Macaca mulatta GN=CTRB2 PE=3 SV=1
  896 : F7HPJ9_MACMU        0.34  0.54   29  175    3  135  151    8   22  262  F7HPJ9     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=3 SV=1
  897 : F7I9F5_CALJA        0.34  0.52   29  173   34  163  145    5   15  263  F7I9F5     Uncharacterized protein OS=Callithrix jacchus GN=CTRB1 PE=3 SV=1
  898 : F8W3C3_DANRE        0.34  0.54   29  175   29  155  149    8   24  250  F8W3C3     Uncharacterized protein (Fragment) OS=Danio rerio GN=zgc:66382 PE=3 SV=1
  899 : F8W4J1_DANRE        0.34  0.52   29  175   36  162  149    7   24  257  F8W4J1     Uncharacterized protein (Fragment) OS=Danio rerio GN=si:ch73-103b2.3 PE=3 SV=2
  900 : F8WBX2_HUMAN        0.34  0.53   29  175   78  217  151    6   15  320  F8WBX2     Transmembrane protease serine 12 OS=Homo sapiens GN=TMPRSS12 PE=3 SV=1
  901 : G1MI31_AILME        0.34  0.52   29  175   38  172  150    7   18  326  G1MI31     Uncharacterized protein OS=Ailuropoda melanoleuca GN=PRSS27 PE=3 SV=1
  902 : G1N3C6_MELGA        0.34  0.48   29  175   36  173  151    6   17  276  G1N3C6     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100542763 PE=3 SV=2
  903 : G1NWY6_MYOLU        0.34  0.52  177  278   94  188  104    7   11  189  G1NWY6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
  904 : G1P378_MYOLU        0.34  0.57   29  175   51  185  148    6   14  289  G1P378     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=PRSS8 PE=3 SV=1
  905 : G1PKM1_MYOLU        0.34  0.51   29  174   37  170  149    7   18  325  G1PKM1     Uncharacterized protein OS=Myotis lucifugus GN=PRSS27 PE=3 SV=1
  906 : G1S7W7_NOMLE        0.34  0.54   29  175   74  213  151    6   15  344  G1S7W7     Uncharacterized protein OS=Nomascus leucogenys GN=TMPRSS12 PE=3 SV=1
  907 : G1SGG1_RABIT        0.34  0.50   29  173   33  166  148    6   17  271  G1SGG1     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100339081 PE=3 SV=1
  908 : G1SGH0_RABIT        0.34  0.51   29  171   24  146  145    8   24  246  G1SGH0     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339859 PE=3 SV=1
  909 : G1SH91_RABIT        0.34  0.55   29  175   21  155  148    7   14  315  G1SH91     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=PRSS8 PE=3 SV=1
  910 : G1TDD9_RABIT        0.34  0.50   29  172   32  160  145    6   17  266  G1TDD9     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100348913 PE=3 SV=1
  911 : G1U4L8_RABIT        0.34  0.53   29  174   40  173  147    7   14  276  G1U4L8     Uncharacterized protein OS=Oryctolagus cuniculus GN=PRSS27 PE=3 SV=2
  912 : G3I7D4_CRIGR        0.34  0.53   29  175   39  173  148    7   14  336  G3I7D4     Prostasin OS=Cricetulus griseus GN=I79_019421 PE=3 SV=1
  913 : G3IFA6_CRIGR        0.34  0.54   29  175   52  188  151    8   18  332  G3IFA6     Serine protease 27 OS=Cricetulus griseus GN=I79_022427 PE=3 SV=1
  914 : G3IH87_CRIGR        0.34  0.51   29  174   43  188  153    9   14  286  G3IH87     Acrosin OS=Cricetulus griseus GN=I79_023174 PE=3 SV=1
  915 : G3INC4_CRIGR        0.34  0.55  178  277   68  164  102    4    7  169  G3INC4     Transmembrane protease, serine 5 OS=Cricetulus griseus GN=I79_025439 PE=3 SV=1
  916 : G3LUK8_9PERC        0.34  0.48   29  175   25  151  149    7   24  247  G3LUK8     Trypsinogen OS=Channa argus PE=2 SV=1
  917 : G3M5Q3_STIJA        0.34  0.55   29  171   32  169  148    8   15  273  G3M5Q3     Trypsin-like serine protease OS=Stichopus japonicus PE=2 SV=1
  918 : G3MG39_9ACAR        0.34  0.54   29  170   45  175  145    9   17  306  G3MG39     Putative uncharacterized protein (Fragment) OS=Amblyomma maculatum PE=2 SV=1
  919 : G3NFB3_GASAC        0.34  0.53   29  175   36  176  149    8   10  327  G3NFB3     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  920 : G3NTU9_GASAC        0.34  0.48   29  172   29  162  147    7   16  267  G3NTU9     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  921 : G3NTW7_GASAC        0.34  0.48   29  172   29  162  147    7   16  268  G3NTW7     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  922 : G3NTX5_GASAC        0.34  0.48   29  172   29  162  147    7   16  270  G3NTX5     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  923 : G3NU92_GASAC        0.34  0.51   29  172   13  153  147    5    9  263  G3NU92     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  924 : G3NYA9_GASAC        0.34  0.55   29  175   23  157  147    4   12  261  G3NYA9     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  925 : G3QAX5_GASAC        0.34  0.51   29  175  299  445  161   14   28  547  G3QAX5     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  926 : G3QXF3_GORGO        0.34  0.53   29  175   42  182  154   10   20  314  G3QXF3     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101149961 PE=3 SV=1
  927 : G3R512_GORGO        0.34  0.52   29  173   34  163  146    6   17  263  G3R512     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101134917 PE=3 SV=1
  928 : G3RCP6_GORGO        0.34  0.56   29  175   45  179  148    6   14  343  G3RCP6     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101152509 PE=3 SV=1
  929 : G3RDE7_GORGO        0.34  0.51   29  174   43  174  146    6   14  273  G3RDE7     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101136362 PE=3 SV=1
  930 : G3RPA9_GORGO        0.34  0.51   29  175   29  166  151    6   17  269  G3RPA9     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101130048 PE=3 SV=1
  931 : G3RYX4_GORGO        0.34  0.52   29  173   34  163  146    6   17  263  G3RYX4     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101134917 PE=3 SV=1
  932 : G3SGE4_GORGO        0.34  0.53   29  175   42  182  154   10   20  314  G3SGE4     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101149961 PE=3 SV=1
  933 : G3SXN3_LOXAF        0.34  0.51   29  175   32  163  149    9   19  270  G3SXN3     Uncharacterized protein OS=Loxodonta africana GN=PRSS48 PE=3 SV=1
  934 : G3T748_LOXAF        0.34  0.54   29  175   16  155  151    6   15  286  G3T748     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=TMPRSS12 PE=3 SV=1
  935 : G3TL05_LOXAF        0.34  0.51   29  174   37  170  149    7   18  331  G3TL05     Uncharacterized protein OS=Loxodonta africana GN=PRSS27 PE=3 SV=1
  936 : G3UWE8_MOUSE        0.34  0.48   29  173  162  299  154    9   25  416  G3UWE8     Hepsin, isoform CRA_c OS=Mus musculus GN=Hpn PE=3 SV=1
  937 : G3VCN6_SARHA        0.34  0.53   29  175   34  165  148    6   17  263  G3VCN6     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100915387 PE=3 SV=1
  938 : G3VVW8_SARHA        0.34  0.54   29  174   35  168  149    7   18  320  G3VVW8     Uncharacterized protein OS=Sarcophilus harrisii GN=PRSS27 PE=3 SV=1
  939 : G3VZS3_SARHA        0.34  0.51   29  174   38  168  146    7   15  271  G3VZS3     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=CTRL PE=3 SV=1
  940 : G3XA07_MOUSE        0.34  0.56  178  278   64  160  105    6   12  208  G3XA07     Tryptase gamma OS=Mus musculus GN=Tpsg1 PE=3 SV=1
  941 : G5B5X5_HETGA        0.34  0.49   29  173   34  163  146    6   17  263  G5B5X5     Chymotrypsinogen B2 OS=Heterocephalus glaber GN=GW7_15472 PE=3 SV=1
  942 : G5C680_HETGA        0.34  0.49   29  172   14  143  145    5   16  244  G5C680     Chymotrypsin-like protease CTRL-1 OS=Heterocephalus glaber GN=GW7_02376 PE=3 SV=1
  943 : G5DYX9_9PIPI        0.34  0.56  177  278  137  236  105    6    8  236  G5DYX9     Putative mannose-binding lectin-associated serine protease-3a (Fragment) OS=Hymenochirus curtipes PE=2 SV=1
  944 : G6D2H8_DANPL        0.34  0.57  177  276  133  237  108    6   11  242  G6D2H8     Clip domain serine protease 4 OS=Danaus plexippus GN=KGM_02371 PE=3 SV=1
  945 : G7NQ74_MACMU        0.34  0.51   29  174   34  165  146    6   14  264  G7NQ74     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_12912 PE=3 SV=1
  946 : G7NXX0_MACFA        0.34  0.54   29  175    3  135  151    8   22  262  G7NXX0     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_10700 PE=3 SV=1
  947 : G7P6E6_MACFA        0.34  0.52   29  175   43  174  150    8   21  341  G7P6E6     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_14746 PE=3 SV=1
  948 : G7PIA7_MACFA        0.34  0.53   29  175   78  217  152    6   17  348  G7PIA7     Transmembrane protease serine 12 OS=Macaca fascicularis GN=EGM_03235 PE=3 SV=1
  949 : G7Q098_MACFA        0.34  0.53   29  174   36  169  149    7   18  324  G7Q098     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_11374 PE=3 SV=1
  950 : G7Q0A2_MACFA        0.34  0.53   29  175   42  182  154   10   20  314  G7Q0A2     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_11378 PE=3 SV=1
  951 : G7Q1F4_MACFA        0.34  0.51   29  174   34  165  146    6   14  264  G7Q1F4     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_11864 PE=3 SV=1
  952 : G7Q1N1_MACFA        0.34  0.53  179  277   70  160  100    6   10  162  G7Q1N1     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_11956 PE=3 SV=1
  953 : G9KIV0_MUSPF        0.34  0.51  177  278  130  235  111    6   14  280  G9KIV0     Protease, serine 27 (Fragment) OS=Mustela putorius furo PE=2 SV=1
  954 : H0UV76_CAVPO        0.34  0.58   29  175   45  179  149    7   16  333  H0UV76     Uncharacterized protein OS=Cavia porcellus GN=PRSS8 PE=3 SV=1
  955 : H0VW83_CAVPO        0.34  0.50   29  175   19  158  152    6   17  286  H0VW83     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=TMPRSS12 PE=3 SV=1
  956 : H0WJV5_OTOGA        0.34  0.52   29  173   34  163  146    6   17  263  H0WJV5     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  957 : H0WJV9_OTOGA        0.34  0.52   29  173   34  163  146    6   17  263  H0WJV9     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  958 : H0XIX0_OTOGA        0.34  0.52   29  174   26  159  149    7   18  279  H0XIX0     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=PRSS27 PE=3 SV=1
  959 : H0Z9C7_TAEGU        0.34  0.55   29  170    7  135  145    8   19  238  H0Z9C7     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  960 : H0ZI18_TAEGU        0.34  0.60  177  272   54  147   97    2    4  147  H0ZI18     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=PRSS56 PE=3 SV=1
  961 : H2L3H1_ORYLA        0.34  0.53   29  175    1  136  149    5   15  232  H2L3H1     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170186 PE=3 SV=1
  962 : H2L3H7_ORYLA        0.34  0.52   29  175   19  161  151    7   12  289  H2L3H7     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=TMPRSS9 (2 of 16) PE=3 SV=1
  963 : H2L6I5_ORYLA        0.34  0.54   29  175   25  157  150    6   20  259  H2L6I5     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156738 PE=3 SV=1
  964 : H2L6I6_ORYLA        0.34  0.54   29  175   25  157  150    6   20  259  H2L6I6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156738 PE=3 SV=1
  965 : H2L6L9_ORYLA        0.34  0.55   29  175    1  134  147    4   13  237  H2L6L9     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
  966 : H2LPT3_ORYLA        0.34  0.53   29  175   35  167  148    6   16  266  H2LPT3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101174455 PE=3 SV=1
  967 : H2LQV9_ORYLA        0.34  0.48   29  175  194  330  155    8   26  439  H2LQV9     Uncharacterized protein OS=Oryzias latipes GN=LOC101168986 PE=3 SV=1
  968 : H2N2L4_ORYLA        0.34  0.48   29  175   23  149  149    8   24  245  H2N2L4     Uncharacterized protein OS=Oryzias latipes GN=LOC101154931 PE=3 SV=1
  969 : H2NHA4_PONAB        0.34  0.53   29  175   78  217  152    6   17  347  H2NHA4     Uncharacterized protein OS=Pongo abelii GN=TMPRSS12 PE=3 SV=1
  970 : H2NQS2_PONAB        0.34  0.55   29  175   45  179  148    6   14  343  H2NQS2     Uncharacterized protein OS=Pongo abelii GN=PRSS8 PE=3 SV=1
  971 : H2NRI0_PONAB        0.34  0.54  178  277   98  190  102    7   11  192  H2NRI0     Uncharacterized protein (Fragment) OS=Pongo abelii GN=CTRB1 PE=3 SV=1
  972 : H2PEI1_PONAB        0.34  0.53   29  174   40  170  149    8   21  337  H2PEI1     Uncharacterized protein OS=Pongo abelii GN=PRSS48 PE=3 SV=1
  973 : H2QAZ8_PANTR        0.34  0.55   29  175   45  179  148    6   14  343  H2QAZ8     Uncharacterized protein OS=Pan troglodytes GN=PRSS8 PE=3 SV=1
  974 : H2R0H0_PANTR        0.34  0.51   29  173   34  163  146    6   17  263  H2R0H0     Uncharacterized protein OS=Pan troglodytes GN=CTRB2 PE=3 SV=1
  975 : H2RDY5_PANTR        0.34  0.57  179  278   69  160  101    4   10  160  H2RDY5     Uncharacterized protein OS=Pan troglodytes PE=3 SV=1
  976 : H2RL91_TAKRU        0.34  0.56   29  175   36  169  148    6   15  280  H2RL91     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101076928 PE=3 SV=1
  977 : H2RL92_TAKRU        0.34  0.54   29  175   32  165  148    5   15  259  H2RL92     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101076928 PE=3 SV=1
  978 : H2RLQ5_TAKRU        0.34  0.50   29  172   33  167  151    7   23  273  H2RLQ5     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101077973 PE=3 SV=1
  979 : H2RLQ6_TAKRU        0.34  0.51   29  172   51  189  151    7   19  290  H2RLQ6     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101077973 PE=3 SV=1
  980 : H2RT71_TAKRU        0.34  0.52   29  172  102  238  150   10   19  310  H2RT71     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101065721 PE=3 SV=1
  981 : H2S1K6_TAKRU        0.34  0.57   29  172   36  166  146    7   17  305  H2S1K6     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074891 PE=3 SV=1
  982 : H2S1K7_TAKRU        0.34  0.57   29  172   33  163  146    7   17  279  H2S1K7     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074891 PE=3 SV=1
  983 : H2S877_TAKRU        0.34  0.55   29  173   33  168  148    6   15  269  H2S877     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  984 : H2S878_TAKRU        0.34  0.55   29  173   24  159  148    6   15  260  H2S878     Uncharacterized protein OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  985 : H2SKH9_TAKRU        0.34  0.46   29  175   31  149  149    6   32  246  H2SKH9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101072997 PE=3 SV=1
  986 : H2SXW7_TAKRU        0.34  0.53   29  173  241  378  154   11   25  479  H2SXW7     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  987 : H2SXW8_TAKRU        0.34  0.53   29  173  225  362  154   11   25  463  H2SXW8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  988 : H2SXW9_TAKRU        0.34  0.53   29  173  186  323  154   12   25  423  H2SXW9     Uncharacterized protein OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  989 : H2SXX0_TAKRU        0.34  0.53   29  173  188  325  154   11   25  438  H2SXX0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  990 : H2SXX1_TAKRU        0.34  0.53   29  173  260  397  154   11   25  500  H2SXX1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  991 : H2SXX2_TAKRU        0.34  0.53   29  173  214  351  154   11   25  449  H2SXX2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  992 : H2SXX3_TAKRU        0.34  0.53   29  173  248  385  154   11   25  483  H2SXX3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  993 : H2T7E9_TAKRU        0.34  0.51   29  171   36  164  144    7   16  280  H2T7E9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
  994 : H2T7F0_TAKRU        0.34  0.52   29  175   31  165  148    7   14  267  H2T7F0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
  995 : H2T7F1_TAKRU        0.34  0.51   29  175   21  155  148    6   14  258  H2T7F1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
  996 : H2T7F4_TAKRU        0.34  0.51   29  175   31  165  148    6   14  259  H2T7F4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
  997 : H2UB73_TAKRU        0.34  0.48   29  175   87  217  149    7   20  329  H2UB73     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074126 PE=3 SV=1
  998 : H2UFF0_TAKRU        0.34  0.49   29  175   30  156  149    8   24  252  H2UFF0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101067258 PE=3 SV=1
  999 : H2UJF4_TAKRU        0.34  0.48   29  172   28  160  149    9   21  266  H2UJF4     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074028 PE=3 SV=1
 1000 : H2UJF5_TAKRU        0.34  0.45   29  175   31  166  152    8   21  269  H2UJF5     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074028 PE=3 SV=1
 1001 : H2VAI6_TAKRU        0.34  0.51   29  175   26  170  152    5   12  279  H2VAI6     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066013 PE=3 SV=1
 1002 : H2VAJ0_TAKRU        0.34  0.53   29  175   32  176  152    7   12  282  H2VAJ0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066013 PE=3 SV=1
 1003 : H2VCD5_TAKRU        0.34  0.50   30  171   29  159  145    6   17  261  H2VCD5     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1004 : H2VCD7_TAKRU        0.34  0.50   30  171   33  163  145    6   17  265  H2VCD7     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1005 : H2Z0I7_CIOSA        0.34  0.55   29  171   33  165  146    7   16  271  H2Z0I7     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 1006 : H2Z0I8_CIOSA        0.34  0.55   29  171   23  155  146    7   16  260  H2Z0I8     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 1007 : H2Z0J0_CIOSA        0.34  0.55   29  171   21  153  146    7   16  260  H2Z0J0     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 1008 : H3A6C8_LATCH        0.34  0.48   29  175   63  208  155    9   17  320  H3A6C8     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1009 : H3B697_LATCH        0.34  0.55   29  171   37  161  145    8   22  259  H3B697     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1010 : H3B6X0_LATCH        0.34  0.54   29  175  250  385  155   11   27  487  H3B6X0     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1011 : H3BH42_LATCH        0.34  0.47   29  175  217  348  155    9   31  454  H3BH42     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
 1012 : H3BKZ6_MOUSE        0.34  0.50   29  143   29  129  115    3   14  129  H3BKZ6     Kallikrein-1 (Fragment) OS=Mus musculus GN=Klk6 PE=2 SV=1
 1013 : H3C1E2_TETNG        0.34  0.56  177  272   77  170  100    7   10  176  H3C1E2     Uncharacterized protein OS=Tetraodon nigroviridis GN=CELA1 (1 of 5) PE=3 SV=1
 1014 : H3CH29_TETNG        0.34  0.55  182  274    4   93   95    3    7   95  H3CH29     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1015 : H3CWC1_TETNG        0.34  0.47   29  175   58  184  149    7   24  280  H3CWC1     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
 1016 : H3D345_TETNG        0.34  0.47   29  172   32  164  149    9   21  270  H3D345     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1017 : H9D159_9TELE        0.34  0.60  177  278  129  221  102    3    9  222  H9D159     Trypsin (Fragment) OS=Colossoma macropomum PE=2 SV=1
 1018 : H9F402_MACMU        0.34  0.57  178  278    4  104  106    5   10  124  H9F402     Putative serine protease 41 (Fragment) OS=Macaca mulatta GN=PRSS41 PE=2 SV=1
 1019 : H9GBW2_ANOCA        0.34  0.51   29  172    4  136  146    7   15  305  H9GBW2     Uncharacterized protein OS=Anolis carolinensis GN=PRSS8 PE=3 SV=2
 1020 : H9GC50_ANOCA        0.34  0.55   29  175   21  153  148    7   16  288  H9GC50     Uncharacterized protein OS=Anolis carolinensis GN=LOC100551951 PE=3 SV=2
 1021 : H9GSF7_ANOCA        0.34  0.47   29  173   34  166  147    9   16  321  H9GSF7     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100552735 PE=3 SV=2
 1022 : H9GU74_ANOCA        0.34  0.57   29  175   55  189  148    7   14  294  H9GU74     Uncharacterized protein OS=Anolis carolinensis PE=3 SV=1
 1023 : H9JKL0_BOMMO        0.34  0.49  177  275  104  197  103    6   13  199  H9JKL0     Uncharacterized protein OS=Bombyx mori PE=3 SV=1
 1024 : HEPS_MOUSE          0.34  0.48   29  173  182  319  154    9   25  436  O35453     Serine protease hepsin OS=Mus musculus GN=Hpn PE=2 SV=3
 1025 : HEPS_RAT            0.34  0.48   29  173  162  299  154    9   25  416  Q05511     Serine protease hepsin OS=Rattus norvegicus GN=Hpn PE=2 SV=1
 1026 : I3JIR6_ORENI        0.34  0.55   29  170   30  160  146    9   19  267  I3JIR6     Uncharacterized protein OS=Oreochromis niloticus GN=TMPRSS9 (2 of 18) PE=3 SV=1
 1027 : I3JIS7_ORENI        0.34  0.53   29  175   25  157  149    6   18  343  I3JIS7     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=TMPRSS9 (6 of 18) PE=3 SV=1
 1028 : I3JSL3_ORENI        0.34  0.54   29  175   14  147  148    6   15  248  I3JSL3     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=3 SV=1
 1029 : I3K9U5_ORENI        0.34  0.55  178  278   67  164  106    7   13  165  I3K9U5     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=GZMA (9 of 24) PE=3 SV=1
 1030 : I3KW04_ORENI        0.34  0.50   29  175   36  171  157    9   31  485  I3KW04     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100706977 PE=3 SV=1
 1031 : I3LZK8_SPETR        0.34  0.51   29  174   39  170  146    6   14  269  I3LZK8     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=CTRL PE=3 SV=1
 1032 : I3M1K2_SPETR        0.34  0.54   29  175   82  213  151   11   23  337  I3M1K2     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=PRSS42 PE=3 SV=1
 1033 : I3M3K6_SPETR        0.34  0.53   29  173   34  163  146    6   17  263  I3M3K6     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
 1034 : I3M9A0_SPETR        0.34  0.52   29  174   38  171  149    7   18  325  I3M9A0     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=PRSS27 PE=3 SV=1
 1035 : I3MJJ5_SPETR        0.34  0.50   29  175   28  158  151    8   24  303  I3MJJ5     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=PRSS48 PE=3 SV=1
 1036 : I3MXG0_SPETR        0.34  0.49   29  175   40  172  151    8   22  310  I3MXG0     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=PRSS48 PE=3 SV=1
 1037 : I3NH25_SPETR        0.34  0.49   29  175   39  171  151    8   22  284  I3NH25     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=PRSS48 PE=3 SV=1
 1038 : I4DRV6_PAPPL        0.34  0.53  187  277   25  110   93    3    9  110  I4DRV6     Clip-domain serine protease, family D OS=Papilio polytes PE=3 SV=1
 1039 : J9HGX9_AEDAE        0.34  0.56  179  273   15  109   98    3    6  119  J9HGX9     AAEL017574-PA (Fragment) OS=Aedes aegypti GN=AaeL_AAEL017574 PE=3 SV=1
 1040 : J9P6J6_CANFA        0.34  0.50   29  175   15  154  151    6   15  283  J9P6J6     Uncharacterized protein (Fragment) OS=Canis familiaris GN=TMPRSS12 PE=3 SV=1
 1041 : K1PPY8_CRAGI        0.34  0.52   29  175   65  198  149    8   17  297  K1PPY8     Trypsin-3 OS=Crassostrea gigas GN=CGI_10012273 PE=3 SV=1
 1042 : K4G389_CALMI        0.34  0.56  177  277  160  255  106    7   15  262  K4G389     Granzyme A OS=Callorhynchus milii PE=2 SV=1
 1043 : K4GIW8_CALMI        0.34  0.56  177  277  160  255  106    7   15  262  K4GIW8     Granzyme A OS=Callorhynchus milii PE=2 SV=1
 1044 : K7ESY0_PONAB        0.34  0.55   29  175   45  179  148    6   14  343  K7ESY0     Uncharacterized protein OS=Pongo abelii GN=PRSS8 PE=3 SV=1
 1045 : K7FIA9_PELSI        0.34  0.46   29  153   32  145  125    3   11  177  K7FIA9     Uncharacterized protein OS=Pelodiscus sinensis GN=PRSS56 PE=3 SV=1
 1046 : K7FME4_PELSI        0.34  0.53   29  172    9  140  145    6   14  280  K7FME4     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis GN=PRSS8 PE=3 SV=1
 1047 : K7G5N3_PELSI        0.34  0.51   29  175   39  178  151    8   15  318  K7G5N3     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis GN=ACR PE=3 SV=1
 1048 : L5K9H6_PTEAL        0.34  0.51   29  175   85  224  151    6   15  289  L5K9H6     Transmembrane protease, serine 12 OS=Pteropus alecto GN=PAL_GLEAN10009950 PE=3 SV=1
 1049 : L5MCQ5_MYODS        0.34  0.51   29  170   34  160  143    6   17  263  L5MCQ5     Chymotrypsinogen 2 OS=Myotis davidii GN=MDA_GLEAN10016751 PE=3 SV=1
 1050 : L7N1K6_MYOLU        0.34  0.50   29  170    5  140  148    6   18  244  L7N1K6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 1051 : M1EL07_MUSPF        0.34  0.52   29  174   17  148  147    6   16  246  M1EL07     Chymotrypsin-like protein (Fragment) OS=Mustela putorius furo PE=2 SV=1
 1052 : M3VYT9_FELCA        0.34  0.56   29  175   45  179  148    6   14  337  M3VYT9     Uncharacterized protein OS=Felis catus GN=PRSS8 PE=3 SV=1
 1053 : M3WMG4_FELCA        0.34  0.51   29  175   35  166  148    6   17  253  M3WMG4     Uncharacterized protein OS=Felis catus GN=LOC101096125 PE=3 SV=1
 1054 : M3WTU2_FELCA        0.34  0.54  177  278   89  190  108    4   12  216  M3WTU2     Uncharacterized protein OS=Felis catus GN=PRSS21 PE=3 SV=1
 1055 : M3XGG3_LATCH        0.34  0.47   29  175  183  314  155    9   31  418  M3XGG3     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
 1056 : M3Y5X7_MUSPF        0.34  0.52   29  174   38  169  147    6   16  268  M3Y5X7     Uncharacterized protein OS=Mustela putorius furo GN=CTRL PE=3 SV=1
 1057 : M3Y7E6_MUSPF        0.34  0.52   29  175   30  161  149    9   19  307  M3Y7E6     Uncharacterized protein OS=Mustela putorius furo GN=PRSS48 PE=3 SV=1
 1058 : M4A361_XIPMA        0.34  0.50   29  172  171  307  155   10   29  427  M4A361     Uncharacterized protein OS=Xiphophorus maculatus GN=TMPRSS11E PE=3 SV=1
 1059 : M4AQ99_XIPMA        0.34  0.45   29  172   28  159  148    6   20  265  M4AQ99     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 1060 : M7BSV0_CHEMY        0.34  0.48   29  149    7  123  124    2   10  223  M7BSV0     Transmembrane protease serine 12 OS=Chelonia mydas GN=UY3_11634 PE=3 SV=1
 1061 : M7CI83_CHEMY        0.34  0.51  177  278   22  127  112    5   16  172  M7CI83     Testisin OS=Chelonia mydas GN=UY3_02081 PE=3 SV=1
 1062 : PRS30_MOUSE         0.34  0.55   29  174   37  171  148    7   15  310  Q9QYZ9     Serine protease 30 OS=Mus musculus GN=Prss30 PE=2 SV=2
 1063 : PRS30_RAT           0.34  0.55   29  174   31  165  148    7   15  304  P83748     Serine protease 30 OS=Rattus norvegicus GN=Prss30 PE=1 SV=1
 1064 : PRSS8_HUMAN 3DFL    0.34  0.55   29  175   45  179  148    6   14  343  Q16651     Prostasin OS=Homo sapiens GN=PRSS8 PE=1 SV=1
 1065 : Q174G7_AEDAE        0.34  0.52   29  175   40  174  149    6   16  289  Q174G7     AAEL006902-PA OS=Aedes aegypti GN=AAEL006902 PE=3 SV=1
 1066 : Q17PV2_AEDAE        0.34  0.53   29  175   96  231  151    7   19  342  Q17PV2     AAEL000225-PA OS=Aedes aegypti GN=AAEL000225 PE=3 SV=1
 1067 : Q3KQ48_XENLA        0.34  0.49   29  171   71  205  152   11   26  317  Q3KQ48     MGC130972 protein OS=Xenopus laevis GN=acr PE=2 SV=1
 1068 : Q3U0U6_MOUSE        0.34  0.48   29  173  191  328  154    9   25  445  Q3U0U6     Putative uncharacterized protein OS=Mus musculus GN=Hpn PE=2 SV=1
 1069 : Q3V068_MOUSE        0.34  0.51   29  175   38  169  155    8   31  294  Q3V068     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=Prss42 PE=2 SV=1
 1070 : Q4S849_TETNG        0.34  0.47   29  172   28  160  149    8   21  259  Q4S849     Chromosome 9 SCAF14710, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00022510001 PE=3 SV=1
 1071 : Q4SH19_TETNG        0.34  0.47   29  175   58  184  149    7   24  278  Q4SH19     Chromosome 8 SCAF14587, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00018365001 PE=3 SV=1
 1072 : Q53FV9_HUMAN        0.34  0.52   29  174   34  165  146    6   14  264  Q53FV9     Chymotrypsin-like variant (Fragment) OS=Homo sapiens PE=2 SV=1
 1073 : Q5R567_PONAB        0.34  0.56  179  278   47  138  102    7   12  140  Q5R567     Putative uncharacterized protein DKFZp459E0918 OS=Pongo abelii GN=DKFZp459E0918 PE=2 SV=1
 1074 : Q5RBI2_PONAB        0.34  0.55   29  175   45  179  148    6   14  343  Q5RBI2     Putative uncharacterized protein DKFZp469E0915 OS=Pongo abelii GN=DKFZp469E0915 PE=2 SV=1
 1075 : Q5RIZ2_DANRE        0.34  0.47   29  172   33  165  148    7   19  271  Q5RIZ2     Novel elastase protein (Zgc:637440) (Fragment) OS=Danio rerio GN=ela2l PE=3 SV=1
 1076 : Q6GLK1_XENLA        0.34  0.55   29  173   40  171  146    6   15  280  Q6GLK1     LOC443716 protein (Fragment) OS=Xenopus laevis GN=LOC443716 PE=2 SV=1
 1077 : Q6GQQ3_RAT          0.34  0.48   29  173  162  299  154    9   25  370  Q6GQQ3     Hpn protein OS=Rattus norvegicus GN=Hpn PE=2 SV=1
 1078 : Q6ICV2_HUMAN        0.34  0.51   29  175   29  166  151    6   17  269  Q6ICV2     ELA2A protein (Fragment) OS=Homo sapiens GN=ELA2A PE=2 SV=1
 1079 : Q6IE60_RAT          0.34  0.52   29  174   32  164  149    7   19  321  Q6IE60     Marapsin (Precursor) OS=Rattus norvegicus GN=Prss27 PE=2 SV=1
 1080 : Q6ISN8_HUMAN        0.34  0.51   29  175   29  166  151    6   17  269  Q6ISN8     Elastase 2A OS=Homo sapiens GN=ELA2A PE=2 SV=1
 1081 : Q6ISU5_HUMAN        0.34  0.52   29  175   29  166  151    6   17  269  Q6ISU5     Elastase 2A OS=Homo sapiens GN=ELA2A PE=2 SV=1
 1082 : Q6NVR7_XENTR        0.34  0.53   29  175   26  158  148    7   16  330  Q6NVR7     Protease, serine, 29 OS=Xenopus tropicalis GN=prss29 PE=2 SV=1
 1083 : Q7Q820_ANOGA        0.34  0.53   29  171   31  163  147    7   18  265  Q7Q820     AGAP004900-PA (Fragment) OS=Anopheles gambiae GN=AGAP004900 PE=3 SV=4
 1084 : Q803Z4_DANRE        0.34  0.46   29  172   33  165  147    7   17  271  Q803Z4     Ela2 protein (Fragment) OS=Danio rerio GN=ela2 PE=2 SV=1
 1085 : Q8IUW0_HUMAN        0.34  0.52   29  174   39  170  146    6   14  269  Q8IUW0     CTRL protein (Fragment) OS=Homo sapiens GN=CTRL PE=2 SV=1
 1086 : Q8QGW3_ANGJA        0.34  0.53   29  171   21  145  144    7   20  244  Q8QGW3     Trypsinogen OS=Anguilla japonica GN=try PE=2 SV=1
 1087 : Q9BK47_9ECHI        0.34  0.57   29  171   30  162  145    7   14  267  Q9BK47     Sea star regeneration-associated protease SRAP OS=Luidia foliolata PE=2 SV=1
 1088 : Q9CPN7_MOUSE        0.34  0.48   29  171   24  147  144    6   21  247  Q9CPN7     Protein 1810009J06Rik OS=Mus musculus GN=1810009J06Rik PE=2 SV=1
 1089 : Q9DGR3_XENLA        0.34  0.53   29  175   41  175  149    9   16  317  Q9DGR3     Embryonic serine protease-1 OS=Xenopus laevis GN=Xesp-1 PE=2 SV=1
 1090 : R7TNR1_CAPTE        0.34  0.59   29  175   25  160  148    7   13  262  R7TNR1     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_213986 PE=3 SV=1
 1091 : S4PLE6_9NEOP        0.34  0.53  182  277   45  144  104    5   12  155  S4PLE6     CLIP domain serine protease 11 OS=Pararge aegeria PE=3 SV=1
 1092 : S4RKN2_PETMA        0.34  0.56  179  277   92  183  101    4   11  185  S4RKN2     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 1093 : S4RYY0_PETMA        0.34  0.50   39  175    1  126  138    5   13  214  S4RYY0     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 1094 : S7MMW1_MYOBR        0.34  0.50  179  278   22  114  102    6   11  115  S7MMW1     Chymotrypsinogen 2 OS=Myotis brandtii GN=D623_10035452 PE=3 SV=1
 1095 : S7MQ15_MYOBR        0.34  0.51   29  170   34  160  143    6   17  263  S7MQ15     Chymotrypsinogen 2 OS=Myotis brandtii GN=D623_10035451 PE=3 SV=1
 1096 : S9XEX8_9CETA        0.34  0.52   29  174    5  138  147    7   14  274  S9XEX8     Serine protease 27-like protein OS=Camelus ferus GN=CB1_000144054 PE=3 SV=1
 1097 : T1L3F3_TETUR        0.34  0.52   29  175   45  178  151    7   21  256  T1L3F3     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 1098 : T1L594_TETUR        0.34  0.52   29  175   21  154  151    6   21  232  T1L594     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 1099 : T1PGA0_MUSDO        0.34  0.53  177  278   83  176  105    5   14  177  T1PGA0     Trypsin OS=Musca domestica PE=2 SV=1
 1100 : T1PJT9_MUSDO        0.34  0.53  179  272   52  137   97    5   14  144  T1PJT9     Trypsin OS=Musca domestica PE=2 SV=1
 1101 : TMPSC_MOUSE         0.34  0.51   29  175   66  205  152    6   17  336  Q3V0Q7     Transmembrane protease serine 12 OS=Mus musculus GN=Tmprss12 PE=2 SV=1
 1102 : TRY3_HUMAN  3L3T    0.34  0.50   29  172   81  204  145    7   22  304  P35030     Trypsin-3 OS=Homo sapiens GN=PRSS3 PE=1 SV=2
 1103 : TRY4_RAT            0.34  0.48   29  171   24  147  144    6   21  247  P12788     Trypsin-4 OS=Rattus norvegicus GN=Try4 PE=2 SV=1
 1104 : U3CWD3_CALJA        0.34  0.49   29  175   24  150  149    8   24  247  U3CWD3     Trypsin-2 preproprotein OS=Callithrix jacchus GN=PRSS2 PE=2 SV=1
 1105 : U3IMK9_ANAPL        0.34  0.54  178  272   70  163   98    4    7  168  U3IMK9     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=ACR PE=3 SV=1
 1106 : U3KC72_FICAL        0.34  0.50   29  170   48  181  144    5   12  248  U3KC72     Uncharacterized protein OS=Ficedula albicollis PE=3 SV=1
 1107 : U6DZK9_NEOVI        0.34  0.51  182  278  114  214  108    8   18  221  U6DZK9     Complement component 1, s subcomponent (Fragment) OS=Neovison vison GN=F8WCZ6 PE=2 SV=1
 1108 : V5GRW4_ANOGL        0.34  0.50   29  170   47  177  146    9   19  276  V5GRW4     Chymotrypsin BI (Fragment) OS=Anoplophora glabripennis GN=CTRB1 PE=3 SV=1
 1109 : V5HES4_IXORI        0.34  0.50   29  175   36  172  152    8   20  281  V5HES4     Putative trypsin-like serine protease OS=Ixodes ricinus PE=2 SV=1
 1110 : V8NE89_OPHHA        0.34  0.54  177  278   45  139  104    7   11  140  V8NE89     Uncharacterized protein (Fragment) OS=Ophiophagus hannah GN=L345_14322 PE=3 SV=1
 1111 : V8NN15_OPHHA        0.34  0.50   29  171   30  158  145    6   18  260  V8NN15     Chymotrypsin-like protease CTRL-1 OS=Ophiophagus hannah GN=CTRL PE=3 SV=1
 1112 : V9L7A7_CALMI        0.34  0.54   29  175   33  165  149    9   18  317  V9L7A7     Prostasin-like protein OS=Callorhynchus milii PE=2 SV=1
 1113 : W4Y9H7_STRPU        0.34  0.58  179  278  107  202  101    4    6  206  W4Y9H7     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Klkb1 PE=3 SV=1
 1114 : W4YUQ1_STRPU        0.34  0.53  179  277   18  112   99    2    4  114  W4YUQ1     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-trypsinL_4 PE=3 SV=1
 1115 : W4Z6E3_STRPU        0.34  0.53   29  172   39  180  148    6   10  245  W4Z6E3     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-GramarL1 PE=3 SV=1
 1116 : W5KAX5_ASTMX        0.34  0.52   29  175   32  162  149    7   20  259  W5KAX5     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1117 : W5KG70_ASTMX        0.34  0.58  177  278   73  171  104    3    7  172  W5KG70     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1118 : W5KQF8_ASTMX        0.34  0.57   29  175   38  173  147    5   11  217  W5KQF8     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1119 : W5LR38_ASTMX        0.34  0.49   29  173  166  305  158   10   31  427  W5LR38     Uncharacterized protein (Fragment) OS=Astyanax mexicanus GN=TMPRSS11E PE=3 SV=1
 1120 : W5LV75_LEPOC        0.34  0.50   29  175   37  170  149    8   17  349  W5LV75     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 1121 : W5LV83_LEPOC        0.34  0.57   29  175   12  145  149    8   17  327  W5LV83     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 1122 : W5LVA4_LEPOC        0.34  0.53   29  175   34  168  147    5   12  313  W5LVA4     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 1123 : W5LXF7_LEPOC        0.34  0.54   29  175   81  219  149    5   12  315  W5LXF7     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 1124 : W5M368_LEPOC        0.34  0.48   29  172   34  166  149    9   21  272  W5M368     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus GN=CTRC (2 of 2) PE=3 SV=1
 1125 : W5M6U1_LEPOC        0.34  0.49   29  173  163  299  156   10   30  416  W5M6U1     Uncharacterized protein OS=Lepisosteus oculatus GN=TMPRSS11E PE=3 SV=1
 1126 : W5Q7N6_SHEEP        0.34  0.44   29  175  534  679  161   14   29  778  W5Q7N6     Uncharacterized protein (Fragment) OS=Ovis aries GN=PRSS12 PE=3 SV=1
 1127 : W5QBI0_SHEEP        0.34  0.53   29  174   38  171  149    7   18  320  W5QBI0     Uncharacterized protein OS=Ovis aries GN=PRSS27 PE=3 SV=1
 1128 : W5UF14_ICTPU        0.34  0.48   29  173  163  302  158   10   31  424  W5UF14     Serine protease hepsin OS=Ictalurus punctatus GN=Hpn PE=2 SV=1
 1129 : X1WEQ8_DANRE        0.34  0.56   29  172   36  166  147    8   19  306  X1WEQ8     Uncharacterized protein OS=Danio rerio GN=si:dkeyp-93a5.3 PE=4 SV=1
 1130 : A0FGS8_CANFA        0.33  0.49   29  171   20  142  145    8   24  243  A0FGS8     Anionic trypsinogen (Fragment) OS=Canis familiaris PE=3 SV=1
 1131 : A2BGP5_DANRE        0.33  0.49   29  175   29  166  152    7   19  269  A2BGP5     Uncharacterized protein OS=Danio rerio GN=ela3l PE=3 SV=1
 1132 : A6XMV9_HUMAN        0.33  0.51   29  171   24  160  148    8   16  261  A6XMV9     Protease serine 2 preproprotein OS=Homo sapiens PE=2 SV=1
 1133 : A7LD79_KARBC        0.33  0.50   29  175   21  147  149    7   24  242  A7LD79     Trypsinogen 2 OS=Kareius bicoloratus GN=TRP2 PE=2 SV=1
 1134 : A7RXZ9_NEMVE        0.33  0.55   42  171    3  120  131    5   14  232  A7RXZ9     Predicted protein OS=Nematostella vectensis GN=v1g164017 PE=3 SV=1
 1135 : A7RYF8_NEMVE        0.33  0.58   29  175    2  135  147    6   13  236  A7RYF8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g97944 PE=3 SV=1
 1136 : A7RZ30_NEMVE        0.33  0.57  182  278   95  189  101    6   10  193  A7RZ30     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g98319 PE=3 SV=1
 1137 : A7S1T0_NEMVE        0.33  0.49   29  174   18  152  146    4   11  252  A7S1T0     Predicted protein OS=Nematostella vectensis GN=v1g101093 PE=3 SV=1
 1138 : A7S9K6_NEMVE        0.33  0.50   29  175   27  162  147    4   11  261  A7S9K6     Predicted protein OS=Nematostella vectensis GN=v1g229711 PE=3 SV=1
 1139 : A7SDB3_NEMVE        0.33  0.57   29  171    4  134  145    7   16  244  A7SDB3     Predicted protein OS=Nematostella vectensis GN=v1g210516 PE=3 SV=1
 1140 : A7SNB8_NEMVE        0.33  0.55   29  175    3  137  150    7   18  230  A7SNB8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g124644 PE=3 SV=1
 1141 : A7SS64_NEMVE        0.33  0.52   29  175    3  144  153    9   17  253  A7SS64     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g129447 PE=3 SV=1
 1142 : A7SZI9_NEMVE        0.33  0.54   29  152    2  118  124    4    7  217  A7SZI9     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g41116 PE=3 SV=1
 1143 : A7T3C0_NEMVE        0.33  0.49   29  175    7  142  147    4   11  241  A7T3C0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g144191 PE=3 SV=1
 1144 : A7VMR8_SOLSE        0.33  0.49   29  172   22  147  144    5   18  247  A7VMR8     Trypsinogen 3 OS=Solea senegalensis GN=TRP3 PE=2 SV=1
 1145 : A7Y355_9PERO        0.33  0.50   29  172   29  163  151    7   23  269  A7Y355     Elastase-like serine protease OS=Spondyliosoma cantharus PE=2 SV=1
 1146 : A7Y359_ACALA        0.33  0.50   29  172   29  163  151    7   23  269  A7Y359     Elastase-like serine protease OS=Acanthopagrus latus PE=2 SV=1
 1147 : A7Y361_PAGMA        0.33  0.50   29  172   29  163  151    7   23  269  A7Y361     Elastase-like serine protease OS=Pagrus major PE=2 SV=1
 1148 : A7YWU6_BOVIN        0.33  0.51   29  173   34  163  146    6   17  263  A7YWU6     CTRB1 protein OS=Bos taurus GN=CTRB1 PE=2 SV=1
 1149 : A9YYL0_DERFA        0.33  0.48   29  175   28  158  149    7   20  259  A9YYL0     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
 1150 : B0LM10_ELERU        0.33  0.50   29  170   17  158  150    9   16  276  B0LM10     Acrosin (Fragment) OS=Elephantulus rufescens GN=ACR PE=3 SV=1
 1151 : B0W281_CULQU        0.33  0.51   29  175   37  179  153    7   16  337  B0W281     Proacrosin OS=Culex quinquefasciatus GN=CpipJ_CPIJ001111 PE=3 SV=1
 1152 : B0WTZ6_CULQU        0.33  0.51   29  175  172  310  154    8   22  413  B0WTZ6     Serine protease OS=Culex quinquefasciatus GN=CpipJ_CPIJ009891 PE=3 SV=1
 1153 : B0XFN8_CULQU        0.33  0.45   29  170   65  196  150    7   26  308  B0XFN8     Serine protease OS=Culex quinquefasciatus GN=CpipJ_CPIJ018036 PE=3 SV=1
 1154 : B2ZDQ2_HUMAN        0.33  0.49   29  173  163  300  154    9   25  402  B2ZDQ2     Truncated hepsin serine protease OS=Homo sapiens PE=2 SV=1
 1155 : B3DJ33_DANRE        0.33  0.47   29  172   30  162  147    6   17  268  B3DJ33     Ela2l protein (Fragment) OS=Danio rerio GN=ela2l PE=2 SV=1
 1156 : B3NHA5_DROER        0.33  0.52  177  277   65  165  105    5    8  173  B3NHA5     GG13828 OS=Drosophila erecta GN=Dere\GG13828 PE=3 SV=1
 1157 : B3V3M8_HYPMO        0.33  0.50   29  171   22  146  144    7   20  243  B3V3M8     Myofibril-bound serine proteinase OS=Hypophthalmichthys molitrix GN=MBSP PE=2 SV=1
 1158 : B3Y6D5_SALLE        0.33  0.50   29  175   21  147  149    7   24  242  B3Y6D5     Trypsin OS=Salvelinus leucomaenis PE=2 SV=2
 1159 : B4DHX9_HUMAN        0.33  0.56  179  278   47  138  102    7   12  140  B4DHX9     Kallikrein-7 OS=Homo sapiens GN=KLK7 PE=2 SV=1
 1160 : B4K7W5_DROMO        0.33  0.49   29  171   71  205  152   11   26  316  B4K7W5     GI24188 OS=Drosophila mojavensis GN=Dmoj\GI24188 PE=3 SV=1
 1161 : B4KLE8_DROMO        0.33  0.53   29  175   74  207  150    7   19  312  B4KLE8     GI22815 OS=Drosophila mojavensis GN=Dmoj\GI22815 PE=3 SV=1
 1162 : B4LCZ8_DROVI        0.33  0.47   29  175   39  174  150    7   17  274  B4LCZ8     GJ12928 OS=Drosophila virilis GN=Dvir\GJ12928 PE=3 SV=1
 1163 : B4MP39_DROWI        0.33  0.55  177  278   87  179  104    5   13  184  B4MP39     GK19457 OS=Drosophila willistoni GN=Dwil\GK19457 PE=3 SV=1
 1164 : B4PGR1_DROYA        0.33  0.52  177  277   65  165  105    5    8  173  B4PGR1     GE20120 OS=Drosophila yakuba GN=Dyak\GE20120 PE=3 SV=1
 1165 : B4QRA8_DROSI        0.33  0.52  177  277   65  165  105    5    8  173  B4QRA8     GD12718 OS=Drosophila simulans GN=Dsim\GD12718 PE=3 SV=1
 1166 : B5AU09_PAROL        0.33  0.50   29  172   29  163  151    7   23  269  B5AU09     Elastase-like serine protease OS=Paralichthys olivaceus GN=ELSrP PE=2 SV=1
 1167 : B5U2W0_BOMIG        0.33  0.47   29  174  114  257  158   12   26  360  B5U2W0     Venom serine protease OS=Bombus ignitus PE=2 SV=1
 1168 : B5X8D4_SALSA        0.33  0.50   29  175   21  147  149    7   24  242  B5X8D4     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
 1169 : B6CGL9_DIPSG        0.33  0.51   29  171   21  143  144    7   22  241  B6CGL9     Trypsinogen OS=Diplodus sargus PE=2 SV=1
 1170 : B6VRV3_ONCMA        0.33  0.50   29  175   21  147  149    7   24  242  B6VRV3     Trypsin OS=Oncorhynchus masou GN=tryp PE=2 SV=2
 1171 : B7GBH6_PHATC        0.33  0.50  180  276   15  105  100    4   12  105  B7GBH6     Predicted protein (Fragment) OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_7679 PE=3 SV=1
 1172 : B7P540_IXOSC        0.33  0.55   29  173   44  172  147    7   20  277  B7P540     Proclotting enzyme, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW001322 PE=3 SV=1
 1173 : B7PCB9_IXOSC        0.33  0.52   29  170   23  151  147    9   23  262  B7PCB9     Serine protease, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW017406 PE=3 SV=1
 1174 : B7Z1L4_HUMAN        0.33  0.49   29  173  135  272  154    9   25  393  B7Z1L4     cDNA FLJ57261, highly similar to Serine protease hepsin (EC 3.4.21.-) OS=Homo sapiens PE=2 SV=1
 1175 : B9V2Z1_EPICO        0.33  0.50   29  170   28  154  147    8   25  257  B9V2Z1     Chymotrypsinogen 2 (Fragment) OS=Epinephelus coioides PE=2 SV=1
 1176 : C1BKZ0_OSMMO        0.33  0.52   29  172   22  147  147    7   24  246  C1BKZ0     Anionic trypsin-1 OS=Osmerus mordax GN=TRY1 PE=2 SV=1
 1177 : C1BZ25_ESOLU        0.33  0.54  179  278   91  186  104    6   12  186  C1BZ25     Granzyme A OS=Esox lucius GN=GRAA PE=2 SV=1
 1178 : C3Y7Q7_BRAFL        0.33  0.53   29  175   11  145  147    5   12  245  C3Y7Q7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_71416 PE=3 SV=1
 1179 : C3YGA3_BRAFL        0.33  0.49   29  171   13  144  143    5   11  248  C3YGA3     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_60465 PE=3 SV=1
 1180 : C3YJJ5_BRAFL        0.33  0.54   29  175   14  148  147    5   12  248  C3YJJ5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_71413 PE=3 SV=1
 1181 : C3YJK9_BRAFL        0.33  0.55   29  175   41  175  149    6   16  274  C3YJK9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_119700 PE=3 SV=1
 1182 : C3Z5B6_BRAFL        0.33  0.54  177  278  118  216  104    4    7  217  C3Z5B6     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_59355 PE=3 SV=1
 1183 : C3ZLA6_BRAFL        0.33  0.51  180  277  120  210  100    5   11  210  C3ZLA6     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_78192 PE=3 SV=1
 1184 : C9W8I3_9NEOP        0.33  0.53   29  175   33  176  150    6    9  217  C9W8I3     Serine protease 46 (Fragment) OS=Mamestra configurata GN=SP46 PE=2 SV=1
 1185 : CEL2A_MOUSE         0.33  0.48   29  175   31  168  151    8   17  271  P05208     Chymotrypsin-like elastase family member 2A OS=Mus musculus GN=Cela2a PE=2 SV=1
 1186 : CEL2B_HUMAN         0.33  0.50   29  175   29  166  153    7   21  269  P08218     Chymotrypsin-like elastase family member 2B OS=Homo sapiens GN=CELA2B PE=2 SV=2
 1187 : CTRB1_RAT   1KDQ    0.33  0.52   29  173   34  163  146    6   17  263  P07338     Chymotrypsinogen B OS=Rattus norvegicus GN=Ctrb1 PE=1 SV=1
 1188 : CTRB2_LITVA         0.33  0.47   29  171   46  171  147    8   25  271  P36178     Chymotrypsin BII OS=Litopenaeus vannamei PE=1 SV=1
 1189 : D0V531_CTEFE        0.33  0.51   29  175   28  160  149    6   18  260  D0V531     Trypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
 1190 : D0V540_CTEFE        0.33  0.48  179  274   41  136  101    5   10  139  D0V540     Trypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
 1191 : D2D389_CTEID        0.33  0.53   29  171   21  143  144    7   22  242  D2D389     Trypsinogen OS=Ctenopharyngodon idella PE=2 SV=1
 1192 : D2GV92_AILME        0.33  0.54   29  171   12  138  144    7   18  248  D2GV92     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_000623 PE=3 SV=1
 1193 : D2HP34_AILME        0.33  0.49   29  171   15  137  144    7   22  238  D2HP34     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_013507 PE=3 SV=1
 1194 : D2HV80_AILME        0.33  0.53  177  278  148  253  111    6   14  264  D2HV80     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_016253 PE=3 SV=1
 1195 : D2I405_AILME        0.33  0.50   29  172   16  143  145    6   18  241  D2I405     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_020295 PE=3 SV=1
 1196 : D3TJH6_SINCH        0.33  0.49   29  175   25  151  148    6   22  247  D3TJH6     Pancreatic trypsin OS=Siniperca chuatsi PE=2 SV=1
 1197 : D4AB85_RAT          0.33  0.52   29  175   54  190  150    7   16  298  D4AB85     Protein Prss32 OS=Rattus norvegicus GN=Prss32 PE=3 SV=2
 1198 : D6WEQ0_TRICA        0.33  0.53  179  277  108  207  104    5    9  207  D6WEQ0     Serine protease P36 OS=Tribolium castaneum GN=P36 PE=3 SV=1
 1199 : E1CJC3_9TELE        0.33  0.50   29  175   21  147  149    7   24  242  E1CJC3     Trypsin OS=Parahucho perryi GN=tryp1 PE=2 SV=1
 1200 : E1CJC4_9TELE        0.33  0.50   29  175   21  147  149    7   24  242  E1CJC4     Trypsin OS=Parahucho perryi GN=tryp2 PE=2 SV=1
 1201 : E2JEI5_BRABE        0.33  0.49   29  175   32  163  148    6   17  272  E2JEI5     Trypsinogen OS=Branchiostoma belcheri PE=2 SV=1
 1202 : E2RKP5_CANFA        0.33  0.49   29  173  163  300  154    9   25  417  E2RKP5     Uncharacterized protein OS=Canis familiaris GN=HPN PE=3 SV=2
 1203 : E3TDH9_9TELE        0.33  0.47   29  175   29  164  150    6   17  267  E3TDH9     Chymotrypsin-like elastase family member 2a OS=Ictalurus furcatus GN=CEL2A PE=2 SV=1
 1204 : E4X393_OIKDI        0.33  0.50  179  276   66  163  101    4    6  163  E4X393     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_9 OS=Oikopleura dioica GN=GSOID_T00017732001 PE=3 SV=1
 1205 : E5KHE3_9ORTH        0.33  0.55   29  175   36  173  152    8   19  283  E5KHE3     Ejaculate serine protease (Fragment) OS=Allonemobius socius PE=2 SV=1
 1206 : E5S751_TRISP        0.33  0.55   29  149   45  170  128    4    9  196  E5S751     Elastase-2A OS=Trichinella spiralis GN=Tsp_10977 PE=3 SV=1
 1207 : E6Y432_BOVIN        0.33  0.54   29  172    1  134  145    5   12  235  E6Y432     Enterokinase light chain (Fragment) OS=Bos taurus PE=2 SV=1
 1208 : E9GHW4_DAPPU        0.33  0.47   29  174   33  168  150    7   18  276  E9GHW4     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_318106 PE=3 SV=1
 1209 : E9GLZ2_DAPPU        0.33  0.51   29  175   69  203  150    7   18  305  E9GLZ2     Chymotrypsin-like protein OS=Daphnia pulex GN=CHY1E PE=3 SV=1
 1210 : E9H0G9_DAPPU        0.33  0.51   29  170    6  135  143    6   14  246  E9H0G9     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_56607 PE=3 SV=1
 1211 : E9INM4_SOLIN        0.33  0.48   29  173   24  163  150    7   15  259  E9INM4     Putative uncharacterized protein (Fragment) OS=Solenopsis invicta GN=SINV_00424 PE=3 SV=1
 1212 : E9J0R3_SOLIN        0.33  0.50  179  272   11   95   94    2    9   95  E9J0R3     Putative uncharacterized protein (Fragment) OS=Solenopsis invicta GN=SINV_01824 PE=3 SV=1
 1213 : E9Q409_MOUSE        0.33  0.54   29  175   54  190  150    6   16  334  E9Q409     Protein Prss32 OS=Mus musculus GN=Prss32 PE=3 SV=1
 1214 : F1CGQ2_BOMTE        0.33  0.47   29  174  112  255  158   12   26  358  F1CGQ2     Venom serine protease OS=Bombus terrestris PE=2 SV=1
 1215 : F1CIW1_HOTJU        0.33  0.55  177  272   52  141   97    4    8  162  F1CIW1     Putative trypsin/chemotrypsin-like S1/S6 peptidase OS=Hottentotta judaicus PE=2 SV=1
 1216 : F1M9J3_RAT          0.33  0.52  179  278   91  194  111    7   18  227  F1M9J3     Protein Prss48 (Fragment) OS=Rattus norvegicus GN=Prss48 PE=3 SV=2
 1217 : F1MA56_RAT          0.33  0.52   29  173   34  163  146    6   17  263  F1MA56     Chymotrypsinogen B OS=Rattus norvegicus GN=Ctrb1 PE=3 SV=1
 1218 : F1P0H2_CHICK        0.33  0.52   29  172   56  191  147    7   14  309  F1P0H2     Uncharacterized protein (Fragment) OS=Gallus gallus GN=ACR PE=3 SV=2
 1219 : F1Q7H9_DANRE        0.33  0.50   29  175   38  171  149    7   17  303  F1Q7H9     Uncharacterized protein OS=Danio rerio GN=zgc:153968 PE=3 SV=1
 1220 : F1QFX9_DANRE        0.33  0.50   29  170   34  160  146    7   23  263  F1QFX9     Uncharacterized protein OS=Danio rerio GN=ctrb1 PE=3 SV=1
 1221 : F1QRL3_DANRE        0.33  0.49   29  175   29  166  152    7   19  267  F1QRL3     Uncharacterized protein OS=Danio rerio GN=ela3l PE=3 SV=1
 1222 : F1QS02_DANRE        0.33  0.54  182  277    9  106  102    4   10  139  F1QS02     Uncharacterized protein (Fragment) OS=Danio rerio GN=zgc:92313 PE=3 SV=1
 1223 : F2WR21_EPICO        0.33  0.50   29  170   31  157  147    8   25  260  F2WR21     Chymotrypsinogen 2 (Fragment) OS=Epinephelus coioides PE=2 SV=1
 1224 : F5BZR7_EPIBR        0.33  0.53  177  277   68  161  103    8   11  163  F5BZR7     Chymotrypsinogen 2 (Fragment) OS=Epinephelus bruneus PE=2 SV=1
 1225 : F6QHU6_MACMU        0.33  0.49   29  173  163  300  154    9   25  417  F6QHU6     Serine protease hepsin OS=Macaca mulatta GN=HPN PE=3 SV=1
 1226 : F6R7E8_MOUSE        0.33  0.48   29  171   24  147  144    6   21  247  F6R7E8     Protein Gm2663 OS=Mus musculus GN=Gm2663 PE=3 SV=1
 1227 : F6RAV1_XENTR        0.33  0.55   29  175   34  168  150    9   18  303  F6RAV1     Uncharacterized protein OS=Xenopus tropicalis GN=LOC100494613 PE=3 SV=1
 1228 : F6T323_HORSE        0.33  0.48   29  172   31  154  146    7   24  254  F6T323     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100055297 PE=3 SV=1
 1229 : F6TCQ7_CALJA        0.33  0.49   29  173  162  299  154    9   25  416  F6TCQ7     Uncharacterized protein OS=Callithrix jacchus GN=HPN PE=3 SV=1
 1230 : F6TMW2_CALJA        0.33  0.49   29  173  163  300  154    9   25  417  F6TMW2     Uncharacterized protein OS=Callithrix jacchus GN=HPN PE=3 SV=1
 1231 : F6X1T9_MACMU        0.33  0.50   29  171   38  161  144    7   21  262  F6X1T9     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 1232 : F6XEJ3_MACMU        0.33  0.49   29  173  111  248  154    9   25  369  F6XEJ3     Uncharacterized protein OS=Macaca mulatta GN=HPN PE=3 SV=1
 1233 : F6XQG8_MONDO        0.33  0.50   29  173  120  257  154    9   25  374  F6XQG8     Uncharacterized protein OS=Monodelphis domestica GN=HPN PE=3 SV=2
 1234 : F6Y5A1_CALJA        0.33  0.53   29  175   28  169  153    9   17  301  F6Y5A1     Uncharacterized protein OS=Callithrix jacchus GN=PRSS22 PE=3 SV=1
 1235 : F6YBN7_MACMU        0.33  0.52   29  175   43  174  150    8   21  341  F6YBN7     Uncharacterized protein OS=Macaca mulatta GN=PRSS48 PE=3 SV=1
 1236 : F6ZYF9_ORNAN        0.33  0.50  177  278  113  214  107    5   10  218  F6ZYF9     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100092422 PE=3 SV=1
 1237 : F7A447_ORNAN        0.33  0.56   29  175   38  173  149    6   15  296  F7A447     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PRSS22 PE=3 SV=1
 1238 : F7AC92_HORSE        0.33  0.52   29  175   12  144  152    9   24  275  F7AC92     Uncharacterized protein (Fragment) OS=Equus caballus GN=PRSS44 PE=3 SV=1
 1239 : F7AZZ7_MONDO        0.33  0.48   29  175   29  166  153    9   21  269  F7AZZ7     Uncharacterized protein OS=Monodelphis domestica GN=LOC100027354 PE=3 SV=2
 1240 : F7BCE0_CIOIN        0.33  0.50   29  170   76  212  147    7   15  340  F7BCE0     Uncharacterized protein OS=Ciona intestinalis GN=LOC100179458 PE=3 SV=1
 1241 : F7BIT1_MONDO        0.33  0.50   29  171   24  146  144    8   22  243  F7BIT1     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010619 PE=3 SV=1
 1242 : F7BMH7_MACMU        0.33  0.47   29  174   10  140  147    5   17  207  F7BMH7     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=PRSS42 PE=3 SV=1
 1243 : F7D9G1_XENTR        0.33  0.49   29  172   32  155  146    7   24  254  F7D9G1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=prss1 PE=3 SV=1
 1244 : F7E6G2_ORNAN        0.33  0.55  177  278   95  199  110    5   13  240  F7E6G2     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PRSS27 PE=3 SV=1
 1245 : F7FND2_MACMU        0.33  0.50   29  175   29  166  151    6   17  269  F7FND2     Uncharacterized protein OS=Macaca mulatta GN=ELA2B PE=3 SV=1
 1246 : F7FY14_MONDO        0.33  0.57   29  175   31  166  150    8   17  270  F7FY14     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=3 SV=1
 1247 : F7G8Q4_MONDO        0.33  0.58   29  175   58  193  150    8   17  298  F7G8Q4     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=3 SV=1
 1248 : F7HBQ4_MACMU        0.33  0.50   29  171   38  160  144    7   22  261  F7HBQ4     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 1249 : F7HBQ8_MACMU        0.33  0.52   29  171   45  167  144    7   22  268  F7HBQ8     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 1250 : F7IWD8_ANOGA        0.33  0.54   29  175   43  176  150    8   19  283  F7IWD8     AGAP004568-PA (Fragment) OS=Anopheles gambiae GN=AgaP_AGAP004568 PE=3 SV=1
 1251 : F8U087_EPIBR        0.33  0.51   29  172   22  147  144    6   18  247  F8U087     Trypsinogen 3 (Fragment) OS=Epinephelus bruneus PE=2 SV=1
 1252 : G1LIB7_AILME        0.33  0.49   29  171   24  146  144    7   22  247  G1LIB7     Uncharacterized protein OS=Ailuropoda melanoleuca GN=LOC100472031 PE=3 SV=1
 1253 : G1N1Z6_MELGA        0.33  0.47   29  172   30  162  148    6   19  267  G1N1Z6     Uncharacterized protein OS=Meleagris gallopavo GN=CTRC PE=3 SV=1
 1254 : G1NSS0_MYOLU        0.33  0.49   29  171   24  146  144    8   22  247  G1NSS0     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 1255 : G1NYX6_MYOLU        0.33  0.49   29  173  163  300  154    9   25  417  G1NYX6     Uncharacterized protein OS=Myotis lucifugus GN=HPN PE=3 SV=1
 1256 : G1Q0A5_MYOLU        0.33  0.47   29  171   25  151  144    6   18  256  G1Q0A5     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=TMPRSS11D PE=3 SV=1
 1257 : G1Q5V6_MYOLU        0.33  0.48   29  169   37  165  143    6   16  240  G1Q5V6     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 1258 : G1QBS0_MYOLU        0.33  0.48   29  169   34  162  143    6   16  239  G1QBS0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 1259 : G1QYQ7_NOMLE        0.33  0.52   29  172   34  163  144    6   14  263  G1QYQ7     Uncharacterized protein OS=Nomascus leucogenys GN=CTRL PE=3 SV=1
 1260 : G1R7T0_NOMLE        0.33  0.50   29  175   29  166  151    6   17  269  G1R7T0     Uncharacterized protein OS=Nomascus leucogenys GN=CELA2A PE=3 SV=1
 1261 : G1R7T1_NOMLE        0.33  0.49   29  175   29  166  152    7   19  269  G1R7T1     Uncharacterized protein OS=Nomascus leucogenys GN=CELA2B PE=3 SV=1
 1262 : G1S2G4_NOMLE        0.33  0.54   29  175   32  168  149    7   14  326  G1S2G4     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=LOC100593995 PE=3 SV=1
 1263 : G1SV25_RABIT        0.33  0.49   29  175   30  165  150    6   17  267  G1SV25     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100339575 PE=3 SV=1
 1264 : G1T0M4_RABIT        0.33  0.50   29  175   34  164  147    5   16  262  G1T0M4     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100342191 PE=3 SV=1
 1265 : G1T4I2_RABIT        0.33  0.53   29  175   41  172  150    6   21  296  G1T4I2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100351000 PE=3 SV=1
 1266 : G1TAR5_RABIT        0.33  0.47   29  172   56  189  151    7   24  294  G1TAR5     Uncharacterized protein OS=Oryctolagus cuniculus GN=CTRC PE=3 SV=2
 1267 : G1U414_RABIT        0.33  0.50   29  172   27  150  145    6   22  249  G1U414     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339353 PE=3 SV=1
 1268 : G1U7Y9_RABIT        0.33  0.54   29  173   34  163  146    6   17  263  G1U7Y9     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100341936 PE=3 SV=1
 1269 : G3GQP4_BOMHP        0.33  0.46   29  174  112  255  159   13   28  358  G3GQP4     Venom serine protease OS=Bombus hypocrita sapporensis GN=VSP PE=2 SV=1
 1270 : G3HU99_CRIGR        0.33  0.46   29  171   26  150  143    6   18  250  G3HU99     Trypsin-4 OS=Cricetulus griseus GN=I79_014507 PE=3 SV=1
 1271 : G3HUA0_CRIGR        0.33  0.47   29  171    6  130  144    7   20  230  G3HUA0     Trypsin-4 (Fragment) OS=Cricetulus griseus GN=I79_014508 PE=3 SV=1
 1272 : G3I2U2_CRIGR        0.33  0.55   29  175   28  164  150    7   16  302  G3I2U2     Transmembrane serine protease 8 OS=Cricetulus griseus GN=I79_017736 PE=3 SV=1
 1273 : G3I4P2_CRIGR        0.33  0.51   29  173   24  153  146    6   17  253  G3I4P2     Chymotrypsinogen B OS=Cricetulus griseus GN=I79_018425 PE=3 SV=1
 1274 : G3I4S0_CRIGR        0.33  0.54  179  278   19  110  102    5   12  112  G3I4S0     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_018453 PE=3 SV=1
 1275 : G3NFA5_GASAC        0.33  0.52   29  175   37  177  153    9   18  272  G3NFA5     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1276 : G3NFQ3_GASAC        0.33  0.53   29  175   64  209  155    9   17  321  G3NFQ3     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1277 : G3NGH2_GASAC        0.33  0.53   31  172    1  124  142    5   18  235  G3NGH2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1278 : G3NJS1_GASAC        0.33  0.48   29  175   21  147  149    8   24  243  G3NJS1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1279 : G3NXK1_GASAC        0.33  0.56   29  175   32  164  147    6   14  261  G3NXK1     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1280 : G3NXZ6_GASAC        0.33  0.54   29  175    9  144  150    5   17  248  G3NXZ6     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1281 : G3NYF7_GASAC        0.33  0.55   29  175   34  168  150    9   18  302  G3NYF7     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1282 : G3QK75_GORGO        0.33  0.52   29  171   24  160  147    7   14  261  G3QK75     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101146899 PE=3 SV=1
 1283 : G3R4Q1_GORGO        0.33  0.53   29  175   35  169  150    7   18  323  G3R4Q1     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101144935 PE=3 SV=1
 1284 : G3SJ88_GORGO        0.33  0.51   29  171   24  146  144    7   22  247  G3SJ88     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101146899 PE=3 SV=1
 1285 : G3SRR4_LOXAF        0.33  0.52   29  173   34  163  147    8   19  263  G3SRR4     Uncharacterized protein OS=Loxodonta africana GN=LOC100672744 PE=3 SV=1
 1286 : G3STI1_LOXAF        0.33  0.47   29  171   25  147  144    6   22  247  G3STI1     Uncharacterized protein OS=Loxodonta africana GN=LOC100670373 PE=3 SV=1
 1287 : G3THT9_LOXAF        0.33  0.54   29  175   50  182  150    6   20  286  G3THT9     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=PRSS42 PE=3 SV=1
 1288 : G3U765_LOXAF        0.33  0.53   29  175   10  146  148    7   12  254  G3U765     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=TMPRSS6 PE=3 SV=1
 1289 : G3V8J3_RAT          0.33  0.51   29  174   34  165  146    6   14  264  G3V8J3     Chymotrypsin-like, isoform CRA_a OS=Rattus norvegicus GN=Ctrl PE=3 SV=1
 1290 : G3VPC4_SARHA        0.33  0.59   29  175   38  173  150    8   17  276  G3VPC4     Uncharacterized protein OS=Sarcophilus harrisii PE=3 SV=1
 1291 : G3WF48_SARHA        0.33  0.50   29  170    3  130  145    6   20  270  G3WF48     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=3 SV=1
 1292 : G3WY11_SARHA        0.33  0.52   29  175  193  331  156    8   26  447  G3WY11     Uncharacterized protein OS=Sarcophilus harrisii GN=F7 PE=3 SV=1
 1293 : G3WY12_SARHA        0.33  0.52   29  175  193  331  156    8   26  434  G3WY12     Uncharacterized protein OS=Sarcophilus harrisii GN=F7 PE=3 SV=1
 1294 : G5AQC5_HETGA        0.33  0.54  177  278  132  237  111    6   14  248  G5AQC5     Serine protease 27 OS=Heterocephalus glaber GN=GW7_05010 PE=3 SV=1
 1295 : G5BRA1_HETGA        0.33  0.50   29  175   20  146  147    7   20  239  G5BRA1     Kallikrein-6 (Fragment) OS=Heterocephalus glaber GN=GW7_13268 PE=3 SV=1
 1296 : G5BXK2_HETGA        0.33  0.49   29  173  162  299  154    9   25  416  G5BXK2     Serine protease hepsin OS=Heterocephalus glaber GN=GW7_18385 PE=3 SV=1
 1297 : G5CV08_PLUXY        0.33  0.54  177  274  106  195  100    5   12  198  G5CV08     Trypsin-like serine proteinase 1 (Fragment) OS=Plutella xylostella PE=2 SV=1
 1298 : G5EA43_HUMAN        0.33  0.52  178  278   98  195  103    4    7  198  G5EA43     Transmembrane protease serine 5 OS=Homo sapiens GN=TMPRSS5 PE=3 SV=1
 1299 : G5EKV7_THUOR        0.33  0.50   29  151    1  108  123    3   15  175  G5EKV7     Trypsin (Fragment) OS=Thunnus orientalis GN=tryp PE=2 SV=1
 1300 : G5EMQ6_THUOR        0.33  0.51   29  170   34  160  146    8   23  263  G5EMQ6     Chymotrypsinogen 2 OS=Thunnus orientalis PE=2 SV=1
 1301 : G7MMZ4_MACMU        0.33  0.52   29  172   45  168  145    7   22  268  G7MMZ4     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_14258 PE=3 SV=1
 1302 : G7MS43_MACMU        0.33  0.52   29  175   43  174  150    8   21  341  G7MS43     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_16154 PE=3 SV=1
 1303 : G7NQR4_MACMU        0.33  0.51   30  172    1  138  149    7   17  245  G7NQR4     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_12331 PE=3 SV=1
 1304 : G7PX79_MACFA        0.33  0.49   29  173  163  300  154    9   25  417  G7PX79     Serine protease hepsin OS=Macaca fascicularis GN=EGM_09572 PE=3 SV=1
 1305 : G9K4Q5_MUSPF        0.33  0.49   29  173  179  316  154    9   25  430  G9K4Q5     Hepsin (Fragment) OS=Mustela putorius furo PE=2 SV=1
 1306 : G9KUC1_MUSPF        0.33  0.57  180  272   11   99   95    3    8  104  G9KUC1     Transmembrane protease, serine 4 (Fragment) OS=Mustela putorius furo PE=2 SV=1
 1307 : H0VWZ0_CAVPO        0.33  0.51   29  175   34  165  148    6   17  263  H0VWZ0     Uncharacterized protein OS=Cavia porcellus GN=LOC100721715 PE=3 SV=1
 1308 : H0W1M7_CAVPO        0.33  0.49   29  173  162  299  154    9   25  416  H0W1M7     Uncharacterized protein OS=Cavia porcellus GN=HPN PE=3 SV=1
 1309 : H0WMD5_OTOGA        0.33  0.49   29  173  163  300  154    9   25  417  H0WMD5     Uncharacterized protein OS=Otolemur garnettii GN=HPN PE=3 SV=1
 1310 : H0XB89_OTOGA        0.33  0.54   29  175   44  178  149    7   16  338  H0XB89     Uncharacterized protein OS=Otolemur garnettii GN=PRSS8 PE=3 SV=1
 1311 : H0XIX0_OTOGA        0.33  0.54  177  278  164  269  111    6   14  279  H0XIX0     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=PRSS27 PE=3 SV=1
 1312 : H0Y006_OTOGA        0.33  0.51   29  175   29  166  151    6   17  270  H0Y006     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
 1313 : H0Y0K2_OTOGA        0.33  0.52   29  175    8  144  147    6   10  276  H0Y0K2     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=3 SV=1
 1314 : H0YX74_TAEGU        0.33  0.49   29  170   10  143  144    6   12  245  H0YX74     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
 1315 : H0ZXF1_TAEGU        0.33  0.56   29  172  142  275  145    6   12  275  H0ZXF1     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
 1316 : H1A7C2_9ANNE        0.33  0.54   29  175   45  179  149    7   16  282  H1A7C2     Fibrinolytic enzyme OS=Enchytraeus japonensis GN=Ej-FEIII-2a PE=2 SV=1
 1317 : H2L3H5_ORYLA        0.33  0.51   29  175   22  156  150    7   18  285  H2L3H5     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=TMPRSS9 (2 of 16) PE=3 SV=1
 1318 : H2LI81_ORYLA        0.33  0.48   29  172   31  164  147    6   16  270  H2LI81     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101168538 PE=3 SV=1
 1319 : H2LQC6_ORYLA        0.33  0.54   29  175   34  169  150    8   17  307  H2LQC6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101157892 PE=3 SV=1
 1320 : H2LQW1_ORYLA        0.33  0.48   29  175  194  336  155    9   20  437  H2LQW1     Uncharacterized protein OS=Oryzias latipes GN=LOC101168986 PE=3 SV=1
 1321 : H2MX28_ORYLA        0.33  0.52   29  175   12  157  153    7   13  269  H2MX28     Uncharacterized protein OS=Oryzias latipes GN=LOC101161025 PE=3 SV=1
 1322 : H2MX77_ORYLA        0.33  0.56  177  277   75  172  103    3    7  174  H2MX77     Uncharacterized protein OS=Oryzias latipes PE=3 SV=1
 1323 : H2NPV2_PONAB        0.33  0.52   29  153   19  134  126    4   11  218  H2NPV2     Uncharacterized protein (Fragment) OS=Pongo abelii GN=PRSS27 PE=3 SV=1
 1324 : H2NYE5_PONAB        0.33  0.49   29  173  163  300  154    9   25  417  H2NYE5     Serine protease hepsin OS=Pongo abelii GN=HPN PE=3 SV=1
 1325 : H2PSN8_PONAB        0.33  0.54   29  153   35  152  126    3    9  184  H2PSN8     Uncharacterized protein (Fragment) OS=Pongo abelii GN=LOC100444260 PE=3 SV=1
 1326 : H2PY34_PANTR        0.33  0.50   29  175   29  166  151    6   17  269  H2PY34     Uncharacterized protein OS=Pan troglodytes GN=CELA2A PE=3 SV=1
 1327 : H2QAE0_PANTR        0.33  0.53   29  175   35  169  150    7   18  290  H2QAE0     Uncharacterized protein OS=Pan troglodytes GN=PRSS27 PE=3 SV=1
 1328 : H2QBD2_PANTR        0.33  0.51   29  174   34  165  146    6   14  264  H2QBD2     Uncharacterized protein OS=Pan troglodytes GN=CTRL PE=3 SV=1
 1329 : H2QG15_PANTR        0.33  0.49   29  173  163  300  154    9   25  417  H2QG15     Uncharacterized protein OS=Pan troglodytes GN=HPN PE=3 SV=1
 1330 : H2RLQ4_TAKRU        0.33  0.49   29  172   29  163  148    6   17  268  H2RLQ4     Uncharacterized protein OS=Takifugu rubripes GN=LOC101077973 PE=3 SV=1
 1331 : H2S855_TAKRU        0.33  0.49   29  172   22  147  144    5   18  247  H2S855     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071324 PE=3 SV=1
 1332 : H2S856_TAKRU        0.33  0.49   29  172   24  149  144    5   18  249  H2S856     Uncharacterized protein OS=Takifugu rubripes GN=LOC101071324 PE=3 SV=1
 1333 : H2SXX5_TAKRU        0.33  0.51   29  173  191  329  155   11   26  442  H2SXX5     Uncharacterized protein OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
 1334 : H2T7E7_TAKRU        0.33  0.53   29  175   33  166  150    9   19  289  H2T7E7     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
 1335 : H2T7E8_TAKRU        0.33  0.53   29  175   35  168  150    9   19  292  H2T7E8     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
 1336 : H2UJ45_TAKRU        0.33  0.54   29  171  105  241  149    8   18  349  H2UJ45     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068458 PE=3 SV=1
 1337 : H2UJF8_TAKRU        0.33  0.49   29  172   52  187  149    8   18  284  H2UJF8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074028 PE=3 SV=1
 1338 : H2UJF9_TAKRU        0.33  0.49   29  172   33  168  149    9   18  274  H2UJF9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074028 PE=3 SV=1
 1339 : H2UK69_TAKRU        0.33  0.43   29  172   28  159  147    7   18  265  H2UK69     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074248 PE=3 SV=1
 1340 : H2VAI5_TAKRU        0.33  0.52   29  175   64  209  155    9   17  321  H2VAI5     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066013 PE=3 SV=1
 1341 : H2VAI7_TAKRU        0.33  0.51   29  175   34  179  153    7   13  287  H2VAI7     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066013 PE=3 SV=1
 1342 : H2VAI8_TAKRU        0.33  0.51   29  175   31  176  153    7   13  284  H2VAI8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066013 PE=3 SV=1
 1343 : H2VAI9_TAKRU        0.33  0.51   29  175   30  173  151    6   11  281  H2VAI9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066013 PE=3 SV=1
 1344 : H2VAJ2_TAKRU        0.33  0.53   29  175   35  175  150    7   12  277  H2VAJ2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066013 PE=3 SV=1
 1345 : H3AZD2_LATCH        0.33  0.51   29  175   31  165  151    9   20  311  H3AZD2     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1346 : H3BXE3_TETNG        0.33  0.59   29  175    4  136  148    6   16  238  H3BXE3     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1347 : H3CMW6_TETNG        0.33  0.52   29  175   60  205  155    9   17  317  H3CMW6     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1348 : H3CT69_TETNG        0.33  0.52   29  175   56  201  155    9   17  313  H3CT69     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
 1349 : H3CWC2_TETNG        0.33  0.48   29  175   38  164  149    8   24  260  H3CWC2     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1350 : H3DCM2_TETNG        0.33  0.58   29  175   14  151  150    6   15  287  H3DCM2     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=TMPRSS9 (5 of 6) PE=3 SV=1
 1351 : H3DM98_TETNG        0.33  0.55   29  175   34  166  147    4   14  265  H3DM98     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
 1352 : H3K3Y6_CTEID        0.33  0.53   29  171   21  143  144    7   22  242  H3K3Y6     Trypsin OS=Ctenopharyngodon idella GN=trp PE=2 SV=1
 1353 : H7CEI2_THUOR        0.33  0.51   29  170   34  160  146    8   23  263  H7CEI2     Chymotrypsin OS=Thunnus orientalis GN=chytryp PE=2 SV=1
 1354 : H9F7G7_MACMU        0.33  0.49   29  173  159  296  154    9   25  413  H9F7G7     Serine protease hepsin (Fragment) OS=Macaca mulatta GN=HPN PE=2 SV=1
 1355 : H9GDA9_ANOCA        0.33  0.48   29  171   25  147  144    8   22  247  H9GDA9     Uncharacterized protein OS=Anolis carolinensis GN=LOC100565603 PE=3 SV=1
 1356 : H9H3N1_MACMU        0.33  0.53   29  174   29  165  150    6   17  273  H9H3N1     Uncharacterized protein OS=Macaca mulatta GN=LOC721460 PE=3 SV=1
 1357 : H9J268_BOMMO        0.33  0.56  182  273    7   91   93    3    9   94  H9J268     Uncharacterized protein (Fragment) OS=Bombyx mori GN=Bmo.6722 PE=3 SV=1
 1358 : H9J6N0_BOMMO        0.33  0.49  178  278  123  225  108    7   12  225  H9J6N0     Uncharacterized protein (Fragment) OS=Bombyx mori PE=3 SV=1
 1359 : HEPS_HUMAN  1Z8G    0.33  0.49   29  173  163  300  154    9   25  417  P05981     Serine protease hepsin OS=Homo sapiens GN=HPN PE=1 SV=1
 1360 : HEPS_PONAB          0.33  0.49   29  173  163  300  154    9   25  417  Q5R5E8     Serine protease hepsin OS=Pongo abelii GN=HPN PE=2 SV=1
 1361 : I3J1A8_ORENI        0.33  0.46   29  172   28  160  148    6   19  266  I3J1A8     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100695916 PE=3 SV=1
 1362 : I3J3P6_ORENI        0.33  0.54   29  175  539  678  160   11   33  778  I3J3P6     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=ST14 (3 of 5) PE=3 SV=1
 1363 : I3J5D4_ORENI        0.33  0.52   29  170   31  159  142    5   13  262  I3J5D4     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=3 SV=1
 1364 : I3J5D5_ORENI        0.33  0.51  177  277   70  163  102    6    9  165  I3J5D5     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=3 SV=1
 1365 : I3J5D6_ORENI        0.33  0.52   29  170   39  167  142    5   13  259  I3J5D6     Uncharacterized protein OS=Oreochromis niloticus PE=3 SV=1
 1366 : I3JIR5_ORENI        0.33  0.55   29  170   25  153  145    9   19  262  I3JIR5     Uncharacterized protein OS=Oreochromis niloticus GN=TMPRSS9 (2 of 18) PE=3 SV=1
 1367 : I3JJX2_ORENI        0.33  0.48   29  172  162  298  157   10   33  418  I3JJX2     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=TMPRSS11E PE=3 SV=1
 1368 : I3JMK4_ORENI        0.33  0.52   29  175   64  209  155    9   17  321  I3JMK4     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100697449 PE=3 SV=1
 1369 : I3K1H4_ORENI        0.33  0.53   38  170    1  120  133    5   13  250  I3K1H4     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=TMPRSS9 (16 of 18) PE=3 SV=1
 1370 : I3LCF8_PIG          0.33  0.50   29  174   37  168  146    6   14  267  I3LCF8     Uncharacterized protein (Fragment) OS=Sus scrofa GN=CTRL PE=3 SV=1
 1371 : I3MY60_SPETR        0.33  0.49   29  173  163  300  154    9   25  416  I3MY60     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=HPN PE=3 SV=1
 1372 : I3N073_SPETR        0.33  0.50   29  174   31  171  152    7   17  283  I3N073     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
 1373 : I3NDD1_SPETR        0.33  0.52   30  174    8  133  147    8   23  240  I3NDD1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=KLK15 PE=3 SV=1
 1374 : I4DNX2_PAPXU        0.33  0.53  177  276   46  150  108    5   11  155  I4DNX2     Serine protease (Fragment) OS=Papilio xuthus PE=2 SV=1
 1375 : J9JXB2_ACYPI        0.33  0.50   29  172   51  180  147    7   20  290  J9JXB2     Uncharacterized protein OS=Acyrthosiphon pisum PE=3 SV=1
 1376 : K7E503_MONDO        0.33  0.56  177  278   44  149  111    6   14  186  K7E503     Uncharacterized protein OS=Monodelphis domestica PE=3 SV=1
 1377 : K9J7U7_XENTR        0.33  0.56   29  173   57  188  147    7   17  297  K9J7U7     Uncharacterized protein OS=Xenopus tropicalis GN=tpsg1 PE=3 SV=1
 1378 : KLK3_RAT            0.33  0.54  179  278   95  186  101    4   10  188  P15950     Glandular kallikrein-3, submandibular (Fragment) OS=Rattus norvegicus GN=Klk3 PE=2 SV=2
 1379 : L5KSY2_PTEAL        0.33  0.51   29  174   38  169  146    6   14  268  L5KSY2     Chymotrypsin-like protease CTRL-1 OS=Pteropus alecto GN=PAL_GLEAN10016250 PE=3 SV=1
 1380 : L8J5P5_9CETA        0.33  0.50  177  278  130  235  111    6   14  267  L8J5P5     Serine protease 27 (Fragment) OS=Bos mutus GN=M91_18801 PE=3 SV=1
 1381 : L8Y0E2_TUPCH        0.33  0.48   29  175   64  206  150    6   10  338  L8Y0E2     Serine protease 42 OS=Tupaia chinensis GN=TREES_T100002385 PE=3 SV=1
 1382 : L9L0Y1_TUPCH        0.33  0.51   29  171   25  147  144    7   22  247  L9L0Y1     Cationic trypsin-3 OS=Tupaia chinensis GN=TREES_T100005090 PE=3 SV=1
 1383 : L9L2C2_TUPCH        0.33  0.50   29  171   25  147  144    8   22  243  L9L2C2     Anionic trypsin OS=Tupaia chinensis GN=TREES_T100005221 PE=3 SV=1
 1384 : M0RA46_RAT          0.33  0.50   29  174   32  165  151    7   22  322  M0RA46     Serine protease 27 OS=Rattus norvegicus GN=Prss27 PE=3 SV=1
 1385 : M0RAL3_RAT          0.33  0.52   29  175   54  190  150    7   16  334  M0RAL3     Protein Prss32 OS=Rattus norvegicus GN=Prss32 PE=3 SV=1
 1386 : M3VY57_FELCA        0.33  0.53   29  175    2  137  147    4   11  256  M3VY57     Uncharacterized protein (Fragment) OS=Felis catus GN=OVCH2 PE=3 SV=1
 1387 : M3WAE4_FELCA        0.33  0.49   29  173  176  313  154    9   25  430  M3WAE4     Uncharacterized protein (Fragment) OS=Felis catus GN=HPN PE=3 SV=1
 1388 : M3Y743_MUSPF        0.33  0.49   29  173  172  309  154    9   25  431  M3Y743     Uncharacterized protein (Fragment) OS=Mustela putorius furo GN=HPN PE=3 SV=1
 1389 : M3Z163_MUSPF        0.33  0.48   29  175  701  846  160   12   27  945  M3Z163     Uncharacterized protein OS=Mustela putorius furo GN=PRSS12 PE=3 SV=1
 1390 : M3ZZG9_XIPMA        0.33  0.52   29  173   17  146  146    6   17  281  M3ZZG9     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=TMPRSS9 (2 of 7) PE=3 SV=1
 1391 : M4A7Z5_XIPMA        0.33  0.53   29  175   32  164  147    6   14  261  M4A7Z5     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 1392 : M4Y7Q4_CERLA        0.33  0.55   29  175   31  178  155    9   15  284  M4Y7Q4     Chymotrypsin-like elastase family member (Fragment) OS=Cerebratulus lacteus PE=2 SV=1
 1393 : N6TT29_DENPD        0.33  0.50  178  277   96  196  106    7   11  197  N6TT29     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=YQE_00031 PE=3 SV=1
 1394 : O42272_XENLA        0.33  0.50   29  175   30  164  150    9   18  329  O42272     Serine protease OS=Xenopus laevis GN=prss8 PE=2 SV=1
 1395 : PRS27_HUMAN         0.33  0.53   29  175   35  169  150    7   18  290  Q9BQR3     Serine protease 27 OS=Homo sapiens GN=PRSS27 PE=1 SV=1
 1396 : Q0Q605_GRYFI        0.33  0.54   29  175   79  216  153    9   21  323  Q0Q605     Hypothetical accessory gland protein (Fragment) OS=Gryllus firmus GN=AG-0308F PE=2 SV=1
 1397 : Q17036_ANOGA        0.33  0.54   29  175   10  143  149    7   17  250  Q17036     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
 1398 : Q32PT2_DANRE        0.33  0.55   29  175   37  172  152    7   21  326  Q32PT2     Zgc:123217 OS=Danio rerio GN=zgc:123217 PE=2 SV=1
 1399 : Q3B898_XENLA        0.33  0.49   29  172   30  153  146    7   24  252  Q3B898     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
 1400 : Q3UEP7_MOUSE        0.33  0.52   29  175   87  222  149    7   15  328  Q3UEP7     Putative uncharacterized protein OS=Mus musculus GN=Masp2 PE=2 SV=1
 1401 : Q4KLE1_XENLA        0.33  0.51   29  175   81  215  154    9   26  357  Q4KLE1     Xesp-1 protein (Fragment) OS=Xenopus laevis GN=Xesp-1 PE=2 SV=1
 1402 : Q4QR60_XENLA        0.33  0.49   29  172   33  156  146    7   24  255  Q4QR60     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
 1403 : Q4QRF8_DANRE        0.33  0.47   29  172   29  161  147    6   17  267  Q4QRF8     Elastase 2 like OS=Danio rerio GN=ela2l PE=2 SV=1
 1404 : Q4QY80_SPAAU        0.33  0.45   29  172   28  160  148    6   19  266  Q4QY80     Elastase 4-like protein (Fragment) OS=Sparus aurata PE=2 SV=1
 1405 : Q4RHR8_TETNG        0.33  0.55   29  175   32  164  147    4   14  261  Q4RHR8     Chromosome 8 SCAF15044, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00034204001 PE=3 SV=1
 1406 : Q4SL79_TETNG        0.33  0.52   29  175   67  212  155    9   17  324  Q4SL79     Chromosome undetermined SCAF14558, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00016377001 PE=3 SV=1
 1407 : Q4ST88_TETNG        0.33  0.52   29  175   68  213  155    9   17  325  Q4ST88     Chromosome undetermined SCAF14269, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00013062001 PE=3 SV=1
 1408 : Q53CG5_DANRE        0.33  0.51   29  175   29  167  152    7   18  270  Q53CG5     Elastase A OS=Danio rerio GN=ela3l PE=2 SV=1
 1409 : Q54AE4_MOUSE        0.33  0.54   29  175   55  192  151    9   17  324  Q54AE4     ESP-1 OS=Mus musculus GN=Prss21 PE=2 SV=1
 1410 : Q561U9_DANRE        0.33  0.47   29  172   29  161  147    6   17  267  Q561U9     Elastase 2 like OS=Danio rerio GN=ela2l PE=2 SV=1
 1411 : Q5BKG0_XENTR        0.33  0.47   29  175   27  164  150    6   15  267  Q5BKG0     Ela2 protein (Fragment) OS=Xenopus tropicalis GN=Ela2 PE=2 SV=1
 1412 : Q5BSE6_SCHJA        0.33  0.54  179  277   36  139  109    5   15  143  Q5BSE6     SJCHGC04731 protein (Fragment) OS=Schistosoma japonicum PE=2 SV=2
 1413 : Q5FVY7_XENTR        0.33  0.56   29  173   56  187  147    7   17  296  Q5FVY7     Mpn-prov protein (Fragment) OS=Xenopus tropicalis GN=mpn-prov PE=2 SV=1
 1414 : Q5H729_MACMU        0.33  0.48   29  171   24  146  144    7   22  247  Q5H729     Try14 OS=Macaca mulatta GN=try14 PE=3 SV=1
 1415 : Q5HZD0_XENTR        0.33  0.51   29  175   34  165  151    7   23  263  Q5HZD0     Chymotrypsinogen B1 OS=Xenopus tropicalis GN=ctrl PE=2 SV=1
 1416 : Q640F8_XENLA        0.33  0.51   29  175   68  202  154    9   26  344  Q640F8     Xesp-1 protein (Fragment) OS=Xenopus laevis GN=Xesp-1 PE=2 SV=1
 1417 : Q642S8_XENTR        0.33  0.52   29  172   29  162  151    7   24  268  Q642S8     MGC79767 protein OS=Xenopus tropicalis GN=ctrc PE=2 SV=1
 1418 : Q66PG9_TAKRU        0.33  0.49   29  172   22  147  144    5   18  247  Q66PG9     Trypsinogen OS=Takifugu rubripes PE=3 SV=1
 1419 : Q68DS2_HUMAN        0.33  0.56  179  278  113  209  102    4    7  210  Q68DS2     Putative uncharacterized protein DKFZp779M0222 (Fragment) OS=Homo sapiens GN=DKFZp779M0222 PE=2 SV=1
 1420 : Q6GNU2_XENLA        0.33  0.49   29  172   33  156  146    7   24  255  Q6GNU2     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
 1421 : Q6ISP9_HUMAN        0.33  0.50   29  175   29  166  153    7   21  269  Q6ISP9     Elastase 2B OS=Homo sapiens GN=ELA2B PE=2 SV=1
 1422 : Q792Y6_MOUSE        0.33  0.52   29  171   24  146  145    8   24  246  Q792Y6     MCG4990, isoform CRA_e OS=Mus musculus GN=Prss2 PE=2 SV=1
 1423 : Q7PZ90_ANOGA        0.33  0.58  182  278   41  141  105    5   12  154  Q7PZ90     AGAP011794-PA OS=Anopheles gambiae GN=AGAP011794 PE=3 SV=3
 1424 : Q7SX97_DANRE        0.33  0.50   29  170   34  160  146    7   23  263  Q7SX97     Chymotrypsinogen B1 OS=Danio rerio GN=ctrb1 PE=2 SV=1
 1425 : Q7SZ51_DANRE        0.33  0.47   29  172   29  161  147    6   17  267  Q7SZ51     Elastase 2 like OS=Danio rerio GN=ela2l PE=2 SV=1
 1426 : Q7SZT1_XENLA        0.33  0.49   29  172   26  149  146    7   24  248  Q7SZT1     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
 1427 : Q7TT42_MOUSE        0.33  0.47   29  171   24  146  143    5   20  246  Q7TT42     Trypsinogen 5 OS=Mus musculus GN=trypsinogen PE=3 SV=1
 1428 : Q7Z5F3_HUMAN        0.33  0.51   29  171   38  160  145    8   24  261  Q7Z5F3     Protease serine 2 isoform B OS=Homo sapiens PE=2 SV=1
 1429 : Q80X17_MOUSE        0.33  0.54   29  175   54  190  150    6   16  331  Q80X17     Protease, serine, 32, isoform CRA_a OS=Mus musculus GN=Prss32 PE=2 SV=1
 1430 : Q80YD8_MOUSE        0.33  0.54   29  175   67  204  151    9   17  336  Q80YD8     Prss21 protein (Fragment) OS=Mus musculus GN=Prss21 PE=2 SV=1
 1431 : Q80Z40_RAT          0.33  0.56   29  175   58  195  151    9   17  328  Q80Z40     Eosinophil serine protease-1 OS=Rattus norvegicus GN=Prss21 PE=2 SV=1
 1432 : Q8R1A6_MOUSE        0.33  0.54   29  175   54  190  150    6   16  331  Q8R1A6     Protease, serine, 32 OS=Mus musculus GN=Prss32 PE=2 SV=1
 1433 : Q9EQZ8_RAT          0.33  0.51   29  174   34  165  146    6   14  264  Q9EQZ8     Chymopasin OS=Rattus norvegicus GN=Ctrl PE=2 SV=1
 1434 : Q9GSN1_CHRBE        0.33  0.48   37  156    1  107  120    2   13  181  Q9GSN1     Serine protease K2.1/F1R1 (Fragment) OS=Chrysomya bezziana PE=2 SV=1
 1435 : Q9VRS6_DROME        0.33  0.45   29  175   38  173  150    7   17  271  Q9VRS6     Jonah 65Aiv OS=Drosophila melanogaster GN=Jon65Aiv PE=2 SV=1
 1436 : Q9VXP8_DROME        0.33  0.58   29  170   38  165  144    7   18  276  Q9VXP8     CG8952 OS=Drosophila melanogaster GN=CG8952 PE=3 SV=1
 1437 : Q9W7P9_PAROL        0.33  0.46   29  172   23  154  148    7   20  260  Q9W7P9     Elastase 4 (Fragment) OS=Paralichthys olivaceus PE=2 SV=1
 1438 : Q9XY59_CTEFE        0.33  0.53  177  277  140  239  108    5   15  242  Q9XY59     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-40 PE=2 SV=1
 1439 : R0J6L0_ANAPL        0.33  0.54   29  150    5  121  124    2    9  122  R0J6L0     Serine protease 27 (Fragment) OS=Anas platyrhynchos GN=Anapl_19082 PE=3 SV=1
 1440 : R0KWP6_ANAPL        0.33  0.49   29  171    9  131  144    8   22  231  R0KWP6     Trypsin I-P1 (Fragment) OS=Anas platyrhynchos GN=Anapl_18720 PE=3 SV=1
 1441 : R0L328_ANAPL        0.33  0.54   29  175   12  152  151    7   14  247  R0L328     Suppressor of tumorigenicity protein 14 (Fragment) OS=Anas platyrhynchos GN=Anapl_13401 PE=3 SV=1
 1442 : R4G2I2_9SAUR        0.33  0.54  179  277   47  137  101    6   12  145  R4G2I2     SP-Hop-3 (Fragment) OS=Hoplocephalus bungaroides PE=2 SV=1
 1443 : R7UBH3_CAPTE        0.33  0.50   29  175   45  181  149    5   14  284  R7UBH3     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_153798 PE=3 SV=1
 1444 : S4RLL3_PETMA        0.33  0.52   29  171   16  146  144    6   14  249  S4RLL3     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
 1445 : S4RVB8_PETMA        0.33  0.49   29  175   24  154  149    8   20  263  S4RVB8     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
 1446 : S4RXT8_PETMA        0.33  0.50   29  175   41  173  148    7   16  273  S4RXT8     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (7 of 11) PE=3 SV=1
 1447 : S5TM67_SOLSO        0.33  0.57  177  278  121  213  102    3    9  214  S5TM67     Trypsinogen 1 (Fragment) OS=Solea solea GN=tryp1 PE=2 SV=1
 1448 : S7MN18_MYOBR        0.33  0.49   29  171   24  146  144    7   22  247  S7MN18     Anionic trypsin OS=Myotis brandtii GN=D623_10026158 PE=3 SV=1
 1449 : S7MXZ2_MYOBR        0.33  0.51  177  278   75  176  109    7   14  202  S7MXZ2     Serine protease 42 OS=Myotis brandtii GN=D623_10006851 PE=3 SV=1
 1450 : S7N0Y7_MYOBR        0.33  0.51   29  174    5  138  149    7   18  293  S7N0Y7     Serine protease 27 OS=Myotis brandtii GN=D623_10005643 PE=3 SV=1
 1451 : S9YYA1_9CETA        0.33  0.54  177  278   91  194  111    5   16  196  S9YYA1     Tryptase beta-2 OS=Camelus ferus GN=CB1_000144001 PE=3 SV=1
 1452 : T1ID92_RHOPR        0.33  0.50   29  175    1  133  147    4   14  234  T1ID92     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
 1453 : T1IEV3_RHOPR        0.33  0.55   29  170    9  137  144    6   17  241  T1IEV3     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
 1454 : T1JSB2_TETUR        0.33  0.52   29  175   66  196  150    7   22  298  T1JSB2     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 1455 : T1L085_TETUR        0.33  0.50   29  174   48  184  151    8   19  290  T1L085     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 1456 : T1PKM5_MUSDO        0.33  0.53  177  277   47  140  103    3   11  141  T1PKM5     Trypsin OS=Musca domestica PE=2 SV=1
 1457 : TEST_MOUSE          0.33  0.54   29  175   55  192  151    9   17  324  Q9JHJ7     Testisin OS=Mus musculus GN=Prss21 PE=2 SV=2
 1458 : TRY2_CANFA          0.33  0.50   29  171   24  146  145    8   24  247  P06872     Anionic trypsin OS=Canis familiaris PE=2 SV=1
 1459 : TRY2_MOUSE          0.33  0.52   29  171   24  146  145    8   24  246  P07146     Anionic trypsin-2 OS=Mus musculus GN=Prss2 PE=2 SV=1
 1460 : U2YQ11_9RHOB        0.33  0.53  177  278   62  160  104    4    7  165  U2YQ11     Trypsin OS=Loktanella cinnabarina LL-001 GN=MBE-LCI_3548 PE=3 SV=1
 1461 : U3B7D1_CALJA        0.33  0.49   29  173  163  300  154    9   25  417  U3B7D1     Serine protease hepsin OS=Callithrix jacchus GN=HPN PE=2 SV=1
 1462 : U3IGY4_ANAPL        0.33  0.54   29  150    5  121  124    2    9  121  U3IGY4     Uncharacterized protein (Fragment) OS=Anas platyrhynchos PE=3 SV=1
 1463 : U3JV07_FICAL        0.33  0.51   29  175   90  230  152    9   16  328  U3JV07     Uncharacterized protein (Fragment) OS=Ficedula albicollis PE=3 SV=1
 1464 : U6DMY4_NEOVI        0.33  0.55  180  278   95  194  106    6   13  220  U6DMY4     Serine protease 42 (Fragment) OS=Neovison vison GN=PRS42 PE=2 SV=1
 1465 : U6I308_HYMMI        0.33  0.51   29  175  149  314  170    8   27  448  U6I308     Mastin OS=Hymenolepis microstoma GN=HmN_000595000 PE=3 SV=1
 1466 : V5IGL3_IXORI        0.33  0.55  177  278   51  150  105    4    8  159  V5IGL3     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
 1467 : V9LLV1_VIBCL        0.33  0.57  177  274   91  189  106    5   15  226  V9LLV1     Protease VC1649 (Fragment) OS=Vibrio cholerae non-O1/non-O139 GN=vc1649 PE=3 SV=1
 1468 : V9QHE7_HUMAN        0.33  0.54   29  172    1  134  144    4   10  235  V9QHE7     Enterokinase catalytic subunit (Fragment) OS=Homo sapiens PE=2 SV=1
 1469 : W4WEN7_ATTCE        0.33  0.54  180  277   23  121  105    4   13  122  W4WEN7     Uncharacterized protein OS=Atta cephalotes PE=3 SV=1
 1470 : W4WTK2_ATTCE        0.33  0.52  179  278    3   97  100    2    5  103  W4WTK2     Uncharacterized protein OS=Atta cephalotes PE=3 SV=1
 1471 : W5K151_ASTMX        0.33  0.52   29  172   24  149  144    6   18  249  W5K151     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=3 SV=1
 1472 : W5L0N0_ASTMX        0.33  0.56   29  175   34  167  149    7   17  278  W5L0N0     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1473 : W5LXL0_LEPOC        0.33  0.53   30  174   33  165  150    7   22  285  W5LXL0     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 1474 : W5M773_LEPOC        0.33  0.52   29  174   28  169  151    7   14  272  W5M773     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 1475 : W5M790_LEPOC        0.33  0.51   29  174   37  178  152    6   16  281  W5M790     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 1476 : W5MLG1_LEPOC        0.33  0.51   29  175  220  359  156   11   25  468  W5MLG1     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus GN=C1S (3 of 4) PE=3 SV=1
 1477 : W5P9B8_SHEEP        0.33  0.51   29  170   34  160  144    7   19  263  W5P9B8     Uncharacterized protein OS=Ovis aries GN=LOC101116501 PE=3 SV=1
 1478 : W5PAR6_SHEEP        0.33  0.55   29  174   76  206  150    8   23  339  W5PAR6     Uncharacterized protein OS=Ovis aries GN=PRSS42 PE=3 SV=1
 1479 : W5PJA2_SHEEP        0.33  0.49   29  175   29  166  151    6   17  269  W5PJA2     Uncharacterized protein OS=Ovis aries GN=CELA2A PE=3 SV=1
 1480 : W5Q1Y9_SHEEP        0.33  0.50   29  175   24  150  148    6   22  246  W5Q1Y9     Uncharacterized protein OS=Ovis aries GN=LOC101111795 PE=3 SV=1
 1481 : W5Q219_SHEEP        0.33  0.50   29  175   30  156  148    6   22  252  W5Q219     Uncharacterized protein (Fragment) OS=Ovis aries PE=3 SV=1
 1482 : A0NDR4_ANOGA        0.32  0.51   29  174   51  181  148    8   19  296  A0NDR4     AGAP004569-PA OS=Anopheles gambiae GN=AgaP_AGAP004569 PE=3 SV=3
 1483 : A1A508_HUMAN        0.32  0.49   29  175   24  150  148    7   22  247  A1A508     PRSS3 protein OS=Homo sapiens GN=PRSS3 PE=2 SV=1
 1484 : A1L5C6_BOVIN        0.32  0.48   29  173  163  300  154    9   25  417  A1L5C6     HPN protein OS=Bos taurus GN=HPN PE=2 SV=1
 1485 : A1Z090_MOUSE        0.32  0.52   29  175   29  164  151    8   19  273  A1Z090     Mast cell-restricted serine protease 7 OS=Mus musculus GN=Tpsab1 PE=3 SV=1
 1486 : A2JDL7_CHICK        0.32  0.47   29  172   26  149  146    7   24  248  A2JDL7     Trypsinogen OS=Gallus gallus PE=3 SV=1
 1487 : A2VD37_DANRE        0.32  0.52   29  170   34  160  146    7   23  263  A2VD37     Similar to chymotrypsinogen B1 OS=Danio rerio GN=LOC562139 PE=2 SV=1
 1488 : A4FSF0_9INSE        0.32  0.51   29  174    3  141  150    4   15  148  A4FSF0     Putative uncharacterized protein (Fragment) OS=Thermobia domestica PE=2 SV=1
 1489 : A4ZX98_MYXAS        0.32  0.53   29  175   24  150  148    6   22  246  A4ZX98     Trypsin OS=Myxocyprinus asiaticus PE=2 SV=1
 1490 : A5PJB8_BOVIN        0.32  0.51   29  173   34  163  146    6   17  263  A5PJB8     CTRB1 protein OS=Bos taurus GN=CTRB1 PE=2 SV=1
 1491 : A7RGS8_NEMVE        0.32  0.45   29  175   32  172  150    7   12  271  A7RGS8     Predicted protein OS=Nematostella vectensis GN=v1g227960 PE=3 SV=1
 1492 : A7RKX5_NEMVE        0.32  0.51   29  175    2  141  147    3    7  240  A7RKX5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85362 PE=3 SV=1
 1493 : A7RLC0_NEMVE        0.32  0.51   29  175   10  156  152    8   10  259  A7RLC0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85993 PE=3 SV=1
 1494 : A7RU68_NEMVE        0.32  0.57   29  175   11  153  150    5   10  254  A7RU68     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g93430 PE=3 SV=1
 1495 : A7S0L7_NEMVE        0.32  0.57   29  172    1  133  145    5   13  252  A7S0L7     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g99932 PE=3 SV=1
 1496 : A7S5Y0_NEMVE        0.32  0.52   29  175    2  136  148    6   14  249  A7S5Y0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g105779 PE=3 SV=1
 1497 : A7S9G1_NEMVE        0.32  0.53   29  171    1  138  146    6   11  245  A7S9G1     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109826 PE=3 SV=1
 1498 : A7S9K4_NEMVE        0.32  0.50   29  172    1  133  145    5   13  235  A7S9K4     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g110126 PE=3 SV=1
 1499 : A7SQF1_NEMVE        0.32  0.53   29  171   16  151  146    8   13  255  A7SQF1     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127465 PE=3 SV=1
 1500 : A7SZF8_NEMVE        0.32  0.52   29  175   11  145  147    6   12  243  A7SZF8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g2158 PE=3 SV=1
 1501 : A7VMR6_SOLSE        0.32  0.50   29  175   21  147  149    7   24  242  A7VMR6     Trypsinogen 1c OS=Solea senegalensis GN=TRP1c PE=2 SV=1
 1502 : A7YWU9_BOVIN        0.32  0.48   29  171   24  146  145    8   24  247  A7YWU9     PRSS2 protein OS=Bos taurus GN=PRSS2 PE=2 SV=1
 1503 : A8CYP1_9ORTH        0.32  0.51   29  175   49  179  148    6   18  290  A8CYP1     Chymotrypsin OS=Teleogryllus emma PE=2 SV=1
 1504 : A9JSU0_DANRE        0.32  0.51   29  175   21  147  148    8   22  240  A9JSU0     Zgc:171509 protein OS=Danio rerio GN=zgc:171509 PE=2 SV=1
 1505 : B0F9T3_TRISP        0.32  0.51   29  145   38  160  125    4   10  193  B0F9T3     Putative serine protease (Fragment) OS=Trichinella spiralis PE=2 SV=1
 1506 : B0JYS9_XENTR        0.32  0.53   29  175   58  192  148    6   14  334  B0JYS9     Uncharacterized protein OS=Xenopus tropicalis GN=LOC548809 PE=2 SV=1
 1507 : B0LM31_TUPGL        0.32  0.52   29  170   16  156  148    9   13  274  B0LM31     Acrosin (Fragment) OS=Tupaia glis GN=ACR PE=3 SV=1
 1508 : B0W9A8_CULQU        0.32  0.51   29  174   26  170  154    7   17  282  B0W9A8     Serine protease OS=Culex quinquefasciatus GN=CpipJ_CPIJ003719 PE=3 SV=1
 1509 : B0W9S9_CULQU        0.32  0.53   29  175   48  182  149    6   16  283  B0W9S9     Serine protease1/2 OS=Culex quinquefasciatus GN=CpipJ_CPIJ003826 PE=3 SV=1
 1510 : B0WD46_CULQU        0.32  0.49   29  174   25  159  148    5   15  260  B0WD46     Chymotrypsin BII OS=Culex quinquefasciatus GN=CpipJ_CPIJ004989 PE=3 SV=1
 1511 : B0WW48_CULQU        0.32  0.48   29  173   39  166  147    6   21  266  B0WW48     Chymotrypsin 1 OS=Culex quinquefasciatus GN=CpipJ_CPIJ011382 PE=3 SV=1
 1512 : B0XFN7_CULQU        0.32  0.46   29  170   62  193  148    7   22  320  B0XFN7     Trypsin II-P29 OS=Culex quinquefasciatus GN=CpipJ_CPIJ018035 PE=3 SV=1
 1513 : B1AN99_HUMAN        0.32  0.47   29  156   36  148  128    3   15  177  B1AN99     Trypsin-3 (Fragment) OS=Homo sapiens GN=PRSS3 PE=2 SV=2
 1514 : B2G0N7_ANOGA        0.32  0.51   29  154   15  129  126    4   11  192  B2G0N7     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 1515 : B2ZA47_CTEID        0.32  0.49   29  175   29  166  152    7   19  269  B2ZA47     Pancreatic elastase OS=Ctenopharyngodon idella GN=Ela2 PE=2 SV=1
 1516 : B3GEG3_SINCH        0.32  0.54   29  175   21  147  149    8   24  242  B3GEG3     Trypsinogen 1 OS=Siniperca chuatsi GN=TRS-A PE=2 SV=1
 1517 : B3IYE4_9PERC        0.32  0.49   29  175   21  147  149    7   24  242  B3IYE4     Trypsin OS=Pleurogrammus azonus PE=2 SV=2
 1518 : B3MI94_DROAN        0.32  0.52   29  172    7  142  149    8   18  250  B3MI94     GF12723 OS=Drosophila ananassae GN=Dana\GF12723 PE=3 SV=1
 1519 : B3MX80_DROAN        0.32  0.51   29  175   42  161  148    6   29  281  B3MX80     GF11464 OS=Drosophila ananassae GN=Dana\GF11464 PE=3 SV=1
 1520 : B3N830_DROER        0.32  0.52   29  172    7  142  149    8   18  250  B3N830     GG10599 OS=Drosophila erecta GN=Dere\GG10599 PE=3 SV=1
 1521 : B3NCC4_DROER        0.32  0.46   29  175   38  173  150    7   17  270  B3NCC4     GG15307 OS=Drosophila erecta GN=Dere\GG15307 PE=3 SV=1
 1522 : B3RY71_TRIAD        0.32  0.53   29  172    2  130  144    5   15  238  B3RY71     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25686 PE=3 SV=1
 1523 : B3Y604_TRIHK        0.32  0.52   29  175   21  147  148    8   22  242  B3Y604     Trypsin OS=Tribolodon hakonensis PE=2 SV=2
 1524 : B4G4X4_DROPE        0.32  0.45   29  172   69  205  152    8   23  316  B4G4X4     GL24254 OS=Drosophila persimilis GN=Dper\GL24254 PE=3 SV=1
 1525 : B4H6E2_DROPE        0.32  0.47   29  175   39  174  150    7   17  274  B4H6E2     GL15537 OS=Drosophila persimilis GN=Dper\GL15537 PE=3 SV=1
 1526 : B4HSD1_DROSE        0.32  0.52   29  172    7  142  149    8   18  250  B4HSD1     GM20644 OS=Drosophila sechellia GN=Dsec\GM20644 PE=3 SV=1
 1527 : B4LQ53_DROVI        0.32  0.50   29  175   45  195  153    6    8  296  B4LQ53     GJ21978 OS=Drosophila virilis GN=Dvir\GJ21978 PE=3 SV=1
 1528 : B4N925_DROWI        0.32  0.50   29  175  129  287  161    7   16  391  B4N925     GK10951 OS=Drosophila willistoni GN=Dwil\GK10951 PE=3 SV=1
 1529 : B4P3F9_DROYA        0.32  0.52   29  172    7  142  149    8   18  250  B4P3F9     GE22674 OS=Drosophila yakuba GN=Dyak\GE22674 PE=3 SV=1
 1530 : B4P6W2_DROYA        0.32  0.54  179  277   90  183  103    7   13  202  B4P6W2     GE14135 OS=Drosophila yakuba GN=Dyak\GE14135 PE=3 SV=1
 1531 : B4P7A6_DROYA        0.32  0.51  177  277  105  200  108    7   19  204  B4P7A6     GE14139 OS=Drosophila yakuba GN=Dyak\GE14139 PE=3 SV=1
 1532 : B4PJB2_DROYA        0.32  0.48   29  175   38  173  150    7   17  273  B4PJB2     GE21528 OS=Drosophila yakuba GN=Dyak\GE21528 PE=3 SV=1
 1533 : B4QGP7_DROSI        0.32  0.52   29  172    7  142  149    8   18  250  B4QGP7     GD10118 OS=Drosophila simulans GN=Dsim\GD10118 PE=3 SV=1
 1534 : B4QIW2_DROSI        0.32  0.45   29  175   38  173  150    7   17  271  B4QIW2     GD13922 OS=Drosophila simulans GN=Dsim\GD13922 PE=3 SV=1
 1535 : B4QKV4_DROSI        0.32  0.51  182  278   85  173  100    4   14  174  B4QKV4     GD13049 OS=Drosophila simulans GN=Dsim\GD13049 PE=3 SV=1
 1536 : B5A5B0_MOUSE        0.32  0.52   29  175   29  164  153    7   23  270  B5A5B0     Tryptase alpha/beta 1 OS=Mus musculus GN=Tpsab1 PE=3 SV=1
 1537 : B5A5B2_MOUSE        0.32  0.50   29  175   32  167  149    8   15  276  B5A5B2     Tryptase beta 2 OS=Mus musculus GN=Tpsb2 PE=3 SV=1
 1538 : B5X8T3_SALSA        0.32  0.50   29  175   21  147  149    7   24  242  B5X8T3     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
 1539 : B5XEC7_SALSA        0.32  0.50   29  175   21  147  149    7   24  242  B5XEC7     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
 1540 : B7P0L5_IXOSC        0.32  0.53   29  174  174  323  159    9   22  431  B7P0L5     Proclotting enzyme, putative OS=Ixodes scapularis GN=IscW_ISCW000320 PE=3 SV=1
 1541 : B7P183_IXOSC        0.32  0.50   29  175  190  326  152    9   20  353  B7P183     Serine protease, putative OS=Ixodes scapularis GN=IscW_ISCW001119 PE=3 SV=1
 1542 : B7P9J0_IXOSC        0.32  0.57   29  153    2  125  129    4    9  199  B7P9J0     Serine protease, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW002093 PE=3 SV=1
 1543 : B7PKE8_IXOSC        0.32  0.55  179  272    2   95   99    4   10  103  B7PKE8     Serine protease, putative OS=Ixodes scapularis GN=IscW_ISCW006637 PE=3 SV=1
 1544 : B7PKG5_IXOSC        0.32  0.51  178  278    6  105  105    3    9  107  B7PKG5     Ovochymase, putative OS=Ixodes scapularis GN=IscW_ISCW006432 PE=3 SV=1
 1545 : B7QID0_IXOSC        0.32  0.49   29  175   36  172  152    9   20  281  B7QID0     Serine proteinase, putative OS=Ixodes scapularis GN=IscW_ISCW014005 PE=3 SV=1
 1546 : B9V2X7_EPICO        0.32  0.49   29  175   24  150  149    7   24  245  B9V2X7     Trypsinogen 1a (Fragment) OS=Epinephelus coioides PE=2 SV=1
 1547 : B9V309_EPICO        0.32  0.45   29  175   26  161  152    8   21  264  B9V309     Elastase 3 (Fragment) OS=Epinephelus coioides PE=2 SV=1
 1548 : C3W4P8_FENCH        0.32  0.51   29  175   30  168  152    9   18  266  C3W4P8     Trypsin-like serine proteinase 4 OS=Fenneropenaeus chinensis PE=2 SV=1
 1549 : C3Y043_BRAFL        0.32  0.61  177  278   98  194  102    2    5  196  C3Y043     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_277721 PE=3 SV=1
 1550 : C3Z061_BRAFL        0.32  0.51   29  175   32  173  152    7   15  300  C3Z061     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_85674 PE=3 SV=1
 1551 : C3Z266_BRAFL        0.32  0.50   29  170   21  151  145    6   17  256  C3Z266     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_215636 PE=3 SV=1
 1552 : C3Z4Q6_BRAFL        0.32  0.52   29  170    1  134  145    8   14  247  C3Z4Q6     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_243672 PE=3 SV=1
 1553 : C3ZNE9_BRAFL        0.32  0.51  178  278  152  259  112    5   15  260  C3ZNE9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_59090 PE=3 SV=1
 1554 : C5IWV5_PIG          0.32  0.49   29  175   24  150  148    7   22  246  C5IWV5     Trypsinogen OS=Sus scrofa PE=2 SV=1
 1555 : C6L245_PIG          0.32  0.49   29  171   24  146  145    8   24  247  C6L245     Putative trypsinogen OS=Sus scrofa GN=try PE=3 SV=1
 1556 : C7DY49_TAKOB        0.32  0.50   29  175   24  150  149    7   24  246  C7DY49     Trypsinogen 2 OS=Takifugu obscurus PE=2 SV=1
 1557 : CEL2A_PIG   1BRU    0.32  0.49   29  175   29  166  151    6   17  269  P08419     Chymotrypsin-like elastase family member 2A OS=Sus scrofa GN=CELA2A PE=1 SV=1
 1558 : CEL2A_RAT           0.32  0.48   29  175   31  168  153    8   21  271  P00774     Chymotrypsin-like elastase family member 2A OS=Rattus norvegicus GN=Cela2a PE=2 SV=1
 1559 : CTR2_ANOGA          0.32  0.53   29  175   33  162  147    8   17  258  Q17025     Chymotrypsin-2 OS=Anopheles gambiae GN=CHYM2 PE=2 SV=3
 1560 : CTRB_BOVIN  1CBW    0.32  0.51   29  173   16  145  146    6   17  245  P00767     Chymotrypsinogen B OS=Bos taurus PE=1 SV=1
 1561 : CTRC_MOUSE          0.32  0.49   29  172   30  163  148    6   18  268  Q3SYP2     Chymotrypsin-C OS=Mus musculus GN=Ctrc PE=2 SV=1
 1562 : D0VYM6_PENJP        0.32  0.48   29  175   46  175  150    8   23  271  D0VYM6     Chymotrypsin-like proteinase OS=Penaeus japonicus PE=2 SV=1
 1563 : D2I407_AILME        0.32  0.43   29  175    4  134  149    6   20  230  D2I407     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_020297 PE=3 SV=1
 1564 : D3TJK1_EPICO        0.32  0.49   29  175   21  147  149    7   24  242  D3TJK1     Pancreatic trypsinogen OS=Epinephelus coioides PE=2 SV=1
 1565 : D3TKX7_GLOMM        0.32  0.53  182  276   93  191  103    5   12  203  D3TKX7     Masquerade-like serine protease (Fragment) OS=Glossina morsitans morsitans PE=2 SV=1
 1566 : D6PVR6_EPICO        0.32  0.47   29  175   26  163  154    7   23  266  D6PVR6     Elastase-like serine protease (Fragment) OS=Epinephelus coioides PE=2 SV=1
 1567 : D7EIV6_TRICA        0.32  0.45   29  175   81  217  151   10   18  295  D7EIV6     Serine protease P32 OS=Tribolium castaneum GN=P32 PE=3 SV=1
 1568 : D9U8G1_PLEAT        0.32  0.46   29  175   28  165  152    6   19  268  D9U8G1     Elastase OS=Plecoglossus altivelis GN=ela PE=2 SV=1
 1569 : E0VN67_PEDHC        0.32  0.49   29  170   67  202  147    6   16  292  E0VN67     Tripsin I-P1, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM329900 PE=3 SV=1
 1570 : E0VW11_PEDHC        0.32  0.50   29  175   35  169  148    6   14  274  E0VW11     Tripsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM472610 PE=3 SV=1
 1571 : E0W3S8_PEDHC        0.32  0.55   40  170   12  141  133    4    5  256  E0W3S8     Trypsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM609560 PE=3 SV=1
 1572 : E1BDT3_BOVIN        0.32  0.49   29  173   34  163  146    6   17  263  E1BDT3     Uncharacterized protein OS=Bos taurus GN=LOC618826 PE=3 SV=2
 1573 : E1BK01_BOVIN        0.32  0.45   29  175  627  772  161   13   29  871  E1BK01     Uncharacterized protein OS=Bos taurus GN=PRSS12 PE=3 SV=2
 1574 : E1C996_CHICK        0.32  0.52   29  172   14  137  145    6   22  236  E1C996     Uncharacterized protein (Fragment) OS=Gallus gallus GN=LOC768817 PE=1 SV=2
 1575 : E2BS70_HARSA        0.32  0.50   29  175   23  154  149    7   19  250  E2BS70     Trypsin-1 OS=Harpegnathos saltator GN=EAI_16633 PE=3 SV=1
 1576 : E3TE32_ICTPU        0.32  0.47   29  175   29  164  151    7   19  267  E3TE32     Chymotrypsin-like elastase family member 2a OS=Ictalurus punctatus GN=CEL2A PE=2 SV=1
 1577 : E6ZHT9_DICLA        0.32  0.51   29  175   60  205  155    9   17  317  E6ZHT9     Uncharacterized protein OS=Dicentrarchus labrax GN=DLA_Ib04650 PE=3 SV=1
 1578 : E7FGN9_DANRE        0.32  0.56   29  175   32  167  149    9   15  305  E7FGN9     Uncharacterized protein OS=Danio rerio GN=LOC100001520 PE=3 SV=1
 1579 : E9FTM4_DAPPU        0.32  0.49   29  175   74  207  152    8   23  311  E9FTM4     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_230174 PE=3 SV=1
 1580 : E9GED5_DAPPU        0.32  0.50   29  172   58  199  155    7   24  338  E9GED5     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_316923 PE=3 SV=1
 1581 : E9H2M8_DAPPU        0.32  0.54   29  175    1  136  147    4   11  263  E9H2M8     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_57647 PE=3 SV=1
 1582 : E9IHV8_SOLIN        0.32  0.54   29  175  124  257  149    6   17  325  E9IHV8     Putative uncharacterized protein (Fragment) OS=Solenopsis invicta GN=SINV_00030 PE=3 SV=1
 1583 : E9PY32_MOUSE        0.32  0.52   29  175   66  201  151    8   19  310  E9PY32     Tryptase OS=Mus musculus GN=Tpsab1 PE=3 SV=1
 1584 : E9QJZ3_MOUSE        0.32  0.52   29  175   29  164  153    7   23  273  E9QJZ3     Tryptase OS=Mus musculus GN=Tpsab1 PE=3 SV=1
 1585 : E9QL79_MOUSE        0.32  0.51   30  172   30  162  149    6   22  267  E9QL79     Chymotrypsin-C OS=Mus musculus GN=Ctrc PE=2 SV=2
 1586 : EURM3_EURMA         0.32  0.48   29  175   30  160  149    8   20  261  O97370     Mite allergen Eur m 3 OS=Euroglyphus maynei GN=EURM3 PE=1 SV=1
 1587 : F1CGQ3_BOMTE        0.32  0.47   29  174  112  255  158   12   26  358  F1CGQ3     Venom serine protease OS=Bombus terrestris PE=3 SV=1
 1588 : F1MB31_BOVIN        0.32  0.52   30  173   33  159  148    8   25  300  F1MB31     Uncharacterized protein (Fragment) OS=Bos taurus GN=PRSS46 PE=3 SV=1
 1589 : F1P457_CHICK        0.32  0.48   29  172   30  162  148    6   19  267  F1P457     Uncharacterized protein OS=Gallus gallus GN=CTRC PE=3 SV=2
 1590 : F1PUA6_CANFA        0.32  0.48   29  175  601  746  160   12   27  845  F1PUA6     Uncharacterized protein OS=Canis familiaris GN=PRSS12 PE=3 SV=2
 1591 : F1R1X9_DANRE        0.32  0.52   29  175   21  151  148    7   18  247  F1R1X9     Uncharacterized protein OS=Danio rerio GN=zgc:92590 PE=3 SV=1
 1592 : F1R894_DANRE        0.32  0.52   29  175   21  147  148    8   22  242  F1R894     Trypsinogen 1a OS=Danio rerio GN=zgc:66382 PE=2 SV=1
 1593 : F1RAJ7_DANRE        0.32  0.58   31  175   37  170  148    9   17  311  F1RAJ7     Uncharacterized protein OS=Danio rerio GN=zgc:112038 PE=3 SV=1
 1594 : F1SRS2_PIG          0.32  0.49   29  175   24  150  148    7   22  246  F1SRS2     Uncharacterized protein OS=Sus scrofa GN=LOC100302368 PE=2 SV=1
 1595 : F2XFT4_DISMA        0.32  0.52   29  175   20  146  149    8   24  241  F2XFT4     Trypsinogen H1_1g OS=Dissostichus mawsoni PE=3 SV=1
 1596 : F2XFT9_DISMA        0.32  0.49   29  172   20  145  144    5   18  231  F2XFT9     Trypsinogen H1_3a3 OS=Dissostichus mawsoni PE=3 SV=1
 1597 : F4WYJ1_ACREC        0.32  0.53  177  276   18  106  102    4   15  136  F4WYJ1     Trypsin eta (Fragment) OS=Acromyrmex echinatior GN=G5I_11044 PE=3 SV=1
 1598 : F5BZN7_EPIBR        0.32  0.52   29  175  144  273  149    7   21  299  F5BZN7     Putative uncharacterized protein (Fragment) OS=Epinephelus bruneus PE=2 SV=1
 1599 : F6Q3F0_MACMU        0.32  0.54   29  175   68  200  149    9   18  288  F6Q3F0     Uncharacterized protein OS=Macaca mulatta GN=PRSS55 PE=3 SV=1
 1600 : F6QKR1_MONDO        0.32  0.48   29  172   30  162  148    6   19  236  F6QKR1     Uncharacterized protein OS=Monodelphis domestica GN=CTRC PE=3 SV=2
 1601 : F6SB70_MONDO        0.32  0.47   29  172   25  148  146    7   24  247  F6SB70     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010109 PE=3 SV=1
 1602 : F6SIF7_HORSE        0.32  0.51   29  175   22  149  148    7   21  244  F6SIF7     Uncharacterized protein (Fragment) OS=Equus caballus GN=KLK6 PE=3 SV=1
 1603 : F6ST43_XENTR        0.32  0.46  177  278   99  193  104    5   11  194  F6ST43     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 1604 : F6TW38_HORSE        0.32  0.52   29  173   34  163  149    7   23  264  F6TW38     Uncharacterized protein OS=Equus caballus PE=3 SV=1
 1605 : F6UKL7_XENTR        0.32  0.52   29  172   27  158  147    7   18  264  F6UKL7     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC100495222 PE=3 SV=1
 1606 : F6VPW3_CALJA        0.32  0.55  179  278   47  138  102    7   12  140  F6VPW3     Uncharacterized protein OS=Callithrix jacchus GN=KLK7 PE=3 SV=1
 1607 : F6X1R5_MACMU        0.32  0.49   29  172   38  161  145    7   22  261  F6X1R5     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 1608 : F6XNU8_XENTR        0.32  0.54   29  173   34  164  145    5   14  264  F6XNU8     Uncharacterized protein OS=Xenopus tropicalis GN=ctrb1 PE=3 SV=1
 1609 : F6Y785_HORSE        0.32  0.51   29  175   34  165  148    7   17  248  F6Y785     Uncharacterized protein (Fragment) OS=Equus caballus PE=3 SV=1
 1610 : F6YR04_CALJA        0.32  0.51   29  175    8  141  148    6   15  265  F6YR04     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=PRSS44 PE=3 SV=1
 1611 : F6YRF8_MONDO        0.32  0.49   29  175   61  196  155    9   27  341  F6YRF8     Uncharacterized protein OS=Monodelphis domestica GN=LOC100016477 PE=3 SV=2
 1612 : F6ZDB9_MONDO        0.32  0.52   29  174   32  165  149    7   18  317  F6ZDB9     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=PRSS27 PE=3 SV=1
 1613 : F7A744_MONDO        0.32  0.50   29  171    4  126  143    7   20  227  F7A744     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=LOC100010991 PE=3 SV=1
 1614 : F7AUF7_MONDO        0.32  0.50   29  174   45  185  152    8   17  317  F7AUF7     Uncharacterized protein OS=Monodelphis domestica GN=LOC100023397 PE=3 SV=2
 1615 : F7B8K3_HORSE        0.32  0.49   29  173  178  314  154   10   26  431  F7B8K3     Uncharacterized protein (Fragment) OS=Equus caballus GN=HPN PE=3 SV=1
 1616 : F7BC37_HORSE        0.32  0.53   29  175    7  141  148    6   14  300  F7BC37     Uncharacterized protein OS=Equus caballus GN=PRSS8 PE=3 SV=1
 1617 : F7D3E0_MONDO        0.32  0.49   29  175   47  183  151    9   18  342  F7D3E0     Uncharacterized protein OS=Monodelphis domestica PE=3 SV=2
 1618 : F7DXT6_XENTR        0.32  0.54   29  175   39  174  149    8   15  281  F7DXT6     Uncharacterized protein OS=Xenopus tropicalis PE=3 SV=1
 1619 : F7E0I1_CALJA        0.32  0.50  179  278   66  157  103    7   14  159  F7E0I1     Uncharacterized protein OS=Callithrix jacchus GN=KLK1 PE=3 SV=1
 1620 : F7E5A7_CALJA        0.32  0.48   29  175   38  170  149    7   18  322  F7E5A7     Uncharacterized protein OS=Callithrix jacchus GN=TPSG1 PE=3 SV=1
 1621 : F7E7I8_MONDO        0.32  0.49   29  173   34  162  146    7   18  262  F7E7I8     Uncharacterized protein OS=Monodelphis domestica GN=LOC100023625 PE=3 SV=1
 1622 : F7ER41_ORNAN        0.32  0.51   29  171   40  170  148   10   22  295  F7ER41     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100089802 PE=3 SV=1
 1623 : F7EWZ8_CALJA        0.32  0.47   29  171    2  132  144    5   14  245  F7EWZ8     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=TPSD1 PE=3 SV=1
 1624 : F7FL69_ORNAN        0.32  0.52   29  174   22  161  155   10   24  295  F7FL69     Uncharacterized protein OS=Ornithorhynchus anatinus GN=TMPRSS12 PE=3 SV=2
 1625 : F7FV14_ORNAN        0.32  0.49   29  175   38  171  148    6   15  269  F7FV14     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=CTRL PE=3 SV=1
 1626 : F7HBQ6_MACMU        0.32  0.50   29  171   38  160  144    7   22  261  F7HBQ6     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 1627 : F7IDB0_CALJA        0.32  0.47   29  175  300  441  160   12   31  878  F7IDB0     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=LOC100411102 PE=3 SV=1
 1628 : F7IJB8_CALJA        0.32  0.55  179  278   88  179  102    7   12  181  F7IJB8     Uncharacterized protein OS=Callithrix jacchus GN=KLK7 PE=3 SV=1
 1629 : F8U051_EPIBR        0.32  0.52  179  277  103  199  103    7   10  199  F8U051     Uncharacterized protein I (Fragment) OS=Epinephelus bruneus PE=2 SV=1
 1630 : F8U096_EPIBR        0.32  0.51  177  278   44  136  103    5   11  137  F8U096     Trypsinogen 2 (Fragment) OS=Epinephelus bruneus PE=2 SV=1
 1631 : F8WAM8_HUMAN        0.32  0.50  179  278   67  158  101    4   10  160  F8WAM8     Kallikrein-1 OS=Homo sapiens GN=KLK1 PE=2 SV=1
 1632 : G1K1L9_BOVIN        0.32  0.52   29  170   34  160  143    6   17  263  G1K1L9     Uncharacterized protein OS=Bos taurus GN=LOC100848132 PE=3 SV=1
 1633 : G1KTN0_ANOCA        0.32  0.53   29  174   32  169  151    8   18  299  G1KTN0     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100552183 PE=3 SV=2
 1634 : G1L013_AILME        0.32  0.49   29  173  163  300  154    9   25  417  G1L013     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=HPN PE=3 SV=1
 1635 : G1LZR2_AILME        0.32  0.49   29  172   40  172  151    8   25  292  G1LZR2     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=CTRC PE=3 SV=1
 1636 : G1P5R2_MYOLU        0.32  0.50   29  175   39  171  147    6   14  269  G1P5R2     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=CTRL PE=3 SV=1
 1637 : G1PE81_MYOLU        0.32  0.48   29  172   33  166  149    7   20  272  G1PE81     Uncharacterized protein OS=Myotis lucifugus GN=CTRC PE=3 SV=1
 1638 : G1Q643_MYOLU        0.32  0.46   29  170   20  147  146    8   22  261  G1Q643     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=KLK13 PE=3 SV=1
 1639 : G1Q6S9_MYOLU        0.32  0.46   29  170   35  170  149    9   20  274  G1Q6S9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 1640 : G1Q7R6_MYOLU        0.32  0.47   29  170   45  181  149    8   19  280  G1Q7R6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 1641 : G1QAF7_MYOLU        0.32  0.49  177  278  142  235  106    7   16  236  G1QAF7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 1642 : G1QE61_MYOLU        0.32  0.50   29  175   38  178  155    9   22  281  G1QE61     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 1643 : G1QEN6_MYOLU        0.32  0.50   29  175   31  166  149    8   15  275  G1QEN6     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 1644 : G1QFP2_MYOLU        0.32  0.46   29  175   31  171  154    8   20  273  G1QFP2     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 1645 : G1QJT7_NOMLE        0.32  0.52  177  277   41  133  104    4   14  133  G1QJT7     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=CFD PE=3 SV=1
 1646 : G1QQL8_NOMLE        0.32  0.49   29  171   24  146  145    8   24  247  G1QQL8     Uncharacterized protein OS=Nomascus leucogenys GN=PRSS1 PE=3 SV=1
 1647 : G1SLC3_RABIT        0.32  0.52   29  175   37  171  148    7   14  279  G1SLC3     Uncharacterized protein OS=Oryctolagus cuniculus GN=PRSS33 PE=3 SV=1
 1648 : G1TI74_RABIT        0.32  0.50   29  175   29  166  151    6   17  268  G1TI74     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100339326 PE=3 SV=1
 1649 : G1TRX0_RABIT        0.32  0.52   29  175  119  256  155    9   25  385  G1TRX0     Uncharacterized protein OS=Oryctolagus cuniculus GN=PRSS21 PE=3 SV=2
 1650 : G1TUM9_RABIT        0.32  0.47   29  175   29  166  153    8   21  269  G1TUM9     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100344955 PE=3 SV=1
 1651 : G1U3L5_RABIT        0.32  0.50   29  172   27  150  145    6   22  249  G1U3L5     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339606 PE=3 SV=1
 1652 : G3HT92_CRIGR        0.32  0.53  178  278  115  216  108    7   13  233  G3HT92     Testis serine protease 2 OS=Cricetulus griseus GN=I79_014114 PE=3 SV=1
 1653 : G3LTW4_9HYME        0.32  0.45   29  172  112  253  155   10   24  357  G3LTW4     Venom serine protease OS=Bombus ardens ardens PE=2 SV=1
 1654 : G3MQX7_9ACAR        0.32  0.46   29  170   35  163  146    8   21  268  G3MQX7     Putative uncharacterized protein OS=Amblyomma maculatum PE=2 SV=1
 1655 : G3NFA9_GASAC        0.32  0.51   29  175  180  320  158    9   28  419  G3NFA9     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1656 : G3NG34_GASAC        0.32  0.50   29  175   21  147  149    7   24  242  G3NG34     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1657 : G3NG42_GASAC        0.32  0.51   29  175   22  148  149    8   24  243  G3NG42     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1658 : G3NG49_GASAC        0.32  0.47   29  175   29  155  149    7   24  250  G3NG49     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1659 : G3NGC8_GASAC        0.32  0.50   29  175   32  158  149    7   24  253  G3NGC8     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1660 : G3NGE3_GASAC        0.32  0.50   29  175   21  147  149    7   24  242  G3NGE3     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1661 : G3P908_GASAC        0.32  0.48   29  172   29  163  151    7   23  268  G3P908     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1662 : G3P914_GASAC        0.32  0.48   29  172   29  163  151    7   23  273  G3P914     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1663 : G3P919_GASAC        0.32  0.48   29  172   29  163  151    7   23  269  G3P919     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1664 : G3P921_GASAC        0.32  0.48   29  172   29  163  151    7   23  269  G3P921     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 1665 : G3PYM1_GASAC        0.32  0.50   29  173  172  311  154   11   23  425  G3PYM1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1666 : G3Q108_GASAC        0.32  0.53   29  172   26  154  146    7   19  259  G3Q108     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=CELA3A PE=3 SV=1
 1667 : G3Q109_GASAC        0.32  0.53   29  172   30  158  146    8   19  266  G3Q109     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=CELA3A PE=3 SV=1
 1668 : G3QQU1_GORGO        0.32  0.52   29  173   41  178  149    7   15  295  G3QQU1     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101135897 PE=3 SV=1
 1669 : G3QUX0_GORGO        0.32  0.49   29  172   30  163  149    7   20  268  G3QUX0     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101129704 PE=3 SV=1
 1670 : G3QYJ1_GORGO        0.32  0.50   29  175   43  174  151   10   23  343  G3QYJ1     Uncharacterized protein OS=Gorilla gorilla gorilla PE=3 SV=1
 1671 : G3RDV1_GORGO        0.32  0.48   29  175   38  170  149    7   18  321  G3RDV1     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101141254 PE=3 SV=1
 1672 : G3RTE2_GORGO        0.32  0.49   29  172   30  163  149    7   20  268  G3RTE2     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101129704 PE=3 SV=1
 1673 : G3RW16_GORGO        0.32  0.48   29  156   24  136  129    5   17  200  G3RW16     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101147499 PE=3 SV=1
 1674 : G3U5U5_LOXAF        0.32  0.51   29  175   26  153  148    7   21  247  G3U5U5     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=KLK10 PE=3 SV=1
 1675 : G3U822_LOXAF        0.32  0.49   29  173   21  146  145    6   19  244  G3U822     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=3 SV=1
 1676 : G3U8R7_LOXAF        0.32  0.50  179  278   20  111  101    3   10  113  G3U8R7     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=KLK15 PE=3 SV=1
 1677 : G3UHP6_LOXAF        0.32  0.49   29  172   19  143  144    6   19  242  G3UHP6     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=3 SV=1
 1678 : G3UJI7_LOXAF        0.32  0.51   29  173   31  170  152    8   19  281  G3UJI7     Uncharacterized protein OS=Loxodonta africana GN=LOC100669978 PE=3 SV=1
 1679 : G3V8F2_RAT          0.32  0.50   29  175   30  165  149    8   15  274  G3V8F2     Mast cell protease 6, isoform CRA_a OS=Rattus norvegicus GN=Tpsb2 PE=3 SV=1
 1680 : G3VA70_SARHA        0.32  0.50  177  277  137  240  111    7   17  240  G3VA70     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=LOC100920182 PE=3 SV=1
 1681 : G3VAT3_SARHA        0.32  0.48   29  175   34  161  147    7   19  261  G3VAT3     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=KLK7 PE=3 SV=1
 1682 : G3VBJ1_SARHA        0.32  0.49   29  174   26  152  146    7   19  250  G3VBJ1     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100916403 PE=3 SV=1
 1683 : G3VE31_SARHA        0.32  0.48   29  150    1  109  122    3   13  147  G3VE31     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=3 SV=1
 1684 : G3VFG3_SARHA        0.32  0.57   29  175    4  152  155    7   14  286  G3VFG3     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=LOC100925461 PE=3 SV=1
 1685 : G3VID1_SARHA        0.32  0.47   29  175   42  178  150    9   16  294  G3VID1     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100920443 PE=3 SV=1
 1686 : G3VKQ6_SARHA        0.32  0.53   41  174   41  154  136    8   24  252  G3VKQ6     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100913350 PE=3 SV=1
 1687 : G3VMR8_SARHA        0.32  0.52   29  175   37  167  151   10   24  263  G3VMR8     Uncharacterized protein OS=Sarcophilus harrisii GN=KLK5 PE=3 SV=1
 1688 : G3W9G7_SARHA        0.32  0.49   29  172   62  194  149    8   21  299  G3W9G7     Uncharacterized protein OS=Sarcophilus harrisii GN=CTRC PE=3 SV=1
 1689 : G5AMG8_HETGA        0.32  0.52   29  175   35  167  148    7   16  321  G5AMG8     Putative serine protease UNQ9391/PRO34284 OS=Heterocephalus glaber GN=GW7_15146 PE=3 SV=1
 1690 : G5BR95_HETGA        0.32  0.47  179  278   96  187  102    5   12  188  G5BR95     Kallikrein-12 OS=Heterocephalus glaber GN=GW7_13262 PE=3 SV=1
 1691 : G5BRS6_HETGA        0.32  0.47   29  172   30  163  148    6   18  268  G5BRS6     Chymotrypsin-C OS=Heterocephalus glaber GN=GW7_15508 PE=3 SV=1
 1692 : G5BXT8_HETGA        0.32  0.50   29  175   31  166  149    8   15  275  G5BXT8     Tryptase OS=Heterocephalus glaber GN=GW7_12955 PE=3 SV=1
 1693 : G5BYC3_HETGA        0.32  0.53   29  175   18  152  148    6   14  315  G5BYC3     Prostasin OS=Heterocephalus glaber GN=GW7_05123 PE=3 SV=1
 1694 : G5EMQ3_THUOR        0.32  0.49   29  175   21  147  149    7   24  242  G5EMQ3     Trypsinogen 1 OS=Thunnus orientalis PE=2 SV=1
 1695 : G5EMQ5_THUOR        0.32  0.50   29  170   34  161  145    6   20  264  G5EMQ5     Chymotrypsinogen 1 OS=Thunnus orientalis PE=2 SV=1
 1696 : G5EMQ8_PAGMA        0.32  0.51   29  175   21  147  149    8   24  241  G5EMQ8     Trypsinogen OS=Pagrus major PE=2 SV=1
 1697 : G5EMR5_9ORTH        0.32  0.56   29  175   47  186  152    8   17  293  G5EMR5     Serine protease like protein OS=Meloimorpha japonica PE=2 SV=1
 1698 : G6DPT5_DANPL        0.32  0.48   29  170  178  317  156   13   30  442  G6DPT5     Hemolymph proteinase 16 OS=Danaus plexippus GN=KGM_09015 PE=3 SV=1
 1699 : G7NQR2_MACMU        0.32  0.49   29  175   38  170  149    7   18  319  G7NQR2     Tryptase gamma OS=Macaca mulatta GN=EGK_12328 PE=3 SV=1
 1700 : G9JKF2_EPICO        0.32  0.50   29  175   21  147  149    7   24  242  G9JKF2     Trypsinogens 1 OS=Epinephelus coioides PE=2 SV=1
 1701 : H0BAF8_9ACTO        0.32  0.50  181  276   73  164  101    4   14  164  H0BAF8     Putative trypsin-like protease OS=Streptomyces sp. W007 GN=SPW_2244 PE=3 SV=1
 1702 : H0VF02_CAVPO        0.32  0.46   29  175   10  146  152    7   20  269  H0VF02     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100722925 PE=3 SV=1
 1703 : H0VVU0_CAVPO        0.32  0.51   29  175   29  165  154    8   24  268  H0VVU0     Uncharacterized protein OS=Cavia porcellus GN=LOC100715518 PE=3 SV=1
 1704 : H0W6S3_CAVPO        0.32  0.52   29  174   14  147  149    7   18  267  H0W6S3     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=PRSS27 PE=3 SV=1
 1705 : H0X807_OTOGA        0.32  0.46   29  175   29  161  152    8   24  311  H0X807     Uncharacterized protein OS=Otolemur garnettii GN=TPSG1 PE=3 SV=1
 1706 : H0X996_OTOGA        0.32  0.49   29  172   24  147  146    7   24  247  H0X996     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
 1707 : H0XFT0_OTOGA        0.32  0.50   29  171   24  146  145    8   24  246  H0XFT0     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
 1708 : H0XFZ6_OTOGA        0.32  0.54   30  174   39  167  147    8   20  276  H0XFZ6     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=3 SV=1
 1709 : H0XV49_OTOGA        0.32  0.51   29  175   40  185  157    8   21  390  H0XV49     Acrosin OS=Otolemur garnettii GN=ACR PE=3 SV=1
 1710 : H0XW95_OTOGA        0.32  0.51   29  174   34  165  146    5   14  237  H0XW95     Uncharacterized protein OS=Otolemur garnettii GN=CTRL PE=3 SV=1
 1711 : H0XX82_OTOGA        0.32  0.49   29  175   29  168  149    6   11  271  H0XX82     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=TMPRSS12 PE=3 SV=1
 1712 : H0YQV9_TAEGU        0.32  0.56  177  278   47  140  105    5   14  144  H0YQV9     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=CFD PE=3 SV=1
 1713 : H0YXQ0_TAEGU        0.32  0.51   29  171    2  136  146    6   14  242  H0YXQ0     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
 1714 : H0Z239_TAEGU        0.32  0.46   29  175    6  136  147    6   16  237  H0Z239     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=TMPRSS11B-1 PE=3 SV=1
 1715 : H0ZVD0_TAEGU        0.32  0.52  182  276   76  168   99    8   10  169  H0ZVD0     Uncharacterized protein OS=Taeniopygia guttata PE=3 SV=1
 1716 : H1A7C0_9ANNE        0.32  0.54   29  175   45  179  149    7   16  282  H1A7C0     Fibrinolytic enzyme OS=Enchytraeus japonensis GN=Ej-FEIII-1a PE=2 SV=1
 1717 : H1A7C3_9ANNE        0.32  0.53   29  175   45  179  149    7   16  282  H1A7C3     Fibrinolytic enzyme OS=Enchytraeus japonensis GN=Ej-FEIII-2b PE=2 SV=1
 1718 : H1A7C4_9ANNE        0.32  0.53   29  175   45  179  148    6   14  282  H1A7C4     Fibrinolytic enzyme OS=Enchytraeus japonensis GN=Ej-FEIII-3 PE=2 SV=1
 1719 : H2LNJ0_ORYLA        0.32  0.47   29  172  162  298  157   10   33  415  H2LNJ0     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101171277 PE=3 SV=1
 1720 : H2LNJ4_ORYLA        0.32  0.47   29  172  138  274  157   10   33  345  H2LNJ4     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101171277 PE=3 SV=1
 1721 : H2LPT4_ORYLA        0.32  0.54   29  175   32  164  147    4   14  261  H2LPT4     Uncharacterized protein OS=Oryzias latipes GN=LOC101174455 PE=3 SV=1
 1722 : H2M4P7_ORYLA        0.32  0.51   29  175   32  170  152    9   18  268  H2M4P7     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
 1723 : H2MX24_ORYLA        0.32  0.52   29  175   31  176  155    9   17  284  H2MX24     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101161025 PE=3 SV=1
 1724 : H2NPN5_PONAB        0.32  0.49   29  175   38  170  149    7   18  321  H2NPN5     Uncharacterized protein OS=Pongo abelii GN=TPSG1 PE=3 SV=1
 1725 : H2PRX3_PONAB        0.32  0.46   29  172   81  203  145    8   23  303  H2PRX3     Uncharacterized protein OS=Pongo abelii GN=PRSS3 PE=3 SV=1
 1726 : H2R1H9_PANTR        0.32  0.50   29  171   24  146  145    8   24  247  H2R1H9     Uncharacterized protein OS=Pan troglodytes GN=LOC100615987 PE=3 SV=1
 1727 : H2RR24_TAKRU        0.32  0.53   29  175   35  168  149    7   17  287  H2RR24     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101067365 PE=3 SV=1
 1728 : H2RR25_TAKRU        0.32  0.53   29  175   38  171  149    7   17  304  H2RR25     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101067365 PE=3 SV=1
 1729 : H2RRG2_TAKRU        0.32  0.52   29  175   21  147  149    8   24  242  H2RRG2     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066992 PE=3 SV=1
 1730 : H2RT70_TAKRU        0.32  0.49   29  172  102  238  154    9   27  356  H2RT70     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101065721 PE=3 SV=1
 1731 : H2SW37_TAKRU        0.32  0.48   29  170  126  283  165    8   30  386  H2SW37     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1732 : H2T7F2_TAKRU        0.32  0.50   29  171   31  156  145    6   21  260  H2T7F2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074118 PE=3 SV=1
 1733 : H2TFA7_TAKRU        0.32  0.56   29  175   32  169  151    8   17  271  H2TFA7     Uncharacterized protein OS=Takifugu rubripes GN=LOC101078898 PE=3 SV=1
 1734 : H2TFA8_TAKRU        0.32  0.56   29  175   38  175  151    8   17  273  H2TFA8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101078898 PE=3 SV=1
 1735 : H2TFA9_TAKRU        0.32  0.56   29  175   34  171  151    8   17  273  H2TFA9     Uncharacterized protein OS=Takifugu rubripes GN=LOC101078898 PE=3 SV=1
 1736 : H2TFB0_TAKRU        0.32  0.56   29  175   35  172  151    8   17  321  H2TFB0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101078898 PE=3 SV=1
 1737 : H2TFB1_TAKRU        0.32  0.56   29  175   42  179  151    8   17  320  H2TFB1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101078898 PE=3 SV=1
 1738 : H2TFB2_TAKRU        0.32  0.56   29  175   15  152  151    8   17  284  H2TFB2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101078898 PE=3 SV=1
 1739 : H2TNW5_TAKRU        0.32  0.56   29  175   37  170  149    7   17  321  H2TNW5     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1740 : H2TNW6_TAKRU        0.32  0.56   29  175   37  170  149    7   17  316  H2TNW6     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1741 : H2TNW7_TAKRU        0.32  0.56   29  175   33  166  149    7   17  308  H2TNW7     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1742 : H2TNW8_TAKRU        0.32  0.56   29  175   36  169  149    7   17  299  H2TNW8     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1743 : H2TNW9_TAKRU        0.32  0.56   29  175   34  167  149    7   17  277  H2TNW9     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1744 : H2TNX0_TAKRU        0.32  0.56   29  175   43  176  149    7   17  283  H2TNX0     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1745 : H2TNX1_TAKRU        0.32  0.56   29  175   40  173  149    7   17  276  H2TNX1     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1746 : H2TNX2_TAKRU        0.32  0.57   29  175   32  165  150    8   19  264  H2TNX2     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=3 SV=1
 1747 : H2U5L1_TAKRU        0.32  0.52   29  175   38  170  148    7   16  269  H2U5L1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101061896 PE=3 SV=1
 1748 : H2U5L3_TAKRU        0.32  0.50   29  175   45  179  152    7   22  276  H2U5L3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101061896 PE=3 SV=1
 1749 : H2UD19_TAKRU        0.32  0.53   29  175   34  174  150    8   12  267  H2UD19     Uncharacterized protein OS=Takifugu rubripes PE=3 SV=1
 1750 : H2ULX8_TAKRU        0.32  0.49   29  175   33  159  148    6   22  255  H2ULX8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071041 PE=3 SV=1
 1751 : H2XL18_CIOIN        0.32  0.57  177  277   62  163  106    3    9  165  H2XL18     Uncharacterized protein OS=Ciona intestinalis PE=3 SV=1
 1752 : H2Z0J2_CIOSA        0.32  0.52   29  170   12  144  145    6   15  253  H2Z0J2     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 1753 : H2ZSM9_LATCH        0.32  0.48   29  152   12  122  125    4   15  190  H2ZSM9     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1754 : H2ZY86_LATCH        0.32  0.54  177  277   73  170  103    3    7  177  H2ZY86     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1755 : H3A3C9_LATCH        0.32  0.47   29  175  402  548  160   11   26  902  H3A3C9     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1756 : H3BFM3_LATCH        0.32  0.47   29  174   32  168  152    6   21  271  H3BFM3     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1757 : H3D344_TETNG        0.32  0.44   29  175   31  169  153    8   20  272  H3D344     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
 1758 : H3GAM1_PHYRM        0.32  0.55  182  276   49  138   98    6   11  146  H3GAM1     Uncharacterized protein OS=Phytophthora ramorum PE=3 SV=1
 1759 : H3GB37_PHYRM        0.32  0.55  182  276   49  138   98    6   11  146  H3GB37     Uncharacterized protein OS=Phytophthora ramorum PE=3 SV=1
 1760 : H9FD78_MACMU        0.32  0.52   32  152    1  115  122    3    8  136  H9FD78     Putative serine protease 41 (Fragment) OS=Macaca mulatta GN=PRSS41 PE=2 SV=1
 1761 : H9G5K5_ANOCA        0.32  0.50   29  175   35  167  148    6   16  265  H9G5K5     Uncharacterized protein OS=Anolis carolinensis GN=CTRL PE=3 SV=2
 1762 : H9GBW9_ANOCA        0.32  0.54   29  173   34  163  145    5   15  263  H9GBW9     Uncharacterized protein OS=Anolis carolinensis GN=LOC100565667 PE=3 SV=1
 1763 : H9GD79_ANOCA        0.32  0.50   29  172   26  149  147    8   26  248  H9GD79     Uncharacterized protein OS=Anolis carolinensis GN=LOC100565795 PE=3 SV=1
 1764 : H9GH72_ANOCA        0.32  0.52   29  172   33  164  147    6   18  276  H9GH72     Uncharacterized protein OS=Anolis carolinensis GN=PRSS56 PE=3 SV=2
 1765 : H9GPR9_ANOCA        0.32  0.51   29  173  163  300  152   10   21  305  H9GPR9     Uncharacterized protein OS=Anolis carolinensis GN=HPN PE=3 SV=2
 1766 : H9K3I0_APIME        0.32  0.47   29  174  109  251  156    9   23  353  H9K3I0     Uncharacterized protein OS=Apis mellifera GN=SP3 PE=3 SV=1
 1767 : H9KQJ3_APIME        0.32  0.50  177  278   24  114  103    4   13  136  H9KQJ3     Uncharacterized protein OS=Apis mellifera PE=3 SV=1
 1768 : I3J3J6_ORENI        0.32  0.51   29  172   32  161  146    6   18  261  I3J3J6     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100707571 PE=3 SV=1
 1769 : I3JZT1_ORENI        0.32  0.50   29  175   23  151  149    7   22  252  I3JZT1     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100700058 PE=3 SV=1
 1770 : I3K150_ORENI        0.32  0.48   29  172   63  197  151    7   23  303  I3K150     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100694176 PE=3 SV=1
 1771 : I3LBF8_PIG          0.32  0.51   29  170    8  137  142    6   12  244  I3LBF8     Uncharacterized protein OS=Sus scrofa GN=LOC100739292 PE=3 SV=1
 1772 : I3LJ52_PIG          0.32  0.50   29  173   34  163  146    6   17  263  I3LJ52     Uncharacterized protein OS=Sus scrofa GN=LOC100621642 PE=3 SV=1
 1773 : I3MWU7_SPETR        0.32  0.47   29  175   29  165  152    7   20  268  I3MWU7     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
 1774 : I3N8I6_SPETR        0.32  0.48   29  175   28  158  148    7   18  300  I3N8I6     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=PRSS46 PE=3 SV=1
 1775 : I3NCW3_SPETR        0.32  0.48   29  171   24  146  143    6   20  246  I3NCW3     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
 1776 : I3NFU5_SPETR        0.32  0.47   29  171   25  147  143    6   20  247  I3NFU5     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
 1777 : I3NI28_HUMAN        0.32  0.53   29  154   34  148  126    4   11  190  I3NI28     Chymotrypsin-like protease CTRL-1 (Fragment) OS=Homo sapiens GN=CTRL PE=3 SV=1
 1778 : I4DKB8_PAPXU        0.32  0.51   29  175   37  175  152    7   18  278  I4DKB8     Clip-domain serine protease, family D OS=Papilio xuthus PE=2 SV=1
 1779 : I4DRP2_PAPPL        0.32  0.51   29  175   68  200  149    7   18  298  I4DRP2     Serine protease (Fragment) OS=Papilio polytes PE=2 SV=1
 1780 : I7I4B9_SCYPA        0.32  0.54   29  175   45  174  149    7   21  270  I7I4B9     Chymotrypsin-like proteinase OS=Scylla paramamosain GN=spchy PE=2 SV=2
 1781 : J9JVY2_ACYPI        0.32  0.51   29  173  143  289  157    8   22  393  J9JVY2     Uncharacterized protein OS=Acyrthosiphon pisum GN=Rps27-2 PE=3 SV=1
 1782 : J9K2F9_ACYPI        0.32  0.51   29  174   37  177  149    7   11  227  J9K2F9     Uncharacterized protein OS=Acyrthosiphon pisum PE=3 SV=2
 1783 : K7EE17_ORNAN        0.32  0.50   29  141   44  150  114    2    8  176  K7EE17     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=3 SV=1
 1784 : K7F422_PELSI        0.32  0.48   29  173  163  300  155   10   27  417  K7F422     Uncharacterized protein OS=Pelodiscus sinensis GN=HPN PE=3 SV=1
 1785 : K7FB25_PELSI        0.32  0.49   29  172   29  161  149    8   21  265  K7FB25     Uncharacterized protein OS=Pelodiscus sinensis GN=CTRC PE=3 SV=1
 1786 : K7FB27_PELSI        0.32  0.49   29  172   29  161  149    8   21  265  K7FB27     Uncharacterized protein OS=Pelodiscus sinensis GN=CTRC PE=3 SV=1
 1787 : K7FB59_PELSI        0.32  0.49   29  174   30  166  149    6   15  228  K7FB59     Uncharacterized protein OS=Pelodiscus sinensis PE=3 SV=1
 1788 : K7FC92_PELSI        0.32  0.51   29  150   53  166  124    5   12  198  K7FC92     Uncharacterized protein OS=Pelodiscus sinensis PE=3 SV=1
 1789 : K7J5J0_NASVI        0.32  0.53  177  272   99  195  101    4    9  201  K7J5J0     Uncharacterized protein OS=Nasonia vitripennis GN=SPH54 PE=3 SV=1
 1790 : K9II38_DESRO        0.32  0.49   29  175   31  166  151   10   19  275  K9II38     Putative trypsin-like serine protease OS=Desmodus rotundus PE=2 SV=1
 1791 : L5KI51_PTEAL        0.32  0.53   29  175   47  181  152    6   22  344  L5KI51     Prostasin OS=Pteropus alecto GN=PAL_GLEAN10011928 PE=3 SV=1
 1792 : L5LHW6_MYODS        0.32  0.50   29  175   34  166  147    5   14  264  L5LHW6     Chymotrypsin-like protease CTRL-1 OS=Myotis davidii GN=MDA_GLEAN10017082 PE=3 SV=1
 1793 : L5LNF6_MYODS        0.32  0.48   29  172   30  163  149    7   20  301  L5LNF6     Chymotrypsin-C OS=Myotis davidii GN=MDA_GLEAN10024336 PE=3 SV=1
 1794 : L5LT73_MYODS        0.32  0.49   29  173  110  247  151   10   19  364  L5LT73     Serine protease hepsin (Fragment) OS=Myotis davidii GN=MDA_GLEAN10008208 PE=3 SV=1
 1795 : L5MBT2_MYODS        0.32  0.45   29  172   31  168  150    6   18  274  L5MBT2     Mastin OS=Myotis davidii GN=MDA_GLEAN10000464 PE=3 SV=1
 1796 : L5MGW5_MYODS        0.32  0.45   29  172   44  173  148    8   22  285  L5MGW5     Kallikrein-13 OS=Myotis davidii GN=MDA_GLEAN10002287 PE=3 SV=1
 1797 : L8HM14_9CETA        0.32  0.50   29  175   16  142  148    6   22  253  L8HM14     Uncharacterized protein (Fragment) OS=Bos mutus GN=M91_17251 PE=3 SV=1
 1798 : L8HNC2_9CETA        0.32  0.50   29  175   16  142  148    6   22  253  L8HNC2     Cationic trypsin (Fragment) OS=Bos mutus GN=M91_15257 PE=3 SV=1
 1799 : L8HNF4_9CETA        0.32  0.55   38  169    1  118  132    5   14  231  L8HNF4     Uncharacterized protein (Fragment) OS=Bos mutus GN=M91_04939 PE=3 SV=1
 1800 : L8HP47_9CETA        0.32  0.45   29  175  528  673  161   13   29  772  L8HP47     Neurotrypsin (Fragment) OS=Bos mutus GN=M91_17480 PE=3 SV=1
 1801 : L8I8C9_9CETA        0.32  0.47   29  171    2  136  150    6   22  269  L8I8C9     Uncharacterized protein (Fragment) OS=Bos mutus GN=M91_11274 PE=3 SV=1
 1802 : L8IIJ4_9CETA        0.32  0.48   29  173  163  300  154    9   25  417  L8IIJ4     Serine protease hepsin OS=Bos mutus GN=M91_10148 PE=3 SV=1
 1803 : L8IM33_9CETA        0.32  0.51   29  173   34  163  146    6   17  263  L8IM33     Uncharacterized protein OS=Bos mutus GN=M91_03440 PE=3 SV=1
 1804 : L8IMV1_9CETA        0.32  0.51   29  173   34  163  146    6   17  263  L8IMV1     Chymotrypsinogen B OS=Bos mutus GN=M91_03442 PE=3 SV=1
 1805 : M1ECY1_MUSPF        0.32  0.49  182  278   23  118  100    4    7  164  M1ECY1     Acrosin (Fragment) OS=Mustela putorius furo PE=2 SV=1
 1806 : M3WDH4_FELCA        0.32  0.57   29  175   33  165  150    9   20  311  M3WDH4     Uncharacterized protein (Fragment) OS=Felis catus GN=PRSS55 PE=3 SV=1
 1807 : M3WFX9_FELCA        0.32  0.51   29  171   34  156  144    7   22  256  M3WFX9     Uncharacterized protein (Fragment) OS=Felis catus GN=LOC101085707 PE=3 SV=1
 1808 : M3X8Q2_FELCA        0.32  0.52   29  174   30  159  148    9   20  297  M3X8Q2     Uncharacterized protein (Fragment) OS=Felis catus GN=PRSS46 PE=3 SV=1
 1809 : M3XR02_MUSPF        0.32  0.50   29  175   38  167  149    6   21  313  M3XR02     Uncharacterized protein OS=Mustela putorius furo GN=KLK12 PE=3 SV=1
 1810 : M3YAT9_MUSPF        0.32  0.50   29  171   24  146  144    7   22  247  M3YAT9     Uncharacterized protein OS=Mustela putorius furo PE=3 SV=1
 1811 : M3YB18_MUSPF        0.32  0.51   29  172   24  147  145    6   22  246  M3YB18     Uncharacterized protein OS=Mustela putorius furo PE=3 SV=1
 1812 : M3Z995_NOMLE        0.32  0.47   29  171   21  143  144    7   22  244  M3Z995     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=LOC100592228 PE=3 SV=1
 1813 : M3ZGW8_XIPMA        0.32  0.49   29  172   29  163  151    7   23  269  M3ZGW8     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 1814 : M4A758_XIPMA        0.32  0.54  180  277   49  143  104    8   15  145  M4A758     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 1815 : M4AQC9_XIPMA        0.32  0.46   29  172   28  160  149    8   21  266  M4AQC9     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 1816 : M7AQ03_CHEMY        0.32  0.50   29  172   18  154  151    6   21  255  M7AQ03     Proproteinase E (Fragment) OS=Chelonia mydas GN=UY3_18082 PE=3 SV=1
 1817 : M7BKY1_CHEMY        0.32  0.48   29  175 1151 1291  160   13   32 1389  M7BKY1     Transmembrane protease serine 7 OS=Chelonia mydas GN=UY3_04924 PE=3 SV=1
 1818 : NETR_SAGLB          0.32  0.47   29  175  631  776  160   12   27  875  Q5G265     Neurotrypsin OS=Saguinus labiatus GN=PRSS12 PE=3 SV=1
 1819 : O42158_PETMA        0.32  0.52   29  175   24  152  149    7   22  247  O42158     Trypsinogen a2 (Precursor) OS=Petromyzon marinus GN=TRYPA2 PE=2 SV=1
 1820 : O42608_PETMA        0.32  0.52   29  175   24  152  149    7   22  247  O42608     Trypsinogen A1 (Precursor) OS=Petromyzon marinus GN=TRYPA3 PE=2 SV=1
 1821 : O93266_PSEAM        0.32  0.50   29  175   21  147  149    7   24  242  O93266     Trypsinogen 2 (Precursor) OS=Pseudopleuronectes americanus GN=TRP2 PE=2 SV=1
 1822 : O93594_DICLA        0.32  0.52   43  171    1  109  130    6   22  178  O93594     Trypsin (Fragment) OS=Dicentrarchus labrax PE=2 SV=1
 1823 : PLMN_SHEEP          0.32  0.49   29  175  114  243  149    8   21  343  P81286     Plasminogen (Fragment) OS=Ovis aries GN=PLG PE=1 SV=1
 1824 : PRS48_HUMAN         0.32  0.51   29  175   28  159  151   10   23  328  Q7RTY5     Serine protease 48 OS=Homo sapiens GN=PRSS48 PE=2 SV=2
 1825 : Q05AI9_DANRE        0.32  0.50   29  175   36  169  148    5   15  301  Q05AI9     Zgc:153968 OS=Danio rerio GN=zgc:153968 PE=2 SV=1
 1826 : Q05AV3_XENLA        0.32  0.50   29  171   22  144  145    8   24  244  Q05AV3     LOC397853 protein OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
 1827 : Q0GYP4_SPAAU        0.32  0.52   29  175   21  147  148    8   22  241  Q0GYP4     Trypsinogen II OS=Sparus aurata GN=TRPII PE=2 SV=1
 1828 : Q0IF78_AEDAE        0.32  0.52   29  174   29  159  148    7   19  265  Q0IF78     AAEL006427-PA OS=Aedes aegypti GN=AAEL006427 PE=3 SV=1
 1829 : Q0IF79_AEDAE        0.32  0.51   29  174   29  159  148    6   19  256  Q0IF79     AAEL006429-PA OS=Aedes aegypti GN=AAEL006429 PE=3 SV=1
 1830 : Q0PG34_9TELE        0.32  0.50   29  175   24  150  148    6   22  246  Q0PG34     Trypsin OS=Spinibarbus sinensis PE=2 SV=1
 1831 : Q16G08_AEDAE        0.32  0.52   29  175   84  217  149    6   17  328  Q16G08     AAEL014570-PA OS=Aedes aegypti GN=AAEL014570 PE=3 SV=1
 1832 : Q16HJ5_AEDAE        0.32  0.50   29  173   48  199  157    9   17  305  Q16HJ5     AAEL014005-PA OS=Aedes aegypti GN=AAEL014005 PE=3 SV=1
 1833 : Q16L17_AEDAE        0.32  0.52   29  175   94  229  150    6   17  229  Q16L17     AAEL012798-PA (Fragment) OS=Aedes aegypti GN=AAEL012798 PE=3 SV=1
 1834 : Q16PR8_AEDAE        0.32  0.51   29  172   24  153  145    6   16  248  Q16PR8     AAEL011553-PA OS=Aedes aegypti GN=AAEL011553 PE=3 SV=1
 1835 : Q17035_ANOGA        0.32  0.53   29  174    1  128  146    5   18  237  Q17035     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
 1836 : Q171W1_AEDAE        0.32  0.48   29  175   10  143  148    5   15  247  Q171W1     AAEL007514-PA (Fragment) OS=Aedes aegypti GN=AAEL007514 PE=3 SV=1
 1837 : Q175S3_AEDAE        0.32  0.50   29  173   39  190  157    9   17  327  Q175S3     AAEL006576-PB OS=Aedes aegypti GN=AAEL006576 PE=3 SV=1
 1838 : Q175S4_AEDAE        0.32  0.50   29  173   48  199  157    9   17  336  Q175S4     AAEL006576-PA OS=Aedes aegypti GN=AAEL006576 PE=3 SV=1
 1839 : Q17BS3_AEDAE        0.32  0.47   29  172   31  161  148    9   21  270  Q17BS3     AAEL004885-PA OS=Aedes aegypti GN=AAEL004885 PE=3 SV=1
 1840 : Q19MT4_BUBBU        0.32  0.53   29  172    1  134  145    5   12  235  Q19MT4     Enterokinase light chain (Fragment) OS=Bubalus bubalis PE=2 SV=1
 1841 : Q1AMP9_DISMA        0.32  0.52   29  175   21  147  149    8   24  242  Q1AMP9     Trypsinogen OS=Dissostichus mawsoni GN=AFGP PE=2 SV=1
 1842 : Q1JPZ1_DANRE        0.32  0.53   29  170   34  160  146    7   23  263  Q1JPZ1     Zgc:136461 OS=Danio rerio GN=zgc:136461 PE=2 SV=1
 1843 : Q25227_LUCCU        0.32  0.48   29  175   21  156  150    7   17  255  Q25227     Chymotrypsinogen (Precursor) OS=Lucilia cuprina PE=2 SV=1
 1844 : Q28EV7_XENTR        0.32  0.53   29  175   38  172  149    8   16  314  Q28EV7     Novel protein containing trypsin domain OS=Xenopus tropicalis GN=TGas071o04.1-001 PE=2 SV=1
 1845 : Q298Z8_DROPS        0.32  0.45   29  172   67  203  152    8   23  315  Q298Z8     GA11230 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA11230 PE=3 SV=2
 1846 : Q3B856_MOUSE        0.32  0.50   29  175   19  146  149    9   23  253  Q3B856     Klk15 protein (Fragment) OS=Mus musculus GN=Klk15 PE=2 SV=1
 1847 : Q3SY20_HUMAN        0.32  0.50   29  171   24  146  145    8   24  247  Q3SY20     Protease, serine, 2 (Trypsin 2) OS=Homo sapiens GN=PRSS2 PE=2 SV=1
 1848 : Q4ADV4_SERQU        0.32  0.49   29  175   21  147  149    7   24  242  Q4ADV4     Trypsinogen OS=Seriola quinqueradiata PE=2 SV=1
 1849 : Q4RH74_TETNG        0.32  0.53   29  175   11  142  148    6   17  234  Q4RH74     Chromosome undetermined SCAF15067, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00034480001 PE=3 SV=1
 1850 : Q4RVI8_TETNG        0.32  0.53   29  175    2  139  150    5   15  233  Q4RVI8     Chromosome 15 SCAF14992, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00028309001 PE=3 SV=1
 1851 : Q4S850_TETNG        0.32  0.44   29  175   31  166  152    7   21  269  Q4S850     Chromosome 9 SCAF14710, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00022509001 PE=3 SV=1
 1852 : Q4TBY8_TETNG        0.32  0.49   29  175  199  339  155    6   22  435  Q4TBY8     Chromosome undetermined SCAF7069, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00003546001 PE=3 SV=1
 1853 : Q4V9I6_DANRE        0.32  0.51   29  175   59  204  155    9   17  316  Q4V9I6     Uncharacterized protein OS=Danio rerio GN=zgc:112285 PE=2 SV=1
 1854 : Q502L4_DANRE        0.32  0.59   31  175   37  170  148    9   17  311  Q502L4     Zgc:112038 OS=Danio rerio GN=zgc:112038 PE=2 SV=1
 1855 : Q547S4_BOVIN        0.32  0.48   29  171   24  146  145    8   24  247  Q547S4     Pancreatic anionic trypsinogen OS=Bos taurus GN=TRYP8 PE=3 SV=1
 1856 : Q561Z7_DANRE        0.32  0.49   29  175   25  151  148    6   22  247  Q561Z7     Try protein OS=Danio rerio GN=try PE=2 SV=1
 1857 : Q58E07_XENLA        0.32  0.55   29  175   37  171  148    6   14  290  Q58E07     LOC733183 protein (Fragment) OS=Xenopus laevis GN=LOC733183 PE=2 SV=1
 1858 : Q5BAR4_EMENI        0.32  0.50   29  175   23  153  147    5   16  249  Q5BAR4     Serine protease similarity, trypsin family (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2366.2 PE=3 SV=1
 1859 : Q5EBE2_XENTR        0.32  0.50   29  171   22  144  145    8   24  244  Q5EBE2     MGC108396 protein OS=Xenopus tropicalis GN=prss1 PE=2 SV=1
 1860 : Q5H731_MACMU        0.32  0.52   29  171   24  146  144    7   22  247  Q5H731     Try12 OS=Macaca mulatta GN=try12 PE=3 SV=1
 1861 : Q5M8V7_XENTR        0.32  0.48   29  175   25  165  152    6   16  266  Q5M8V7     LOC496680 protein (Fragment) OS=Xenopus tropicalis GN=LOC496680 PE=2 SV=1
 1862 : Q5NV56_HUMAN        0.32  0.50   29  171   24  146  145    8   24  247  Q5NV56     Anionic trypsinogen OS=Homo sapiens GN=TRY8 PE=2 SV=1
 1863 : Q5TWE1_ANOGA        0.32  0.53   29  175   33  162  147    8   17  258  Q5TWE1     AGAP006710-PA OS=Anopheles gambiae GN=AGAP006710 PE=3 SV=1
 1864 : Q5XIZ0_DANRE        0.32  0.52   29  175   21  151  148    7   18  247  Q5XIZ0     Zgc:92590 OS=Danio rerio GN=zgc:92590 PE=2 SV=1
 1865 : Q63ZI1_XENLA        0.32  0.49  177  278  117  204  104    7   18  210  Q63ZI1     LOC494802 protein OS=Xenopus laevis GN=gzmh PE=2 SV=1
 1866 : Q6AZC2_DANRE        0.32  0.52   29  170   30  156  146    7   23  259  Q6AZC2     LOC562139 protein (Fragment) OS=Danio rerio GN=LOC562139 PE=2 SV=1
 1867 : Q6GNK3_XENLA        0.32  0.55   29  175   41  175  148    6   14  321  Q6GNK3     MGC82715 protein OS=Xenopus laevis GN=MGC82715 PE=2 SV=1
 1868 : Q6GQE9_XENLA        0.32  0.50   29  172   29  162  151    8   24  268  Q6GQE9     MGC80117 protein OS=Xenopus laevis GN=ctrc PE=2 SV=1
 1869 : Q6IRA4_XENLA        0.32  0.50   29  175   29  163  149    9   16  328  Q6IRA4     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
 1870 : Q6PGS4_XENLA        0.32  0.50   29  173   34  163  146    5   17  263  Q6PGS4     MGC64417 protein OS=Xenopus laevis GN=ctrb1 PE=2 SV=1
 1871 : Q7PQB3_ANOGA        0.32  0.52   29  175   85  213  147    5   18  321  Q7PQB3     AGAP004567-PA OS=Anopheles gambiae GN=AgaP_AGAP004567 PE=3 SV=5
 1872 : Q7Q526_ANOGA        0.32  0.51   29  175   25  163  152   10   18  268  Q7Q526     AGAP006676-PA OS=Anopheles gambiae GN=AGAP006676 PE=3 SV=4
 1873 : Q7Q9W5_ANOGA        0.32  0.52   29  175   83  216  149    7   17  327  Q7Q9W5     AGAP004566-PA OS=Anopheles gambiae GN=AgaP_AGAP004566 PE=3 SV=5
 1874 : Q7QJ37_ANOGA        0.32  0.52   29  175   64  202  153    8   20  305  Q7QJ37     AGAP007252-PA OS=Anopheles gambiae GN=AGAP007252 PE=3 SV=4
 1875 : Q7SX90_DANRE        0.32  0.52   29  175   21  147  148    8   22  242  Q7SX90     Zgc:66382 OS=Danio rerio GN=zgc:66382 PE=2 SV=1
 1876 : Q7SYS4_XENLA        0.32  0.50   29  175   34  165  151    7   23  263  Q7SYS4     MGC64534 protein OS=Xenopus laevis GN=ctrl PE=2 SV=1
 1877 : Q7T1R8_9TELE        0.32  0.50   29  175   21  147  149    8   24  242  Q7T1R8     Trypsinogen OS=Pangasianodon hypophthalmus PE=2 SV=1
 1878 : Q7Z5F4_HUMAN        0.32  0.48   29  171   38  160  143    6   20  261  Q7Z5F4     Protease serine 4 isoform B OS=Homo sapiens PE=2 SV=1
 1879 : Q8C1L4_MOUSE        0.32  0.55   29  175   45  179  149    7   16  255  Q8C1L4     Putative uncharacterized protein OS=Mus musculus GN=Prss8 PE=2 SV=1
 1880 : Q8CGR4_MOUSE        0.32  0.50   29  175   20  147  149    9   23  254  Q8CGR4     Kallikrein related-peptidase 15 OS=Mus musculus GN=Klk15 PE=2 SV=1
 1881 : Q8N2U3_HUMAN3L3T    0.32  0.49   29  171   28  150  143    6   20  251  Q8N2U3     PRSS3 protein (Fragment) OS=Homo sapiens GN=PRSS3 PE=2 SV=1
 1882 : Q8WVC1_HUMAN3P8F    0.32  0.49   29  173  182  321  156    8   27  422  Q8WVC1     ST14 protein (Fragment) OS=Homo sapiens GN=ST14 PE=2 SV=1
 1883 : Q91039_GADMO        0.32  0.49   29  172   29  163  148    6   17  270  Q91039     Elastase A (Precursor) OS=Gadus morhua GN=elA PE=2 SV=1
 1884 : Q91515_TAKRU        0.32  0.53   29  175   16  142  148    7   22  237  Q91515     Trypsinogen (Fragment) OS=Takifugu rubripes PE=2 SV=1
 1885 : Q91Y82_MOUSE        0.32  0.55   29  175   29  156  148    7   21  253  Q91Y82     Kallikrein 6, isoform CRA_a OS=Mus musculus GN=Klk6 PE=2 SV=1
 1886 : Q92077_GADMO        0.32  0.47   29  172   28  160  148    6   19  266  Q92077     Elastase (Precursor) OS=Gadus morhua GN=elB PE=2 SV=1
 1887 : Q92099_PARMG        0.32  0.51   29  175   21  147  149    7   24  242  Q92099     Trypsin (Precursor) OS=Paranotothenia magellanica PE=2 SV=1
 1888 : Q921N4_MOUSE        0.32  0.52   29  175   29  164  151    8   19  273  Q921N4     Tryptase alpha/beta 1 OS=Mus musculus GN=Tpsab1 PE=2 SV=1
 1889 : Q98TG9_9TELE        0.32  0.51   29  175   20  146  149    8   24  241  Q98TG9     Trypsinogen II OS=Engraulis japonicus GN=aTryII PE=2 SV=1
 1890 : Q9D7P8_MOUSE        0.32  0.51   29  174   34  165  146    6   14  264  Q9D7P8     Putative uncharacterized protein OS=Mus musculus GN=Ctrl PE=2 SV=1
 1891 : Q9D7Y7_MOUSE        0.32  0.47   30  172   26  148  144    6   22  247  Q9D7Y7     Putative uncharacterized protein OS=Mus musculus GN=2210010C04Rik PE=2 SV=1
 1892 : Q9ER05_MOUSE        0.32  0.51   29  174   34  165  146    6   14  264  Q9ER05     Chymopasin OS=Mus musculus GN=Ctrl PE=2 SV=1
 1893 : Q9GSM5_CHRBE        0.32  0.47   37  156    1  107  120    1   13  181  Q9GSM5     Serine protease K17/F1R1 (Fragment) OS=Chrysomya bezziana PE=2 SV=1
 1894 : Q9W7Q0_PAROL        0.32  0.45   29  175   28  163  152    8   21  266  Q9W7Q0     Elastase 3 OS=Paralichthys olivaceus PE=2 SV=2
 1895 : Q9W7Q7_PAROL        0.32  0.50   29  175   21  147  149    7   24  242  Q9W7Q7     Trypsinogen 1 OS=Paralichthys olivaceus PE=2 SV=1
 1896 : Q9XY57_CTEFE        0.32  0.51   29  175  146  284  154    8   22  387  Q9XY57     Trypsin-like serine protease OS=Ctenocephalides felis GN=SP-33 PE=2 SV=1
 1897 : R0LET7_ANAPL        0.32  0.46   29  175   16  153  151    5   17  252  R0LET7     Elastase-2A (Fragment) OS=Anas platyrhynchos GN=Anapl_03385 PE=3 SV=1
 1898 : R4FPB3_RHOPR        0.32  0.48  182  276   95  195  104    4   12  199  R4FPB3     Putative trypsin-like serine protease (Fragment) OS=Rhodnius prolixus PE=2 SV=1
 1899 : R4QR01_BOSIN        0.32  0.54   29  172    1  134  145    5   12  235  R4QR01     Enterokinase catalytic light chain (Fragment) OS=Bos indicus PE=2 SV=1
 1900 : R9TFT7_ACAPC        0.32  0.48   29  175   38  174  150    7   16  269  R9TFT7     Trypsin OS=Acartia pacifica PE=2 SV=1
 1901 : S4RKI2_PETMA        0.32  0.45   29  170   25  149  146    8   25  254  S4RKI2     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (3 of 11) PE=3 SV=1
 1902 : S4RKU6_PETMA        0.32  0.45   29  170   19  143  143    7   19  248  S4RKU6     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (4 of 11) PE=3 SV=1
 1903 : S4RVC1_PETMA        0.32  0.50   29  175   22  152  150   10   22  236  S4RVC1     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 1904 : S4RXQ6_PETMA        0.32  0.45   29  170   29  153  146    8   25  258  S4RXQ6     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (5 of 11) PE=3 SV=1
 1905 : S4RXS3_PETMA        0.32  0.45   29  170   36  160  146    8   25  265  S4RXS3     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (6 of 11) PE=3 SV=1
 1906 : S4RXU2_PETMA        0.32  0.45   29  170   32  156  146    8   25  265  S4RXU2     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (8 of 11) PE=3 SV=1
 1907 : S4RXU3_PETMA        0.32  0.45   29  170   34  158  146    8   25  263  S4RXU3     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (9 of 11) PE=3 SV=1
 1908 : S4RXU6_PETMA        0.32  0.46   29  172   33  159  145    7   19  263  S4RXU6     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (10 of 11) PE=3 SV=1
 1909 : S7N918_MYOBR        0.32  0.45   29  172   44  173  148    8   22  285  S7N918     Kallikrein-13 OS=Myotis brandtii GN=D623_10004530 PE=3 SV=1
 1910 : S7NSX8_MYOBR        0.32  0.50   29  175   29  166  151    6   17  269  S7NSX8     Chymotrypsin-like elastase family member 2A OS=Myotis brandtii GN=D623_10010494 PE=3 SV=1
 1911 : S7PZP9_MYOBR        0.32  0.50   29  175   38  170  147    5   14  268  S7PZP9     Chymotrypsin-like protease CTRL-1 OS=Myotis brandtii GN=D623_10015092 PE=3 SV=1
 1912 : S9WBW2_9CETA        0.32  0.42   38  175    7  129  139    5   17  229  S9WBW2     Transmembrane protease serine 11F OS=Camelus ferus GN=CB1_002532001 PE=3 SV=1
 1913 : S9X9I0_9CETA        0.32  0.51   29  170   34  160  146    7   23  263  S9X9I0     Chymotrypsinogen B isoform 3-like protein OS=Camelus ferus GN=CB1_000407010 PE=3 SV=1
 1914 : S9X9I7_9CETA        0.32  0.52   29  173   34  163  146    6   17  235  S9X9I7     Chymotrypsinogen B OS=Camelus ferus GN=CB1_000407009 PE=3 SV=1
 1915 : S9XB36_9CETA        0.32  0.49   29  175   31  166  148    6   13  300  S9XB36     Tryptase beta-2 OS=Camelus ferus GN=CB1_090697001 PE=3 SV=1
 1916 : T1EJ18_HELRO        0.32  0.49   29  170   10  146  145    6   11  260  T1EJ18     Uncharacterized protein (Fragment) OS=Helobdella robusta GN=HELRODRAFT_140768 PE=3 SV=1
 1917 : T1G3B6_HELRO        0.32  0.57   29  150    1  115  122    3    7  140  T1G3B6     Uncharacterized protein (Fragment) OS=Helobdella robusta GN=HELRODRAFT_78428 PE=3 SV=1
 1918 : T1HXG3_RHOPR        0.32  0.51  188  278   26  117   98    4   13  118  T1HXG3     Uncharacterized protein OS=Rhodnius prolixus PE=3 SV=1
 1919 : T1IGA4_RHOPR        0.32  0.53   29  175   36  178  154    8   18  286  T1IGA4     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
 1920 : T1IV59_STRMM        0.32  0.53   29  175   23  165  154    8   18  290  T1IV59     Uncharacterized protein (Fragment) OS=Strigamia maritima PE=3 SV=1
 1921 : T1L3I2_TETUR        0.32  0.50   32  174   31  158  145    6   19  263  T1L3I2     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 1922 : T1PN85_MUSDO        0.32  0.58  178  278  113  220  111    4   13  222  T1PN85     Trypsin (Fragment) OS=Musca domestica PE=2 SV=1
 1923 : TEST_HUMAN          0.32  0.50   29  175   42  182  154    9   20  314  Q9Y6M0     Testisin OS=Homo sapiens GN=PRSS21 PE=1 SV=1
 1924 : TRY1_BOVIN  2D8W    0.32  0.50   29  175   24  150  148    6   22  246  P00760     Cationic trypsin OS=Bos taurus PE=1 SV=3
 1925 : TRY1_CHICK          0.32  0.52   29  172   26  149  145    6   22  248  Q90627     Trypsin I-P1 OS=Gallus gallus PE=2 SV=1
 1926 : TRY1_RAT            0.32  0.50   29  171   24  146  145    8   24  246  P00762     Anionic trypsin-1 OS=Rattus norvegicus GN=Prss1 PE=1 SV=1
 1927 : TRY1_SALSA  2TBS    0.32  0.50   29  175   21  147  149    7   24  242  P35031     Trypsin-1 OS=Salmo salar PE=1 SV=1
 1928 : TRY2_BOVIN          0.32  0.48   29  171   24  146  145    8   24  247  Q29463     Anionic trypsin OS=Bos taurus PE=2 SV=1
 1929 : TRY2_CHICK          0.32  0.52   29  172   26  149  145    6   22  248  Q90628     Trypsin I-P38 OS=Gallus gallus PE=2 SV=1
 1930 : TRY2_HUMAN          0.32  0.50   29  171   24  146  145    8   24  247  P07478     Trypsin-2 OS=Homo sapiens GN=PRSS2 PE=1 SV=1
 1931 : TRY2_SALSA          0.32  0.52   29  175   10  136  149    8   24  231  P35032     Trypsin-2 (Fragment) OS=Salmo salar PE=2 SV=1
 1932 : TRY2_XENLA          0.32  0.50   29  171   22  144  145    8   24  244  P70059     Trypsin OS=Xenopus laevis PE=2 SV=1
 1933 : TRY3_CHICK          0.32  0.47   29  172   26  149  146    7   24  248  Q90629     Trypsin II-P29 OS=Gallus gallus PE=2 SV=1
 1934 : TRY3_RAT            0.32  0.49   29  171   25  147  144    7   22  247  P08426     Cationic trypsin-3 OS=Rattus norvegicus GN=Try3 PE=2 SV=1
 1935 : TRYB1_MOUSE         0.32  0.52   29  175   29  164  151    8   19  273  Q02844     Tryptase OS=Mus musculus GN=Tpsab1 PE=2 SV=1
 1936 : TRYB2_MOUSE         0.32  0.50   29  175   32  167  149    8   15  276  P21845     Tryptase beta-2 OS=Mus musculus GN=Tpsb2 PE=1 SV=2
 1937 : TRYB2_RAT           0.32  0.49   29  175   30  165  149    8   15  274  P50343     Tryptase beta-2 OS=Rattus norvegicus GN=Tpsb2 PE=2 SV=1
 1938 : TRYD_HUMAN          0.32  0.50   29  175   38  173  149    8   15  242  Q9BZJ3     Tryptase delta OS=Homo sapiens GN=TPSD1 PE=1 SV=2
 1939 : TRYG1_HUMAN         0.32  0.48   29  175   38  170  149    7   18  321  Q9NRR2     Tryptase gamma OS=Homo sapiens GN=TPSG1 PE=2 SV=3
 1940 : TRYP_PIG    1AN1    0.32  0.49   29  175    9  135  148    7   22  231  P00761     Trypsin OS=Sus scrofa PE=1 SV=1
 1941 : U3I9W7_ANAPL        0.32  0.50   29  171   26  148  145    8   24  248  U3I9W7     Uncharacterized protein OS=Anas platyrhynchos PE=3 SV=1
 1942 : U3JQ75_FICAL        0.32  0.47   29  172   38  161  146    7   24  260  U3JQ75     Uncharacterized protein (Fragment) OS=Ficedula albicollis PE=3 SV=1
 1943 : U3JSH2_FICAL        0.32  0.48   29  174   43  180  154   10   24  380  U3JSH2     Uncharacterized protein OS=Ficedula albicollis PE=3 SV=1
 1944 : U5ENX1_9DIPT        0.32  0.47   29  170   26  155  146    6   20  259  U5ENX1     Putative trypsin-like serine protease OS=Corethrella appendiculata PE=2 SV=1
 1945 : U5EYM3_9DIPT        0.32  0.51   29  175   35  183  160    7   24  624  U5EYM3     Putative trypsin-like serine protease OS=Corethrella appendiculata PE=2 SV=1
 1946 : U6DCB8_NEOVI        0.32  0.50  182  278   32  127  100    4    7  194  U6DCB8     Acrosin (Fragment) OS=Neovison vison GN=ACRO PE=2 SV=1
 1947 : V3ZI81_LOTGI        0.32  0.49  177  278   50  147  106    6   12  167  V3ZI81     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_122304 PE=3 SV=1
 1948 : V4B1X0_LOTGI        0.32  0.49   29  171    3  148  152    6   15  262  V4B1X0     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_111620 PE=3 SV=1
 1949 : V4BAS1_LOTGI        0.32  0.53   29  175    4  134  149    8   20  247  V4BAS1     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_135842 PE=3 SV=1
 1950 : V4BRC2_LOTGI        0.32  0.45   29  170   39  173  149    9   21  277  V4BRC2     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_105275 PE=3 SV=1
 1951 : V5G7E0_ANOGL        0.32  0.54  179  277   30  131  106    4   11  132  V5G7E0     Serine protease (Fragment) OS=Anoplophora glabripennis GN=EAST PE=3 SV=1
 1952 : V5GS76_ANOGL        0.32  0.49   29  174   39  171  147    6   15  280  V5GS76     Chymotrypsin BII OS=Anoplophora glabripennis GN=CTRB2 PE=3 SV=1
 1953 : V5HPV4_IXORI        0.32  0.51   29  175  193  329  152    9   20  356  V5HPV4     Putative serine protease OS=Ixodes ricinus PE=2 SV=1
 1954 : V5I3H7_IXORI        0.32  0.55  177  277  106  203  105    5   11  203  V5I3H7     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
 1955 : V8NT74_OPHHA        0.32  0.49   29  174   16  154  149    6   13  225  V8NT74     Transmembrane protease serine 12 (Fragment) OS=Ophiophagus hannah GN=TMPRSS12 PE=3 SV=1
 1956 : V9IH70_APICE        0.32  0.56  177  277   32  130  104    4    8  136  V9IH70     Hepatocyte growth factor activator OS=Apis cerana GN=ACCB06814 PE=2 SV=1
 1957 : V9KKL1_CALMI        0.32  0.49   29  174  129  272  160    9   30  372  V9KKL1     Urokinase-type plasminogen activator-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
 1958 : V9LK96_CALMI        0.32  0.52   29  146   17  122  118    3   12  122  V9LK96     Transmembrane protease serine 9-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
 1959 : W4WTJ4_ATTCE        0.32  0.53   29  175   85  218  151    9   21  322  W4WTJ4     Uncharacterized protein OS=Atta cephalotes PE=3 SV=1
 1960 : W4Y3B9_STRPU        0.32  0.50   29  172   39  180  151   10   16  297  W4Y3B9     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Tmprss4 PE=3 SV=1
 1961 : W4ZJX8_STRPU        0.32  0.48   29  175   70  213  157   13   23  342  W4ZJX8     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Tmprss3_1 PE=3 SV=1
 1962 : W5JI12_ANODA        0.32  0.52   29  174   54  184  148    8   19  299  W5JI12     Oviductin OS=Anopheles darlingi GN=AND_005378 PE=3 SV=1
 1963 : W5K9Q4_ASTMX        0.32  0.48   29  175  226  356  154   11   30  456  W5K9Q4     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1964 : W5L7A7_ASTMX        0.32  0.49   29  175   21  147  149    7   24  242  W5L7A7     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1965 : W5L7B3_ASTMX        0.32  0.49   29  175   34  160  149    7   24  255  W5L7B3     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=3 SV=1
 1966 : W5LAZ9_ASTMX        0.32  0.52   29  175   62  207  155    9   17  319  W5LAZ9     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=3 SV=1
 1967 : W5LP66_ASTMX        0.32  0.60   29  175   38  171  149    7   17  324  W5LP66     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1968 : W5LTT6_ASTMX        0.32  0.52   29  175   25  151  148    7   22  247  W5LTT6     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1969 : W5LTU4_ASTMX        0.32  0.50   29  175   25  151  148    6   22  247  W5LTU4     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 1970 : W5LV78_LEPOC        0.32  0.54   29  175   35  169  150    9   18  324  W5LV78     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 1971 : W5LV95_LEPOC        0.32  0.55   29  172   33  162  148    9   22  302  W5LV95     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 1972 : W5M919_LEPOC        0.32  0.52   29  175   34  166  148    7   16  265  W5M919     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 1973 : W5MA62_LEPOC        0.32  0.50   29  175  396  546  160    6   22  646  W5MA62     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 1974 : W5MU78_LEPOC        0.32  0.51   29  175  198  336  154   10   22  442  W5MU78     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 1975 : W5N5G3_LEPOC        0.32  0.52   29  175   31  176  155    9   17  284  W5N5G3     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 1976 : W5PBK4_SHEEP        0.32  0.53   30  173   44  170  148    8   25  311  W5PBK4     Uncharacterized protein OS=Ovis aries GN=PRSS46 PE=3 SV=1
 1977 : W5UFS5_ICTPU        0.32  0.55   29  175   38  169  148    6   17  305  W5UFS5     Tryptase OS=Ictalurus punctatus GN=MCT7 PE=2 SV=1
 1978 : W6MEV6_9EUCA        0.32  0.51  187  277   10   99   92    3    3   99  W6MEV6     Prophenoloxidase-activating-factor-like-1 protein (Fragment) OS=Coenobita clypeatus PE=3 SV=1
 1979 : W6MEV7_9EUCA        0.32  0.52  182  278   33  133  105    4   12  143  W6MEV7     Prophenoloxidase-activating-factor-like-6 protein (Fragment) OS=Coenobita clypeatus PE=3 SV=1
 1980 : W8BRV0_CERCA        0.32  0.52  177  278  141  250  114    8   16  252  W8BRV0     Serine protease easter OS=Ceratitis capitata GN=EAST PE=2 SV=1
 1981 : A0EZX7_PSEMX        0.31  0.43   29  149   15  122  121    2   13  184  A0EZX7     Trypsinogen (Fragment) OS=Psetta maxima PE=2 SV=1
 1982 : A1KXH3_DERFA        0.31  0.46   29  175   28  158  150    9   22  259  A1KXH3     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
 1983 : A5PJB4_BOVIN        0.31  0.47   29  171   24  146  145    8   24  247  A5PJB4     PRSS2 protein OS=Bos taurus GN=PRSS2 PE=2 SV=1
 1984 : A6FHJ8_9GAMM        0.31  0.46   29  170   24  156  149   11   23  322  A6FHJ8     Hypothetical trypsin-like serine protease OS=Moritella sp. PE36 GN=PE36_11752 PE=3 SV=1
 1985 : A6QQ05_BOVIN        0.31  0.50   29  175   27  162  150    9   17  271  A6QQ05     TPSB1 protein OS=Bos taurus GN=TPSB1 PE=2 SV=1
 1986 : A6QQ95_BOVIN        0.31  0.50   29  175   24  151  148    7   21  246  A6QQ95     KLK6 protein OS=Bos taurus GN=KLK6 PE=2 SV=1
 1987 : A7S5M4_NEMVE        0.31  0.46   29  175   13  148  148    6   13  249  A7S5M4     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g105460 PE=3 SV=1
 1988 : A7S8Y5_NEMVE        0.31  0.50   29  175    4  140  147    3   10  240  A7S8Y5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109239 PE=3 SV=1
 1989 : A7SNZ6_NEMVE        0.31  0.53   29  173    3  150  154   10   15  268  A7SNZ6     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g125541 PE=3 SV=1
 1990 : A7UNT7_DERPT        0.31  0.48   29  175   30  160  149    8   20  261  A7UNT7     Der p 3 allergen OS=Dermatophagoides pteronyssinus PE=2 SV=1
 1991 : A7VMR4_SOLSE        0.31  0.50   29  175   21  147  149    7   24  242  A7VMR4     Trypsinogen 1a OS=Solea senegalensis GN=TRP1a PE=2 SV=1
 1992 : A8DZF9_DANRE        0.31  0.51   29  175   20  146  148    8   22  242  A8DZF9     Uncharacterized protein OS=Danio rerio GN=zgc:171509 PE=3 SV=1
 1993 : A8KB66_DANRE        0.31  0.51   29  175   31  163  147    4   14  260  A8KB66     Zgc:171592 protein OS=Danio rerio GN=zgc:171592 PE=2 SV=1
 1994 : A8QL65_LOCMI        0.31  0.50   29  175   10  146  149    6   14  244  A8QL65     Trypsin-like serine protease (Fragment) OS=Locusta migratoria manilensis GN=TSP PE=2 SV=1
 1995 : ACRO_MOUSE          0.31  0.48   29  174   43  188  157   10   22  436  P23578     Acrosin OS=Mus musculus GN=Acr PE=2 SV=1
 1996 : ACRO_PIG    1FIZ    0.31  0.45   29  174   40  185  160   12   28  415  P08001     Acrosin OS=Sus scrofa GN=ACR PE=1 SV=5
 1997 : B0WAI9_CULQU        0.31  0.47   29  175   21  154  149    6   17  258  B0WAI9     Coagulation factor XI OS=Culex quinquefasciatus GN=CpipJ_CPIJ004093 PE=3 SV=1
 1998 : B0WB63_CULQU        0.31  0.50   29  173   72  214  156    8   24  325  B0WB63     Serine protease OS=Culex quinquefasciatus GN=CpipJ_CPIJ004305 PE=3 SV=1
 1999 : B0WBU1_CULQU        0.31  0.53   29  175   32  160  148    8   20  264  B0WBU1     Trypsin 5G1 OS=Culex quinquefasciatus GN=CpipJ_CPIJ004640 PE=3 SV=1
 2000 : B0WH76_CULQU        0.31  0.51   29  170   29  161  147    8   19  271  B0WH76     Chymotrypsinogen 2 OS=Culex quinquefasciatus GN=CpipJ_CPIJ006544 PE=3 SV=1
 2001 : B0WTZ5_CULQU        0.31  0.52   29  175   27  165  153   10   20  270  B0WTZ5     Serine proteinase stubble OS=Culex quinquefasciatus GN=CpipJ_CPIJ009890 PE=3 SV=1
 2002 : B2G0M9_ANOAR        0.31  0.51   29  154   15  129  126    4   11  192  B2G0M9     ENSANGG00000019205 protein (Fragment) OS=Anopheles arabiensis GN=ENSANGG00000019205 PE=3 SV=1
 2003 : B2G0N0_ANOAR        0.31  0.51   29  154   15  129  126    4   11  192  B2G0N0     ENSANGG00000019205 protein (Fragment) OS=Anopheles arabiensis GN=ENSANGG00000019205 PE=3 SV=1
 2004 : B2G0N8_ANOGA        0.31  0.51   29  154   15  129  126    4   11  192  B2G0N8     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 2005 : B2G0P0_ANOGA        0.31  0.51   29  154   15  129  126    4   11  192  B2G0P0     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 2006 : B2G0P2_ANOGA        0.31  0.50   29  154   15  129  126    4   11  192  B2G0P2     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 2007 : B2G0P3_ANOGA        0.31  0.51   29  154   15  129  126    4   11  192  B2G0P3     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 2008 : B2G0P8_ANOGA        0.31  0.51   29  154   15  129  126    4   11  192  B2G0P8     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 2009 : B2G0Q2_ANOGA        0.31  0.50   29  154   15  129  126    4   11  192  B2G0Q2     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 2010 : B2G0Q3_ANOGA        0.31  0.51   29  154   15  129  126    4   11  192  B2G0Q3     ENSANGG00000019205 protein (Fragment) OS=Anopheles gambiae GN=ENSANGG00000019205 PE=3 SV=1
 2011 : B2GM85_9ACAR        0.31  0.44   29  175   44  174  149    8   20  271  B2GM85     Sui m 3 OS=Suidasia medanensis PE=2 SV=1
 2012 : B3M3E8_DROAN        0.31  0.49   29  175  129  263  154    9   26  375  B3M3E8     GF25188 OS=Drosophila ananassae GN=Dana\GF25188 PE=3 SV=1
 2013 : B3M4V7_DROAN        0.31  0.45   29  175   28  163  150    5   17  275  B3M4V7     GF10558 OS=Drosophila ananassae GN=Dana\GF10558 PE=3 SV=1
 2014 : B3M644_DROAN        0.31  0.49   29  175   35  170  150    7   17  268  B3M644     GF10666 OS=Drosophila ananassae GN=Dana\GF10666 PE=3 SV=1
 2015 : B3MRG5_DROAN        0.31  0.55   29  170   27  156  144    6   16  281  B3MRG5     GF21275 OS=Drosophila ananassae GN=Dana\GF21275 PE=3 SV=1
 2016 : B3ND45_DROER        0.31  0.48   29  175  125  259  154    9   26  371  B3ND45     GG13716 OS=Drosophila erecta GN=Dere\GG13716 PE=3 SV=1
 2017 : B4G4U9_DROPE        0.31  0.49   29  175  262  406  162   14   32  476  B4G4U9     GL23299 OS=Drosophila persimilis GN=Dper\GL23299 PE=3 SV=1
 2018 : B4GSC6_DROPE        0.31  0.60  181  278  104  205  107    6   14  220  B4GSC6     GL26715 OS=Drosophila persimilis GN=Dper\GL26715 PE=3 SV=1
 2019 : B4GUK8_DROPE        0.31  0.48   29  175  127  261  154    9   26  373  B4GUK8     GL26150 OS=Drosophila persimilis GN=Dper\GL26150 PE=3 SV=1
 2020 : B4H6E1_DROPE        0.31  0.48   29  175   39  174  150    7   17  274  B4H6E1     GL15536 OS=Drosophila persimilis GN=Dper\GL15536 PE=3 SV=1
 2021 : B4H709_DROPE        0.31  0.49   29  171  112  263  158   10   21  376  B4H709     GL11766 OS=Drosophila persimilis GN=Dper\GL11766 PE=3 SV=1
 2022 : B4HHR8_DROSE        0.31  0.48   29  175  128  262  154    9   26  374  B4HHR8     GM24537 OS=Drosophila sechellia GN=Dsec\GM24537 PE=3 SV=1
 2023 : B4HRK7_DROSE        0.31  0.57  179  278    2  105  108    4   12  131  B4HRK7     GM20715 OS=Drosophila sechellia GN=Dsec\GM20715 PE=3 SV=1
 2024 : B4HV92_DROSE        0.31  0.52  182  278   56  144  100    3   14  145  B4HV92     GM13750 OS=Drosophila sechellia GN=Dsec\GM13750 PE=3 SV=1
 2025 : B4IWS8_DROGR        0.31  0.48   29  175  122  256  154    9   26  368  B4IWS8     GH16799 OS=Drosophila grimshawi GN=Dgri\GH16799 PE=3 SV=1
 2026 : B4J599_DROGR        0.31  0.51   39  170    2  137  137    4    6  242  B4J599     GH20292 OS=Drosophila grimshawi GN=Dgri\GH20292 PE=3 SV=1
 2027 : B4J5E2_DROGR        0.31  0.52   29  172    7  142  149    8   18  250  B4J5E2     GH20265 OS=Drosophila grimshawi GN=Dgri\GH20265 PE=3 SV=1
 2028 : B4JH23_DROGR        0.31  0.46   29  171   72  207  152   10   25  317  B4JH23     GH18677 OS=Drosophila grimshawi GN=Dgri\GH18677 PE=3 SV=1
 2029 : B4JRR9_DROGR        0.31  0.46   29  174  120  267  160   10   26  370  B4JRR9     GH19627 OS=Drosophila grimshawi GN=Dgri\GH19627 PE=3 SV=1
 2030 : B4K374_DROGR        0.31  0.46   41  170   15  130  133    7   20  235  B4K374     GH23917 (Fragment) OS=Drosophila grimshawi GN=Dgri\GH23917 PE=3 SV=1
 2031 : B4KLP2_DROMO        0.31  0.52   29  172    7  142  149    8   18  250  B4KLP2     GI19433 OS=Drosophila mojavensis GN=Dmoj\GI19433 PE=3 SV=1
 2032 : B4L5G2_DROMO        0.31  0.51   29  175   14  146  148    5   16  253  B4L5G2     GI21521 OS=Drosophila mojavensis GN=Dmoj\GI21521 PE=3 SV=1
 2033 : B4L9R1_DROMO        0.31  0.46   29  175   40  174  149    7   16  274  B4L9R1     GI16677 OS=Drosophila mojavensis GN=Dmoj\GI16677 PE=3 SV=1
 2034 : B4L9R2_DROMO        0.31  0.45   29  175   38  173  150    7   17  273  B4L9R2     GI16676 OS=Drosophila mojavensis GN=Dmoj\GI16676 PE=3 SV=1
 2035 : B4LJ09_DROVI        0.31  0.53   29  170   34  158  143    7   19  261  B4LJ09     GJ20850 OS=Drosophila virilis GN=Dvir\GJ20850 PE=3 SV=1
 2036 : B4MLP9_DROWI        0.31  0.47   29  175   39  174  150    7   17  274  B4MLP9     GK16888 OS=Drosophila willistoni GN=Dwil\GK16888 PE=3 SV=1
 2037 : B4MT77_DROWI        0.31  0.53   29  175   32  164  148    5   16  271  B4MT77     GK19756 OS=Drosophila willistoni GN=Dwil\GK19756 PE=3 SV=1
 2038 : B4MV74_DROWI        0.31  0.52   29  174   54  182  147    7   19  280  B4MV74     GK14673 OS=Drosophila willistoni GN=Dwil\GK14673 PE=3 SV=1
 2039 : B4N630_DROWI        0.31  0.52   29  172    7  142  149    8   18  250  B4N630     GK17815 OS=Drosophila willistoni GN=Dwil\GK17815 PE=3 SV=1
 2040 : B4PIF4_DROYA        0.31  0.48   29  175  141  275  154    9   26  387  B4PIF4     GE20012 OS=Drosophila yakuba GN=Dyak\GE20012 PE=3 SV=1
 2041 : B4QK13_DROSI        0.31  0.48   29  175  131  265  154    9   26  377  B4QK13     GD12611 OS=Drosophila simulans GN=Dsim\GD12611 PE=3 SV=1
 2042 : B4R1X2_DROSI        0.31  0.51  177  275   83  185  108    7   14  190  B4R1X2     GD20524 OS=Drosophila simulans GN=Dsim\GD20524 PE=3 SV=1
 2043 : B4XQ45_PANTR        0.31  0.49   29  175   31  166  149    8   15  235  B4XQ45     Delta tryptase 1 OS=Pan troglodytes PE=3 SV=1
 2044 : B4XQ46_PANTR        0.31  0.49   29  175   31  166  149    8   15  235  B4XQ46     Delta tryptase 2 OS=Pan troglodytes PE=3 SV=1
 2045 : B5DYL7_DROPS        0.31  0.49   29  175  262  406  162   14   32  508  B5DYL7     GA27214 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA27214 PE=3 SV=1
 2046 : B5DZL3_DROPS        0.31  0.48   29  171  112  263  159   12   23  376  B5DZL3     GA24065, isoform A OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA24065 PE=3 SV=1
 2047 : B5E0P5_DROPS        0.31  0.43   29  175   54  186  150    8   20  304  B5E0P5     GA24175 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA24175 PE=3 SV=2
 2048 : B5X8S0_SALSA        0.31  0.49   29  175   23  151  148    7   20  249  B5X8S0     Trypsin OS=Salmo salar GN=TRYP PE=2 SV=1
 2049 : B6D5J1_PERPL        0.31  0.48   29  174   40  185  157   10   22  427  B6D5J1     Acrosin OS=Peromyscus polionotus subgriseus GN=Acr PE=2 SV=1
 2050 : B6D5J5_PERER        0.31  0.48   29  174   40  185  157   10   22  428  B6D5J5     Acrosin OS=Peromyscus eremicus GN=Acr PE=2 SV=1
 2051 : B6D5J6_PERCA        0.31  0.48   29  174   40  185  157   10   22  427  B6D5J6     Acrosin OS=Peromyscus californicus insignis GN=Acr PE=2 SV=1
 2052 : B7P3F4_IXOSC        0.31  0.51  177  278   99  200  109    7   14  200  B7P3F4     Secreted salivary gland peptide, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW016466 PE=3 SV=1
 2053 : B7PC98_IXOSC        0.31  0.48   29  175   61  196  150    5   17  241  B7PC98     Serin proteinase, putative OS=Ixodes scapularis GN=IscW_ISCW002674 PE=3 SV=1
 2054 : B7Q0W2_IXOSC        0.31  0.48  182  278   99  205  110    7   16  215  B7Q0W2     Coagulation factor, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW009166 PE=3 SV=1
 2055 : B7QAU4_IXOSC        0.31  0.51  177  272    4   97   99    5    8  105  B7QAU4     Ovochymase, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW012782 PE=3 SV=1
 2056 : B7QGT2_IXOSC        0.31  0.52  182  278   68  160  100    5   10  168  B7QGT2     Secreted serine protease, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW014841 PE=3 SV=1
 2057 : B7U5S5_DERFA        0.31  0.46   29  175   28  158  150    9   22  259  B7U5S5     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
 2058 : B7U5S6_DERFA        0.31  0.46   29  175   28  158  150    9   22  259  B7U5S6     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
 2059 : B7Z1F7_HUMAN        0.31  0.49  179  278   67  158  102    6   12  160  B7Z1F7     cDNA FLJ53859, highly similar to Kallikrein-1 (EC 3.4.21.35) OS=Homo sapiens PE=2 SV=1
 2060 : B8PWQ7_9HEMI        0.31  0.48   29  175   60  201  154    9   19  315  B8PWQ7     Trypsin-like protease OS=Ranatra unicolor PE=2 SV=1
 2061 : B8RJE5_CULTA        0.31  0.60  179  278    1   99  102    2    5  105  B8RJE5     Serine protease (Fragment) OS=Culex tarsalis PE=2 SV=1
 2062 : B8XTS0_PIG          0.31  0.50   29  175   32  162  149    7   20  260  B8XTS0     Granzyme M OS=Sus scrofa GN=gzmM PE=2 SV=1
 2063 : C1BLA2_OSMMO        0.31  0.51   29  171   23  145  144    7   22  245  C1BLA2     Trypsin-3 OS=Osmerus mordax GN=TRY3 PE=2 SV=1
 2064 : C1JCL1_HYPNO        0.31  0.54  177  274   30  119  101    5   14  119  C1JCL1     Putative uncharacterized protein (Fragment) OS=Hypophthalmichthys nobilis PE=2 SV=1
 2065 : C3UV51_GADMO        0.31  0.47   29  175   20  146  149    7   24  241  C3UV51     Trypsinogen I (Fragment) OS=Gadus morhua PE=2 SV=1
 2066 : C3YMQ5_BRAFL        0.31  0.49   29  170   32  159  143    6   16  266  C3YMQ5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_117045 PE=3 SV=1
 2067 : C3YMR5_BRAFL        0.31  0.48   29  170   12  141  145    6   18  252  C3YMR5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_56782 PE=3 SV=1
 2068 : C3Z5C1_BRAFL        0.31  0.45   29  175  182  315  157    9   33  415  C3Z5C1     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_84099 PE=3 SV=1
 2069 : C3ZRZ4_BRAFL        0.31  0.51   29  171   21  146  144    6   19  246  C3ZRZ4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_287422 PE=3 SV=1
 2070 : C4TP29_THECH        0.31  0.47   29  175   20  146  149    7   24  241  C4TP29     Trypsin (Precursor) OS=Theragra chalcogramma GN=tryp PE=2 SV=3
 2071 : C5IBF8_9MUSC        0.31  0.49   29  175   33  161  148    7   20  256  C5IBF8     Female reproductive tract protease navajoa-3 (Fragment) OS=Drosophila navajoa PE=3 SV=1
 2072 : CTR1_ANOGA          0.31  0.52   29  175   33  162  147    7   17  259  Q27289     Chymotrypsin-1 OS=Anopheles gambiae GN=CHYM1 PE=1 SV=3
 2073 : CTRA_BOVIN  1AFQ    0.31  0.52   29  170   16  142  143    6   17  245  P00766     Chymotrypsinogen A OS=Bos taurus PE=1 SV=1
 2074 : CTRC_HUMAN  4H4F    0.31  0.47   29  172   30  163  148    7   18  268  Q99895     Chymotrypsin-C OS=Homo sapiens GN=CTRC PE=1 SV=2
 2075 : CTRC_RAT            0.31  0.46   29  172   30  163  149    6   20  268  P55091     Chymotrypsin-C OS=Rattus norvegicus GN=Ctrc PE=1 SV=1
 2076 : D0EXD7_9ORTH        0.31  0.55   29  175   66  203  153    9   21  313  D0EXD7     Ejaculate serine protease OS=Allonemobius fasciatus GN=ejac-sp PE=2 SV=1
 2077 : D0G7G2_BORSA        0.31  0.47   29  175   20  146  149    7   24  241  D0G7G2     Trypsin OS=Boreogadus saida GN=tryp PE=2 SV=1
 2078 : D2HY27_AILME        0.31  0.52   29  171   17  144  143    5   15  246  D2HY27     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_017583 PE=3 SV=1
 2079 : D2I3K9_AILME        0.31  0.51   29  175   24  151  148    7   21  259  D2I3K9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_020111 PE=3 SV=1
 2080 : D2Y5C2_PANAR        0.31  0.49   29  175   30  168  152    9   18  266  D2Y5C2     Trypsin 3 OS=Panulirus argus GN=Try3 PE=2 SV=1
 2081 : D3Y298_BRABE        0.31  0.54   29  171    1  128  144    6   17  204  D3Y298     Trypsinogen (Fragment) OS=Branchiostoma belcheri GN=try PE=2 SV=1
 2082 : D3ZIL3_RAT          0.31  0.50   29  175   20  147  150    9   25  254  D3ZIL3     Protein Klk15 OS=Rattus norvegicus GN=Klk15 PE=3 SV=1
 2083 : D4AB49_RAT          0.31  0.53   29  175   34  168  148    7   14  277  D4AB49     Protein Prss33 OS=Rattus norvegicus GN=Prss33 PE=3 SV=1
 2084 : D4ACZ0_RAT          0.31  0.48   29  174   33  173  153    9   19  316  D4ACZ0     Protease, serine, 34 (Predicted) OS=Rattus norvegicus GN=Prss34 PE=3 SV=1
 2085 : D5L840_MOUSE        0.31  0.45   29  175   30  162  152    9   24  311  D5L840     Tryptase gamma 1, isoform CRA_b OS=Mus musculus GN=Tpsg1 PE=3 SV=1
 2086 : D6PVN2_EPICO        0.31  0.52   29  175   23  149  149    8   24  245  D6PVN2     Trypsinogen OS=Epinephelus coioides PE=2 SV=1
 2087 : D6W701_TRICA        0.31  0.47   29  172  177  320  154    7   20  421  D6W701     Serine protease P144 OS=Tribolium castaneum GN=P144 PE=3 SV=1
 2088 : D6W975_TRICA        0.31  0.50   29  175   39  183  156   10   20  287  D6W975     Serine protease P16 OS=Tribolium castaneum GN=P16 PE=3 SV=1
 2089 : D6WBL3_TRICA        0.31  0.48   29  173  104  241  153   10   23  355  D6WBL3     Serine protease P56 OS=Tribolium castaneum GN=P56 PE=3 SV=1
 2090 : D6WFM2_TRICA        0.31  0.50   29  175   55  198  151    8   11  306  D6WFM2     Serine protease H42 OS=Tribolium castaneum GN=H42 PE=3 SV=1
 2091 : DERF3_DERFA         0.31  0.47   29  175   28  158  150    9   22  259  P49275     Mite allergen Der f 3 OS=Dermatophagoides farinae GN=DERF3 PE=1 SV=2
 2092 : DERP3_DERPT         0.31  0.48   29  175   30  160  149    8   20  261  P39675     Mite allergen Der p 3 OS=Dermatophagoides pteronyssinus GN=DERP3 PE=1 SV=1
 2093 : E0MNQ7_9RHOB        0.31  0.47   29  175   63  209  162   13   30  350  E0MNQ7     Elastase-2A OS=Ahrensia sp. R2A130 GN=R2A130_3067 PE=3 SV=1
 2094 : E0VW12_PEDHC        0.31  0.52   29  175   23  155  149    7   18  262  E0VW12     Trypsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM472620 PE=3 SV=1
 2095 : E0W193_PEDHC        0.31  0.52   29  175  102  240  153    8   20  343  E0W193     Tripsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM571210 PE=3 SV=1
 2096 : E1BLE0_BOVIN        0.31  0.48   29  172   20  153  148    7   18  255  E1BLE0     Uncharacterized protein OS=Bos taurus GN=LOC786126 PE=3 SV=2
 2097 : E1BP32_BOVIN        0.31  0.45   29  170   22  148  144    7   19  258  E1BP32     Uncharacterized protein OS=Bos taurus GN=GZMM PE=3 SV=1
 2098 : E1GBY4_LOALO        0.31  0.56  182  277   29  122   99    3    8  132  E1GBY4     Uncharacterized protein OS=Loa loa GN=LOAG_10674 PE=3 SV=2
 2099 : E2A2G6_CAMFO        0.31  0.55  180  277    6   97  101    5   12  142  E2A2G6     Transmembrane protease, serine 13 (Fragment) OS=Camponotus floridanus GN=EAG_16087 PE=3 SV=1
 2100 : E2AD42_CAMFO        0.31  0.51   29  175   87  227  154    6   20  334  E2AD42     Trypsin-1 OS=Camponotus floridanus GN=EAG_01206 PE=3 SV=1
 2101 : E2BU43_HARSA        0.31  0.52  187  274    1   89   95    5   13   94  E2BU43     Putative uncharacterized protein OS=Harpegnathos saltator GN=EAI_06989 PE=3 SV=1
 2102 : E2BYI8_HARSA        0.31  0.49   29  175   13  155  150    7   10  265  E2BYI8     Transmembrane protease, serine 9 (Fragment) OS=Harpegnathos saltator GN=EAI_08942 PE=3 SV=1
 2103 : E2FHV9_MOUSE        0.31  0.46   29  174   31  171  154   10   21  314  E2FHV9     Protease serine 34 OS=Mus musculus PE=3 SV=1
 2104 : E2RTI1_CANFA        0.31  0.50   29  173   34  163  147    7   19  263  E2RTI1     Uncharacterized protein OS=Canis familiaris GN=LOC610373 PE=3 SV=1
 2105 : E3RNS2_PYRTT        0.31  0.47   29  175   37  170  150    7   19  263  E3RNS2     Putative uncharacterized protein OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_10235 PE=3 SV=1
 2106 : E4XCQ8_OIKDI        0.31  0.47   29  175  175  321  160   10   26  986  E4XCQ8     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_23 OS=Oikopleura dioica GN=GSOID_T00007938001 PE=4 SV=1
 2107 : E4XVV4_OIKDI        0.31  0.51   29  170   25  169  152   11   17  279  E4XVV4     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_209 OS=Oikopleura dioica GN=GSOID_T00006756001 PE=3 SV=1
 2108 : E5A5U3_LEPMJ        0.31  0.49   29  175   40  170  150    7   22  265  E5A5U3     Similar to trypsin-like protease 1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LEMA_P082270.1 PE=3 SV=1
 2109 : E6ZH30_DICLA        0.31  0.54   29  175   35  169  149    8   16  310  E6ZH30     Serine protease 27 OS=Dicentrarchus labrax GN=PRSS27 PE=3 SV=1
 2110 : E7FBA9_DANRE        0.31  0.51   29  175   21  147  148    8   22  242  E7FBA9     Trypsinogen 1b OS=Danio rerio GN=si:ch73-103b2.3 PE=2 SV=1
 2111 : E7FDP9_DANRE        0.31  0.55   29  170   21  145  143    7   19  243  E7FDP9     Uncharacterized protein OS=Danio rerio PE=3 SV=1
 2112 : E9FZZ2_DAPPU        0.31  0.51  177  277  110  207  105    7   11  208  E9FZZ2     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_43419 PE=3 SV=1
 2113 : E9GEA5_DAPPU        0.31  0.50   29  175  111  251  155    9   22  387  E9GEA5     Putative chymotrypsin-1 protein OS=Daphnia pulex GN=CHY1 PE=3 SV=1
 2114 : E9GED4_DAPPU        0.31  0.53   29  175   10  145  153    6   23  301  E9GED4     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_49162 PE=3 SV=1
 2115 : E9GQZ9_DAPPU        0.31  0.50   29  175   61  206  153    9   13  306  E9GQZ9     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_320716 PE=3 SV=1
 2116 : E9H3D1_DAPPU        0.31  0.47   29  171   19  148  143    5   13  251  E9H3D1     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_57846 PE=3 SV=1
 2117 : E9H8J7_DAPPU        0.31  0.45   29  173  194  331  154    8   25  437  E9H8J7     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_216354 PE=3 SV=1
 2118 : E9HBL5_DAPPU        0.31  0.53   29  175    2  135  148    5   15  249  E9HBL5     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_60765 PE=3 SV=1
 2119 : E9QJW9_MOUSE        0.31  0.50   29  175   32  167  149    8   15  276  E9QJW9     Tryptase beta-2 OS=Mus musculus GN=Tpsb2 PE=1 SV=1
 2120 : E9QLD4_MOUSE        0.31  0.45   29  175   30  162  152    9   24  311  E9QLD4     Tryptase gamma OS=Mus musculus GN=Tpsg1 PE=3 SV=1
 2121 : F1LSP0_RAT          0.31  0.49   29  175  208  343  154    6   25  445  F1LSP0     Protein Tmprss5 OS=Rattus norvegicus GN=Tmprss5 PE=3 SV=2
 2122 : F1N803_CHICK        0.31  0.44   29  175  440  578  160   11   34  690  F1N803     Uncharacterized protein OS=Gallus gallus GN=C1S PE=3 SV=2
 2123 : F1N9P3_CHICK        0.31  0.52   29  172   26  149  145    6   22  248  F1N9P3     Uncharacterized protein OS=Gallus gallus GN=LOC768817 PE=3 SV=2
 2124 : F1PCE8_CANFA        0.31  0.49   29  174   24  149  147    6   22  246  F1PCE8     Uncharacterized protein OS=Canis familiaris GN=PRSS1 PE=3 SV=1
 2125 : F1Q3T5_CANFA        0.31  0.50   34  175    2  127  143    6   18  228  F1Q3T5     Uncharacterized protein OS=Canis familiaris GN=LOC482172 PE=3 SV=2
 2126 : F1Q464_CANFA        0.31  0.48   29  174   64  204  154    8   21  313  F1Q464     Uncharacterized protein OS=Canis familiaris GN=LOC448801 PE=3 SV=2
 2127 : F1QII6_DANRE        0.31  0.51   29  175   21  147  148    8   22  240  F1QII6     Uncharacterized protein OS=Danio rerio GN=si:ch211-235f12.5 PE=3 SV=1
 2128 : F2WR16_EPICO        0.31  0.50   29  175   21  147  149    7   24  242  F2WR16     Trypsinogen 1a OS=Epinephelus coioides PE=2 SV=1
 2129 : F2XFT0_DISMA        0.31  0.53   29  175   20  146  149    8   24  241  F2XFT0     Trypsinogen H1_1c OS=Dissostichus mawsoni PE=3 SV=1
 2130 : F2XFT1_DISMA        0.31  0.53   29  175   21  147  149    8   24  242  F2XFT1     Trypsinogen H1_1d OS=Dissostichus mawsoni PE=3 SV=1
 2131 : F2XFT3_DISMA        0.31  0.50   29  175   21  147  149    8   24  242  F2XFT3     Trypsinogen H1_1f OS=Dissostichus mawsoni PE=3 SV=1
 2132 : F2XFV7_DISMA        0.31  0.53   29  175   20  146  149    8   24  241  F2XFV7     Trypsinogen H2_1d OS=Dissostichus mawsoni PE=3 SV=1
 2133 : F2XFW4_DISMA        0.31  0.49   29  172   20  145  144    5   18  224  F2XFW4     Trypsinogen H2_3a4 OS=Dissostichus mawsoni PE=3 SV=1
 2134 : F4MI42_9DIPT        0.31  0.55   29  171    1  127  144    5   18  227  F4MI42     Putative trypsin 3 (Fragment) OS=Phlebotomus perniciosus PE=2 SV=1
 2135 : F4X072_ACREC        0.31  0.49   29  170   26  154  147   11   23  271  F4X072     Serine protease snake OS=Acromyrmex echinatior GN=G5I_11679 PE=3 SV=1
 2136 : F4X0S0_ACREC        0.31  0.54   29  175   87  220  151    9   21  324  F4X0S0     Coagulation factor XI OS=Acromyrmex echinatior GN=G5I_11867 PE=3 SV=1
 2137 : F4X2V3_ACREC        0.31  0.47   29  175   10  141  147    5   15  249  F4X2V3     Serine proteinase stubble (Fragment) OS=Acromyrmex echinatior GN=G5I_12634 PE=3 SV=1
 2138 : F5BZS3_EPIBR        0.31  0.54  179  278   71  169  104    7    9  170  F5BZS3     Elastase 4 (Fragment) OS=Epinephelus bruneus PE=2 SV=1
 2139 : F6Q9M1_CIOIN        0.31  0.55   29  175   15  154  150    8   13  264  F6Q9M1     Uncharacterized protein OS=Ciona intestinalis GN=LOC100177776 PE=3 SV=2
 2140 : F6QHN3_XENTR        0.31  0.49   29  172   41  167  145    7   19  267  F6QHN3     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 2141 : F6S9V9_CIOIN        0.31  0.46   29  171  241  389  159   11   26  496  F6S9V9     Uncharacterized protein OS=Ciona intestinalis GN=LOC100187379 PE=3 SV=2
 2142 : F6UUU6_MACMU        0.31  0.49   29  172   39  172  150    7   22  277  F6UUU6     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=CTRC PE=3 SV=1
 2143 : F6V4G1_CALJA        0.31  0.51   29  175   22  149  148    7   21  244  F6V4G1     Kallikrein-6 isoform A preproprotein OS=Callithrix jacchus GN=KLK6 PE=2 SV=1
 2144 : F6V6G0_MONDO        0.31  0.49   29  175   38  174  156    9   28  290  F6V6G0     Uncharacterized protein OS=Monodelphis domestica GN=LOC100022090 PE=3 SV=2
 2145 : F6V8R1_XENTR        0.31  0.54   29  175   25  154  147    6   17  251  F6V8R1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=prss3 PE=3 SV=1
 2146 : F6VSH7_ORNAN        0.31  0.47   29  171   25  147  145    8   24  247  F6VSH7     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100086459 PE=3 SV=1
 2147 : F6WMM1_MACMU        0.31  0.49   29  172   30  163  150    7   22  264  F6WMM1     Uncharacterized protein OS=Macaca mulatta GN=CTRC PE=3 SV=1
 2148 : F6X1R9_MACMU        0.31  0.49   29  171   24  146  144    6   22  247  F6X1R9     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 2149 : F6X291_MACMU        0.31  0.49   29  171   38  160  144    7   22  261  F6X291     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 2150 : F6X5Q3_MACMU        0.31  0.47   29  175   38  170  154    7   28  331  F6X5Q3     Uncharacterized protein OS=Macaca mulatta GN=TPSG1 PE=3 SV=1
 2151 : F6X6N3_MONDO        0.31  0.50   30  152    1  113  123    2   10  146  F6X6N3     Uncharacterized protein OS=Monodelphis domestica PE=3 SV=2
 2152 : F6XNK6_XENTR        0.31  0.51   29  175   34  170  149    8   14  268  F6XNK6     Uncharacterized protein OS=Xenopus tropicalis GN=ctrb2 PE=3 SV=1
 2153 : F6YJN1_XENTR        0.31  0.49   29  175   21  147  149    8   24  243  F6YJN1     Uncharacterized protein OS=Xenopus tropicalis PE=3 SV=1
 2154 : F6Z3T8_ORNAN        0.31  0.53  177  277   72  173  105    5    7  178  F6Z3T8     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=3 SV=1
 2155 : F6Z4X9_ORNAN        0.31  0.50   29  175   61  199  149    6   12  213  F6Z4X9     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=HGFAC PE=3 SV=2
 2156 : F6Z7Y2_XENTR        0.31  0.50  179  275    6  100  101    6   10  104  F6Z7Y2     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 2157 : F6ZAN5_HORSE        0.31  0.53   29  175   10  144  150    8   18  253  F6ZAN5     Uncharacterized protein (Fragment) OS=Equus caballus GN=PRSS33 PE=3 SV=1
 2158 : F7AGE3_XENTR        0.31  0.55   29  175   41  175  150    9   18  305  F7AGE3     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC100495077 PE=3 SV=1
 2159 : F7BQ37_XENTR        0.31  0.54   29  172   29  161  147    9   17  274  F7BQ37     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 2160 : F7C5I6_XENTR        0.31  0.51   29  175   23  173  157   10   16  285  F7C5I6     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC100497505 PE=3 SV=1
 2161 : F7DGA6_XENTR        0.31  0.52   29  174    2  133  149    9   20  258  F7DGA6     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC101734975 PE=3 SV=1
 2162 : F7DXM3_XENTR        0.31  0.50   29  175   37  171  150    7   18  290  F7DXM3     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC100493617 PE=3 SV=1
 2163 : F7EBU0_XENTR        0.31  0.49   30  175   25  164  152    7   18  265  F7EBU0     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=cela3b PE=3 SV=1
 2164 : F7EFL8_XENTR        0.31  0.54   29  172   29  161  147    9   17  271  F7EFL8     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 2165 : F7EM73_ORNAN        0.31  0.44   29  175   24  150  149    7   24  246  F7EM73     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100088455 PE=3 SV=1
 2166 : F7ERX9_CALJA        0.31  0.47   29  175  631  776  160   12   27  875  F7ERX9     Uncharacterized protein OS=Callithrix jacchus GN=PRSS12 PE=3 SV=1
 2167 : F7FGR7_MONDO        0.31  0.52   29  175   19  146  148    7   21  255  F7FGR7     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=KLK15 PE=3 SV=1
 2168 : F7G7F8_MACMU        0.31  0.46   29  171   24  146  144    7   22  247  F7G7F8     Uncharacterized protein OS=Macaca mulatta GN=PRSS3 PE=3 SV=1
 2169 : F7IJY4_CALJA        0.31  0.50   29  172   29  165  151    6   21  270  F7IJY4     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=CELA3B PE=3 SV=1
 2170 : F7J8C1_9TELE        0.31  0.51   29  170   34  161  145    6   20  265  F7J8C1     Chymotrypsin OS=Gadus macrocephalus GN=chytryp PE=2 SV=1
 2171 : F8UN04_SCYPA        0.31  0.50   29  175   45  174  151    8   25  270  F8UN04     Chymotrypsin OS=Scylla paramamosain PE=2 SV=1
 2172 : FA9_CAVPO           0.31  0.58   29  172   59  191  148    8   19  285  P16295     Coagulation factor IX (Fragment) OS=Cavia porcellus GN=F9 PE=2 SV=1
 2173 : G1K2P6_DANRE        0.31  0.51   29  172  158  288  147    8   19  299  G1K2P6     Uncharacterized protein (Fragment) OS=Danio rerio GN=si:dkey-76d14.1 PE=3 SV=1
 2174 : G1KW57_ANOCA        0.31  0.59  179  277   96  190  101    5    8  190  G1KW57     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=3 SV=1
 2175 : G1LFZ7_AILME        0.31  0.52   29  171   34  161  144    6   17  263  G1LFZ7     Uncharacterized protein OS=Ailuropoda melanoleuca GN=LOC100479949 PE=3 SV=1
 2176 : G1LFZ9_AILME        0.31  0.51   30  173   34  162  144    5   15  262  G1LFZ9     Uncharacterized protein OS=Ailuropoda melanoleuca PE=3 SV=1
 2177 : G1LI64_AILME        0.31  0.50   29  175   23  148  148    7   23  244  G1LI64     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=3 SV=1
 2178 : G1M6R2_AILME        0.31  0.48   29  170   22  145  144    6   22  249  G1M6R2     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=KLK12 PE=3 SV=1
 2179 : G1M6W0_AILME        0.31  0.51   29  175   29  156  148    7   21  251  G1M6W0     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=KLK6 PE=3 SV=1
 2180 : G1ND76_MELGA        0.31  0.45   29  175   21  151  148    5   18  252  G1ND76     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100549159 PE=3 SV=1
 2181 : G1NN41_MELGA        0.31  0.47   29  172   26  149  146    7   24  248  G1NN41     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100544478 PE=3 SV=2
 2182 : G1PR01_MYOLU        0.31  0.50   29  175   34  169  149    8   15  278  G1PR01     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 2183 : G1PV92_MYOLU        0.31  0.51   29  175   59  196  150   10   15  325  G1PV92     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=PRSS21 PE=3 SV=1
 2184 : G1PXV9_MYOLU        0.31  0.47   29  172   38  175  155   10   28  278  G1PXV9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 2185 : G1Q0Z6_MYOLU        0.31  0.48   30  170   39  174  149   10   21  286  G1Q0Z6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 2186 : G1Q3K2_MYOLU        0.31  0.48   29  175   31  171  153    7   18  274  G1Q3K2     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 2187 : G1Q4H7_MYOLU        0.31  0.49   29  169   31  160  144    9   17  278  G1Q4H7     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 2188 : G1Q4X6_MYOLU        0.31  0.47   29  175   31  171  153    7   18  271  G1Q4X6     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 2189 : G1Q790_MYOLU        0.31  0.49   29  173   29  164  148    5   15  272  G1Q790     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 2190 : G1QB50_MYOLU        0.31  0.47   29  175   31  171  153    6   18  273  G1QB50     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 2191 : G1QED3_MYOLU        0.31  0.50   29  174   24  149  148    8   24  246  G1QED3     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 2192 : G1QEU1_MYOLU        0.31  0.48   29  172   38  175  151    9   20  281  G1QEU1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 2193 : G1QKK8_NOMLE        0.31  0.49   29  174   43  187  158   12   25  439  G1QKK8     Uncharacterized protein OS=Nomascus leucogenys GN=ACR PE=3 SV=1
 2194 : G1R1I2_NOMLE        0.31  0.51   29  175   28  158  150    9   22  328  G1R1I2     Uncharacterized protein OS=Nomascus leucogenys GN=PRSS48 PE=3 SV=2
 2195 : G3HBW7_CRIGR        0.31  0.47   29  175   31  172  153    7   17  230  G3HBW7     Mastin OS=Cricetulus griseus GN=I79_007918 PE=3 SV=1
 2196 : G3HFD1_CRIGR        0.31  0.49   29  172  227  358  154    8   32  412  G3HFD1     Transmembrane protease, serine 2 (Fragment) OS=Cricetulus griseus GN=I79_009287 PE=3 SV=1
 2197 : G3IFA5_CRIGR        0.31  0.53   29  175   43  180  153   11   21  322  G3IFA5     Testisin OS=Cricetulus griseus GN=I79_022426 PE=3 SV=1
 2198 : G3IFA8_CRIGR        0.31  0.53   29  175   16  150  148    6   14  259  G3IFA8     Serine protease 33 OS=Cricetulus griseus GN=I79_022429 PE=3 SV=1
 2199 : G3IGP1_CRIGR        0.31  0.44   29  175   71  201  150    6   22  269  G3IGP1     Transmembrane protease, serine 11E2 OS=Cricetulus griseus GN=I79_022961 PE=3 SV=1
 2200 : G3NKM4_GASAC        0.31  0.52   29  175  133  281  157    8   18  384  G3NKM4     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2201 : G3NU42_GASAC        0.31  0.47   29  172   29  161  148    7   19  269  G3NU42     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 2202 : G3NU61_GASAC        0.31  0.47   29  172   28  160  148    7   19  266  G3NU61     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 2203 : G3NU78_GASAC        0.31  0.47   29  172   28  160  148    7   19  266  G3NU78     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 2204 : G3NWZ0_GASAC        0.31  0.48   29  175   23  149  147    7   20  245  G3NWZ0     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2205 : G3NWZ1_GASAC        0.31  0.48   29  175   22  148  147    7   20  244  G3NWZ1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2206 : G3NX20_GASAC        0.31  0.48   29  175   23  149  147    7   20  245  G3NX20     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 2207 : G3NX41_GASAC        0.31  0.50   29  175   24  152  147    6   18  248  G3NX41     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2208 : G3NX51_GASAC        0.31  0.48   29  175   23  149  147    7   20  245  G3NX51     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 2209 : G3P413_GASAC        0.31  0.47   29  170    4  130  144    7   19  245  G3P413     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2210 : G3PBJ6_GASAC        0.31  0.50   29  170   28  155  143    7   16  260  G3PBJ6     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 2211 : G3PS22_GASAC        0.31  0.51   29  174   19  154  148    7   14  264  G3PS22     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
 2212 : G3QZE0_GORGO        0.31  0.49   29  171   24  146  144    7   22  247  G3QZE0     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101145449 PE=3 SV=1
 2213 : G3RH21_GORGO        0.31  0.52   29  175   27  161  148    7   14  270  G3RH21     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101132282 PE=3 SV=1
 2214 : G3RPB6_GORGO        0.31  0.50   29  171   24  160  147    7   14  214  G3RPB6     Uncharacterized protein OS=Gorilla gorilla gorilla PE=3 SV=1
 2215 : G3SM33_LOXAF        0.31  0.53   29  175   11  145  153    8   24  254  G3SM33     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=PRSS33 PE=3 SV=1
 2216 : G3TFS5_LOXAF        0.31  0.49   29  175   29  166  150    5   15  269  G3TFS5     Uncharacterized protein OS=Loxodonta africana GN=LOC100657159 PE=3 SV=1
 2217 : G3TM62_LOXAF        0.31  0.48   29  171   24  146  144    7   22  246  G3TM62     Uncharacterized protein OS=Loxodonta africana GN=LOC100659862 PE=3 SV=1
 2218 : G3U7D1_LOXAF        0.31  0.49   29  172   24  145  144    6   22  244  G3U7D1     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=3 SV=1
 2219 : G3UB58_LOXAF        0.31  0.54  177  277   97  193  103    5    8  193  G3UB58     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=3 SV=1
 2220 : G3VAM2_SARHA        0.31  0.48   29  150   23  129  122    3   15  152  G3VAM2     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100928222 PE=3 SV=1
 2221 : G3VFG2_SARHA        0.31  0.56   29  175   16  157  154    7   19  288  G3VFG2     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=LOC100925461 PE=3 SV=1
 2222 : G3VR43_SARHA        0.31  0.45   29  172   25  148  147    9   26  247  G3VR43     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100929943 PE=3 SV=1
 2223 : G3W8U8_SARHA        0.31  0.50   29  175   29  166  153    8   21  269  G3W8U8     Uncharacterized protein OS=Sarcophilus harrisii GN=CELA2A PE=3 SV=1
 2224 : G3X9K6_MOUSE        0.31  0.54   29  175   35  166  150    9   21  321  G3X9K6     MCG15875 OS=Mus musculus GN=Prss55 PE=3 SV=1
 2225 : G5B155_HETGA        0.31  0.46   29  173   76  204  147    7   20  307  G5B155     Transmembrane protease, serine 11B (Fragment) OS=Heterocephalus glaber GN=GW7_09287 PE=3 SV=1
 2226 : G5BR67_HETGA        0.31  0.49   34  175    8  130  144    8   23  237  G5BR67     Kallikrein-15 (Fragment) OS=Heterocephalus glaber GN=GW7_18248 PE=3 SV=1
 2227 : G5BRA0_HETGA        0.31  0.48   29  175    5  130  147    7   21  242  G5BRA0     Kallikrein-7 (Fragment) OS=Heterocephalus glaber GN=GW7_13267 PE=3 SV=1
 2228 : G5BRS7_HETGA        0.31  0.48   29  175   29  165  151    6   18  268  G5BRS7     Chymotrypsin-like elastase family member 2A OS=Heterocephalus glaber GN=GW7_15509 PE=3 SV=1
 2229 : G5C5M9_HETGA        0.31  0.48   29  172   25  148  145    6   22  247  G5C5M9     Cationic trypsin-3 OS=Heterocephalus glaber GN=GW7_03993 PE=3 SV=1
 2230 : G6CVT9_DANPL        0.31  0.47   29  175  237  373  156    8   28  472  G6CVT9     Uncharacterized protein OS=Danaus plexippus GN=KGM_11046 PE=3 SV=1
 2231 : G7P1G5_MACFA        0.31  0.48   29  172   45  168  145    7   22  268  G7P1G5     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_13041 PE=3 SV=1
 2232 : G7Q044_MACFA        0.31  0.47   29  175   83  215  154    7   28  357  G7Q044     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_11309 PE=3 SV=1
 2233 : G7Q045_MACFA        0.31  0.50   29  175   38  173  149    7   15  319  G7Q045     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_11310 PE=3 SV=1
 2234 : G9D481_9NEOP        0.31  0.55   29  175   79  209  149    7   20  286  G9D481     Seminal fluid protein HACP002 (Fragment) OS=Heliconius ismenius PE=2 SV=1
 2235 : G9D482_HELHC        0.31  0.55   29  175   79  209  149    7   20  299  G9D482     Seminal fluid protein HACP002 (Fragment) OS=Heliconius hecale PE=2 SV=1
 2236 : G9D484_9NEOP        0.31  0.55   29  175   80  210  149    7   20  300  G9D484     Seminal fluid protein HACP002 (Fragment) OS=Heliconius burneyi PE=2 SV=1
 2237 : G9D486_9NEOP        0.31  0.55   29  175   69  199  149    7   20  289  G9D486     Seminal fluid protein HACP002 (Fragment) OS=Heliconius xanthocles PE=2 SV=1
 2238 : G9F9J0_9NEOP        0.31  0.47   29  175   67  199  151    8   22  308  G9F9J0     Seminal fluid protein CSSFP038 OS=Chilo suppressalis PE=2 SV=1
 2239 : H0W3S5_CAVPO        0.31  0.53   29  175   20  156  149    8   14  307  H0W3S5     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100724465 PE=3 SV=1
 2240 : H0WNG6_OTOGA        0.31  0.53   29  175   50  186  150    7   16  307  H0WNG6     Uncharacterized protein OS=Otolemur garnettii GN=PRSS22 PE=3 SV=1
 2241 : H0XY90_OTOGA        0.31  0.50   29  170   19  144  146    8   24  288  H0XY90     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=PRSS46 PE=3 SV=1
 2242 : H0Y212_OTOGA        0.31  0.49   29  171   25  147  144    7   22  247  H0Y212     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
 2243 : H0YPM9_TAEGU        0.31  0.45   29  170   97  222  150    9   32  322  H0YPM9     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=TMPRSS4 PE=3 SV=1
 2244 : H0YWR0_TAEGU        0.31  0.48   29  170   19  152  148   11   20  254  H0YWR0     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
 2245 : H0ZWX1_TAEGU        0.31  0.51   29  160   10  136  134    3    9  143  H0ZWX1     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
 2246 : H1A7C1_9ANNE        0.31  0.52   29  175   45  179  149    7   16  282  H1A7C1     Fibrinolytic enzyme OS=Enchytraeus japonensis GN=Ej-FEIII-1b PE=2 SV=1
 2247 : H2BLC4_CHEQU        0.31  0.51   29  175   45  174  150    8   23  270  H2BLC4     Chymotrypsin-like serine protease 1 OS=Cherax quadricarinatus PE=2 SV=1
 2248 : H2D0L1_9ORTH        0.31  0.52   29  175   32  169  149    5   13  242  H2D0L1     Ejaculate serine protease (Fragment) OS=Allonemobius socius complex sp. ejacsp_1 PE=2 SV=1
 2249 : H2D0L2_9ORTH        0.31  0.52   29  175   32  169  149    5   13  242  H2D0L2     Ejaculate serine protease (Fragment) OS=Allonemobius socius PE=2 SV=1
 2250 : H2D0L3_9ORTH        0.31  0.52   29  175   32  169  149    5   13  242  H2D0L3     Ejaculate serine protease (Fragment) OS=Allonemobius socius PE=2 SV=1
 2251 : H2D0L4_9ORTH        0.31  0.52   29  175   32  169  149    5   13  242  H2D0L4     Ejaculate serine protease (Fragment) OS=Allonemobius sp. Tex PE=2 SV=1
 2252 : H2KPU0_CLOSI        0.31  0.50   29  175  340  495  162    9   21  638  H2KPU0     Chymotrypsinogen A OS=Clonorchis sinensis GN=CLF_102611 PE=3 SV=1
 2253 : H2LPB8_ORYLA        0.31  0.49   29  175   33  160  149    7   23  258  H2LPB8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170788 PE=3 SV=1
 2254 : H2NR96_PONAB        0.31  0.48   29  174   34  164  147    8   17  263  H2NR96     Uncharacterized protein OS=Pongo abelii GN=CTRL PE=3 SV=1
 2255 : H2P372_PONAB        0.31  0.47   29  174  202  335  156    8   32  442  H2P372     Uncharacterized protein OS=Pongo abelii GN=TMPRSS2 PE=3 SV=2
 2256 : H2PY33_PANTR        0.31  0.47   29  172   30  163  148    7   18  268  H2PY33     Uncharacterized protein OS=Pan troglodytes GN=CTRC PE=3 SV=1
 2257 : H2RR26_TAKRU        0.31  0.51   29  175   16  149  148    6   15  250  H2RR26     Uncharacterized protein OS=Takifugu rubripes GN=LOC101067365 PE=3 SV=1
 2258 : H2TSM9_TAKRU        0.31  0.58   29  175   41  176  149    8   15  298  H2TSM9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071414 PE=3 SV=1
 2259 : H2U5L2_TAKRU        0.31  0.52   29  174   11  144  149    8   18  246  H2U5L2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101061896 PE=3 SV=1
 2260 : H2U5L6_TAKRU        0.31  0.52   29  174   80  213  147    6   14  311  H2U5L6     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101061896 PE=3 SV=1
 2261 : H2U661_TAKRU        0.31  0.51   29  170   15  156  152    9   20  268  H2U661     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101077657 PE=3 SV=1
 2262 : H2XZV3_CIOIN        0.31  0.55  180  278   44  137  103    7   13  140  H2XZV3     Uncharacterized protein (Fragment) OS=Ciona intestinalis GN=LOC100181939 PE=3 SV=1
 2263 : H2YNG0_CIOSA        0.31  0.48   29  175  469  626  163    8   21  741  H2YNG0     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 2264 : H2Z086_CIOSA        0.31  0.44   29  175   41  176  153   11   23  284  H2Z086     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 2265 : H3AI72_LATCH        0.31  0.53   29  170   25  176  158    7   22  278  H3AI72     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 2266 : H3CN53_TETNG        0.31  0.50   29  171   29  171  153    9   20  284  H3CN53     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 2267 : H3DCL5_TETNG        0.31  0.57   29  175   34  169  150    8   17  307  H3DCL5     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
 2268 : H3DHF7_TETNG        0.31  0.51   29  173  199  339  156   11   26  440  H3DHF7     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
 2269 : H3DMP9_TETNG        0.31  0.51   29  175   11  142  148    6   17  236  H3DMP9     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=TMPRSS9 (6 of 6) PE=3 SV=1
 2270 : H3DP30_TETNG        0.31  0.47   29  172  161  296  157   10   34  414  H3DP30     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=TMPRSS11E PE=3 SV=1
 2271 : H9GC52_ANOCA        0.31  0.52   29  175   41  179  151    9   16  299  H9GC52     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100564231 PE=3 SV=1
 2272 : H9GC91_ANOCA        0.31  0.52   30  175   25  158  151    9   22  315  H9GC91     Uncharacterized protein OS=Anolis carolinensis GN=LOC100553133 PE=3 SV=2
 2273 : H9GX51_DANRE        0.31  0.50   29  175   31  163  147    4   14  260  H9GX51     Uncharacterized protein OS=Danio rerio GN=zgc:171592 PE=3 SV=1
 2274 : H9H1S9_MELGA        0.31  0.52   29  174   16  156  153   10   19  284  H9H1S9     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=TMPRSS12 PE=3 SV=1
 2275 : H9H4C5_MACMU        0.31  0.50   29  175   29  166  151    5   17  212  H9H4C5     Uncharacterized protein OS=Macaca mulatta GN=LOC721409 PE=3 SV=1
 2276 : H9IUB0_BOMMO        0.31  0.53   29  175   46  175  148    7   19  273  H9IUB0     Uncharacterized protein OS=Bombyx mori GN=Bmo.5015 PE=3 SV=1
 2277 : H9JDS1_BOMMO        0.31  0.51  179  278   83  173  102    6   13  174  H9JDS1     Uncharacterized protein OS=Bombyx mori PE=3 SV=1
 2278 : H9JJH7_BOMMO        0.31  0.49   29  175  127  265  154    8   22  369  H9JJH7     Uncharacterized protein OS=Bombyx mori PE=3 SV=1
 2279 : H9JV30_BOMMO        0.31  0.50  177  277   43  144  110    4   17  146  H9JV30     Uncharacterized protein OS=Bombyx mori GN=Bmo.14354 PE=3 SV=1
 2280 : I1SRK8_9SMEG        0.31  0.51   29  175   84  213  147    7   17  266  I1SRK8     Plasminogen OS=Oryzias melastigma PE=2 SV=1
 2281 : I3IYX0_ORENI        0.31  0.48   29  154   10  126  127    4   11  193  I3IYX0     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC102082366 PE=3 SV=1
 2282 : I3J4W0_ORENI        0.31  0.51   29  172   29  163  149    7   19  268  I3J4W0     Uncharacterized protein OS=Oreochromis niloticus GN=CELA3A PE=3 SV=1
 2283 : I3J5C5_ORENI        0.31  0.50   29  170   34  160  147    8   25  263  I3J5C5     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100691584 PE=3 SV=1
 2284 : I3JC54_ORENI        0.31  0.48   29  170   37  166  145    7   18  272  I3JC54     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC102082250 PE=3 SV=1
 2285 : I3KW01_ORENI        0.31  0.55   29  175   35  169  150    8   18  299  I3KW01     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100706977 PE=3 SV=1
 2286 : I3L3D7_HUMAN        0.31  0.54   29  175   26  160  147    6   12  236  I3L3D7     Serine protease 33 (Fragment) OS=Homo sapiens GN=PRSS33 PE=2 SV=1
 2287 : I3L7Z2_PIG          0.31  0.53   30  171   32  157  144    7   20  216  I3L7Z2     Uncharacterized protein (Fragment) OS=Sus scrofa GN=PRSS46 PE=3 SV=1
 2288 : I3LK65_PIG          0.31  0.50   32  175   29  153  147    9   25  250  I3LK65     Uncharacterized protein OS=Sus scrofa GN=KLK15 PE=3 SV=1
 2289 : I3LKM1_PIG          0.31  0.51   29  175   70  207  152   10   19  338  I3LKM1     Uncharacterized protein (Fragment) OS=Sus scrofa GN=PRSS21 PE=3 SV=1
 2290 : I3LPN0_PIG          0.31  0.46   29  175   31  166  154    8   25  274  I3LPN0     Tryptase OS=Sus scrofa GN=MCT7 PE=3 SV=1
 2291 : I3M8B4_SPETR        0.31  0.50   29  175   29  156  148    6   21  251  I3M8B4     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=KLK6 PE=3 SV=1
 2292 : I3UII9_9NEOP        0.31  0.47   29  175   67  199  151    8   22  308  I3UII9     Trypsin-like proteinase OS=Chilo suppressalis PE=2 SV=1
 2293 : I4DNU8_PAPXU        0.31  0.49   29  175   23  155  150    7   20  264  I4DNU8     Serine protease OS=Papilio xuthus PE=2 SV=1
 2294 : I6LWU3_ERISI        0.31  0.51   29  175   45  174  150    8   23  270  I6LWU3     Collagenolytic serine protease protein OS=Eriocheir sinensis PE=2 SV=1
 2295 : I7HI61_9PERO        0.31  0.51   29  175   21  147  148    8   22  243  I7HI61     Trypsin OS=Lutjanus fulvus GN=trp PE=2 SV=1
 2296 : J7ICR2_SALFO        0.31  0.51   29  158   12  126  130    3   15  163  J7ICR2     Trypsin (Fragment) OS=Salvelinus fontinalis PE=2 SV=1
 2297 : J9DQC3_WUCBA        0.31  0.56  182  277   28  121   99    3    8  131  J9DQC3     Uncharacterized protein OS=Wuchereria bancrofti GN=WUBG_17249 PE=3 SV=1
 2298 : J9HGT3_AEDAE        0.31  0.46   29  170   86  226  151   10   19  334  J9HGT3     AAEL014140-PB (Fragment) OS=Aedes aegypti GN=CLIPB24 PE=3 SV=1
 2299 : J9JM20_ACYPI        0.31  0.46   29  174   66  199  149    8   18  311  J9JM20     Uncharacterized protein OS=Acyrthosiphon pisum GN=LOC100159921 PE=3 SV=1
 2300 : J9LJ54_ACYPI        0.31  0.51  177  278   96  193  105    6   10  193  J9LJ54     Uncharacterized protein OS=Acyrthosiphon pisum GN=LOC100165475 PE=3 SV=1
 2301 : K1QM96_CRAGI        0.31  0.51   29  175   42  174  150    7   20  275  K1QM96     Chymotrypsin B OS=Crassostrea gigas GN=CGI_10015381 PE=3 SV=1
 2302 : K7FD68_PELSI        0.31  0.52   29  175   51  196  155    9   17  307  K7FD68     Uncharacterized protein OS=Pelodiscus sinensis PE=3 SV=1
 2303 : K7FM00_PELSI        0.31  0.51   29  172   24  151  146    9   20  250  K7FM00     Uncharacterized protein OS=Pelodiscus sinensis PE=3 SV=1
 2304 : K7ISR5_NASVI        0.31  0.52   29  175   36  165  149    7   21  269  K7ISR5     Uncharacterized protein OS=Nasonia vitripennis GN=SP36 PE=3 SV=1
 2305 : K7IV01_NASVI        0.31  0.49   29  175   39  177  154    9   22  285  K7IV01     Uncharacterized protein OS=Nasonia vitripennis GN=SP48 PE=3 SV=1
 2306 : K7IYC1_NASVI        0.31  0.50  182  278   71  165  100    5    8  169  K7IYC1     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
 2307 : K7J1V4_NASVI        0.31  0.52   29  173   30  166  150    7   18  275  K7J1V4     Uncharacterized protein OS=Nasonia vitripennis GN=SP101 PE=3 SV=1
 2308 : K7J514_NASVI        0.31  0.53  177  278   27  130  108    5   10  131  K7J514     Uncharacterized protein (Fragment) OS=Nasonia vitripennis GN=SP108 PE=3 SV=1
 2309 : K7J8I1_NASVI        0.31  0.50   29  175  130  268  154    9   22  371  K7J8I1     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
 2310 : L5KJ89_PTEAL        0.31  0.49   29  175   31  166  149    8   15  275  L5KJ89     Tryptase beta-2 OS=Pteropus alecto GN=PAL_GLEAN10011753 PE=3 SV=1
 2311 : L5LR71_MYODS        0.31  0.48   29  175   29  166  150    5   15  269  L5LR71     Chymotrypsin-like elastase family member 2A OS=Myotis davidii GN=MDA_GLEAN10024335 PE=3 SV=1
 2312 : L5MFC7_MYODS        0.31  0.46   29  172   14  151  151    9   20  286  L5MFC7     Mastin (Fragment) OS=Myotis davidii GN=MDA_GLEAN10001093 PE=3 SV=1
 2313 : L5MHZ5_MYODS        0.31  0.50   29  173   33  159  147    6   22  255  L5MHZ5     Kallikrein-12 OS=Myotis davidii GN=MDA_GLEAN10002288 PE=3 SV=1
 2314 : L8ID95_9CETA        0.31  0.50   29  175   24  151  148    7   21  246  L8ID95     Kallikrein-6 OS=Bos mutus GN=M91_05461 PE=3 SV=1
 2315 : M0R7G1_RAT          0.31  0.50   29  175   18  145  150    9   25  252  M0R7G1     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=3 SV=1
 2316 : M3WMG5_FELCA        0.31  0.47   29  175   36  170  155    7   28  268  M3WMG5     Uncharacterized protein (Fragment) OS=Felis catus GN=LOC101091168 PE=3 SV=1
 2317 : M3WP64_FELCA        0.31  0.51   29  174   26  151  147    6   22  248  M3WP64     Uncharacterized protein (Fragment) OS=Felis catus GN=LOC101085453 PE=3 SV=1
 2318 : M3WS46_FELCA        0.31  0.49   29  170   46  175  148   12   24  315  M3WS46     Uncharacterized protein OS=Felis catus PE=3 SV=1
 2319 : M3ZX03_XIPMA        0.31  0.50   29  175   21  147  149    7   24  242  M3ZX03     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 2320 : M4A142_XIPMA        0.31  0.47   29  171   26  144  144    5   26  218  M4A142     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
 2321 : M4A677_XIPMA        0.31  0.50   29  170   34  160  147    8   25  263  M4A677     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 2322 : M4AF88_XIPMA        0.31  0.47   30  175  208  344  157   11   31  442  M4AF88     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
 2323 : M4API8_XIPMA        0.31  0.51   29  172   15  143  147    7   21  246  M4API8     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
 2324 : M4UM85_9GAMM        0.31  0.41   29  172   28  166  160    9   37  405  M4UM85     Peptidase S1 and S6, chymotrypsin/Hap OS=Psychromonas sp. CNPT3 GN=PCNPT3_08210 PE=3 SV=1
 2325 : M7AXA3_CHEMY        0.31  0.51   29  151   11  120  123    4   13  179  M7AXA3     Trypsin-4 OS=Chelonia mydas GN=UY3_15205 PE=3 SV=1
 2326 : M7B2T4_CHEMY        0.31  0.53   29  173   34  165  148    8   19  265  M7B2T4     Chymotrypsinogen B OS=Chelonia mydas GN=UY3_11488 PE=3 SV=1
 2327 : M7B2Z7_CHEMY        0.31  0.52   29  175   16  148  147    5   14  242  M7B2Z7     Transmembrane protease serine 3 (Fragment) OS=Chelonia mydas GN=UY3_11393 PE=3 SV=1
 2328 : M7BHH3_CHEMY        0.31  0.50   32  170   14  133  140    7   21  235  M7BHH3     Kallikrein-15 (Fragment) OS=Chelonia mydas GN=UY3_15201 PE=3 SV=1
 2329 : M7CB80_CHEMY        0.31  0.49   29  171  101  244  154   11   21  347  M7CB80     Urokinase-type plasminogen activator (Fragment) OS=Chelonia mydas GN=UY3_04867 PE=3 SV=1
 2330 : M7CF69_CHEMY        0.31  0.47   29  175  114  248  155    9   28  403  M7CF69     Serine protease 27 (Fragment) OS=Chelonia mydas GN=UY3_03255 PE=3 SV=1
 2331 : N0DPA8_9HEMI        0.31  0.50   29  175   41  176  150    7   17  294  N0DPA8     Serine protease like protein OS=Cryptotympana facialis PE=2 SV=1
 2332 : O54854_RAT          0.31  0.54   29  175   29  156  148    7   21  251  O54854     Kallikrein 6, isoform CRA_a OS=Rattus norvegicus GN=Klk6 PE=2 SV=1
 2333 : O62562_LITVA        0.31  0.51   29  175   28  166  152    9   18  263  O62562     Trypsin (Fragment) OS=Litopenaeus vannamei PE=3 SV=1
 2334 : O88301_MOUSE        0.31  0.52   29  175   22  149  147    7   19  246  O88301     Brain serine protease OS=Mus musculus GN=Klk6 PE=2 SV=1
 2335 : O96089_HAELO        0.31  0.47   29  175   39  176  150    7   15  284  O96089     Serin proteinase 2 OS=Haemaphysalis longicornis PE=2 SV=1
 2336 : O97097_ANOAQ        0.31  0.51   29  175   33  164  149    8   19  259  O97097     Chymotrypsin 1 OS=Anopheles aquasalis GN=cy1 PE=3 SV=1
 2337 : PRS33_HUMAN         0.31  0.53   29  175   37  171  148    7   14  280  Q8NF86     Serine protease 33 OS=Homo sapiens GN=PRSS33 PE=1 SV=3
 2338 : PRS33_MOUSE         0.31  0.54   29  175   34  168  148    7   14  277  Q80WM7     Serine protease 33 OS=Mus musculus GN=Prss33 PE=2 SV=1
 2339 : PRS55_MOUSE         0.31  0.54   29  175   35  166  150    9   21  321  Q14BX2     Serine protease 55 OS=Mus musculus GN=Prss55 PE=2 SV=1
 2340 : Q07277_HUMAN        0.31  0.49  179  278  102  193  102    6   12  195  Q07277     Pre-pro-protein for kallikrein OS=Homo sapiens PE=3 SV=1
 2341 : Q16XF5_AEDAE        0.31  0.52   29  175   40  188  155    8   14  267  Q16XF5     AAEL008904-PA OS=Aedes aegypti GN=AAEL008904 PE=3 SV=1
 2342 : Q16XU2_AEDAE        0.31  0.54   29  172   24  157  148    8   18  254  Q16XU2     AAEL008784-PA OS=Aedes aegypti GN=AAEL008784 PE=3 SV=1
 2343 : Q17039_ANOGA        0.31  0.48   29  175   10  143  147    4   13  247  Q17039     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
 2344 : Q171W0_AEDAE        0.31  0.50   29  175   10  142  149    5   18  251  Q171W0     AAEL007511-PA (Fragment) OS=Aedes aegypti GN=AAEL007511 PE=3 SV=1
 2345 : Q17BD9_AEDAE        0.31  0.53   29  175   37  166  148    8   19  267  Q17BD9     AAEL004996-PA OS=Aedes aegypti GN=AAEL004996 PE=3 SV=1
 2346 : Q1M2M8_GLYDO        0.31  0.41   29  175   42  166  148    8   24  260  Q1M2M8     Gly d 3 OS=Glycyphagus domesticus PE=2 SV=1
 2347 : Q2LZC1_DROPS        0.31  0.48   29  175   39  174  150    7   17  274  Q2LZC1     GA19618 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA19618 PE=3 SV=2
 2348 : Q2M165_DROPS        0.31  0.48   29  175  129  263  154    9   26  375  Q2M165     GA18522 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA18522 PE=3 SV=1
 2349 : Q3SY19_HUMAN        0.31  0.51   29  171   24  146  144    7   22  247  Q3SY19     PRSS1 protein OS=Homo sapiens GN=PRSS1 PE=2 SV=1
 2350 : Q3ZB04_MOUSE        0.31  0.52   29  174   40  185  153    9   14  264  Q3ZB04     Acr protein OS=Mus musculus GN=Acr PE=2 SV=1
 2351 : Q3ZB06_MOUSE        0.31  0.48   29  174   42  187  157   10   22  435  Q3ZB06     Acrosin (Fragment) OS=Mus musculus GN=Acr PE=2 SV=1
 2352 : Q45RG0_BOMMO        0.31  0.53   29  175   63  195  150    7   20  303  Q45RG0     Serine protease-like protein OS=Bombyx mori PE=2 SV=1
 2353 : Q4QY79_SPAAU        0.31  0.51   29  175   21  147  148    8   22  241  Q4QY79     Trypsinogen 1-like protein OS=Sparus aurata PE=2 SV=1
 2354 : Q4RGF3_TETNG        0.31  0.54   29  175   44  182  151    8   16  279  Q4RGF3     Chromosome 18 SCAF15100, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00034829001 PE=3 SV=1
 2355 : Q4RVJ6_TETNG        0.31  0.57   29  175   34  169  150    8   17  279  Q4RVJ6     Chromosome 15 SCAF14992, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00028300001 PE=3 SV=1
 2356 : Q4SEW1_TETNG        0.31  0.51   29  170   34  160  147    8   25  263  Q4SEW1     Chromosome undetermined SCAF14611, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00019363001 PE=3 SV=1
 2357 : Q4SH18_TETNG        0.31  0.47   29  175   24  150  148    8   22  246  Q4SH18     Chromosome 8 SCAF14587, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00018366001 PE=3 SV=1
 2358 : Q52NW5_9DIPT        0.31  0.49   29  175   37  168  151    9   23  272  Q52NW5     Serine protease OS=Anopheles culicifacies PE=2 SV=1
 2359 : Q561U4_DANRE        0.31  0.53   29  170   34  162  147    7   23  265  Q561U4     Uncharacterized protein OS=Danio rerio GN=zgc:112160 PE=2 SV=1
 2360 : Q5F3N3_CHICK        0.31  0.44   29  175  440  578  160   11   34  690  Q5F3N3     Uncharacterized protein OS=Gallus gallus GN=RCJMB04_11h6 PE=2 SV=1
 2361 : Q5G3K5_PYGNE        0.31  0.49   29  171   18  159  150    7   15  262  Q5G3K5     Neurotrypsin (Fragment) OS=Pygathrix nemaeus GN=PRSS12 PE=3 SV=1
 2362 : Q5G3K6_TRAFR        0.31  0.49   29  171   18  159  150    7   15  262  Q5G3K6     Neurotrypsin (Fragment) OS=Trachypithecus francoisi GN=PRSS12 PE=3 SV=1
 2363 : Q5G3K7_PYGBI        0.31  0.49   29  171   18  159  150    7   15  262  Q5G3K7     Neurotrypsin (Fragment) OS=Pygathrix bieti GN=PRSS12 PE=3 SV=1
 2364 : Q5G3K8_HOOHO        0.31  0.49   29  171   18  159  150    7   15  262  Q5G3K8     Neurotrypsin (Fragment) OS=Hoolock hoolock GN=PRSS12 PE=3 SV=1
 2365 : Q5H728_MACMU        0.31  0.49   29  171   24  146  144    7   22  247  Q5H728     Try16 OS=Macaca mulatta GN=try16 PE=3 SV=1
 2366 : Q5H732_MACMU        0.31  0.49   29  171   24  147  143    6   19  248  Q5H732     Try10 OS=Macaca mulatta GN=try10 PE=3 SV=1
 2367 : Q5I029_XENTR        0.31  0.50   29  170   34  160  146    7   23  263  Q5I029     Chymotrypsin-like OS=Xenopus tropicalis GN=ctrb2 PE=2 SV=1
 2368 : Q5TWT2_ANOGA        0.31  0.53   29  170   66  205  150   10   18  316  Q5TWT2     AGAP007262-PA OS=Anopheles gambiae GN=AGAP007262 PE=3 SV=3
 2369 : Q6AZF9_XENLA        0.31  0.47   29  175   28  167  152    6   17  269  Q6AZF9     Ela3b-prov protein OS=Xenopus laevis GN=cela3b PE=2 SV=1
 2370 : Q6B4R4_BOVIN        0.31  0.54   29  172    1  134  145    5   12  235  Q6B4R4     Enterokinase light chain (Fragment) OS=Bos taurus PE=2 SV=1
 2371 : Q6DHD9_DANRE        0.31  0.53   29  170   30  158  147    7   23  261  Q6DHD9     Zgc:112160 protein (Fragment) OS=Danio rerio GN=zgc:112160 PE=2 SV=1
 2372 : Q6GN82_XENLA        0.31  0.50   29  175   29  166  155    9   25  269  Q6GN82     MGC82963 protein OS=Xenopus laevis GN=MGC82963 PE=2 SV=1
 2373 : Q6GYJ5_STRCA        0.31  0.48   29  171    9  131  144    6   22  231  Q6GYJ5     Pancreatic trypsinogen (Fragment) OS=Struthio camelus PE=2 SV=2
 2374 : Q6RI79_9LABR        0.31  0.49   29  175   21  147  149    7   24  242  Q6RI79     Pretrypsinogen OS=Tautogolabrus adspersus PE=2 SV=1
 2375 : Q6RUT2_MOUSE        0.31  0.46   29  174   31  171  154   10   21  314  Q6RUT2     Mast cell protease-11 OS=Mus musculus GN=Mcp11 PE=3 SV=1
 2376 : Q6SV38_9HYPO        0.31  0.49  177  276   98  186  101    6   13  186  Q6SV38     Trypsin-like protease (Fragment) OS=Metarhizium acridum PE=3 SV=1
 2377 : Q792Z1_MOUSE        0.31  0.49   29  171   24  146  143    6   20  246  Q792Z1     MCG140784 OS=Mus musculus GN=Try10 PE=2 SV=1
 2378 : Q7Z0B3_STOCA        0.31  0.51   29  175   29  162  148    6   15  266  Q7Z0B3     Trypsin OS=Stomoxys calcitrans PE=2 SV=1
 2379 : Q7Z163_DERPT        0.31  0.48   29  175   50  179  153   11   29  273  Q7Z163     Trypsin-like serine protease OS=Dermatophagoides pteronyssinus PE=2 SV=1
 2380 : Q804G1_DANRE        0.31  0.47   29  171   29  158  148    7   23  265  Q804G1     Elastase B OS=Danio rerio GN=ela2l PE=2 SV=1
 2381 : Q80UR4_MOUSE        0.31  0.47   29  174   35  175  154   10   21  318  Q80UR4     Mast cell protease-11 OS=Mus musculus GN=Prss34 PE=2 SV=1
 2382 : Q80XZ3_RAT          0.31  0.48   29  175   30  162  152    9   24  311  Q80XZ3     Protein Tpsg1 OS=Rattus norvegicus GN=Tpsg1 PE=2 SV=1
 2383 : Q8I8E3_AEDPO        0.31  0.47   29  170   26  155  146    7   20  257  Q8I8E3     Late trypsin OS=Aedes polynesiensis PE=3 SV=1
 2384 : Q8MWR4_DERPT        0.31  0.48   29  175   64  193  153   11   29  261  Q8MWR4     Serine protease LM-1 (Fragment) OS=Dermatophagoides pteronyssinus PE=2 SV=2
 2385 : Q8SYB5_DROME        0.31  0.42   29  175   38  173  153    8   23  281  Q8SYB5     RE74144p OS=Drosophila melanogaster GN=Jon65Aiv PE=2 SV=1
 2386 : Q8T4N4_RHIAP        0.31  0.52   29  175   45  177  151    8   22  298  Q8T4N4     Midgut serine proteinase-1 OS=Rhipicephalus appendiculatus PE=2 SV=1
 2387 : Q9CPN9_MOUSE        0.31  0.49   29  171   25  147  144    7   22  247  Q9CPN9     Protein 2210010C04Rik OS=Mus musculus GN=2210010C04Rik PE=2 SV=1
 2388 : Q9CVU2_MOUSE        0.31  0.51  185  278   21  106   95    3   10  108  Q9CVU2     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=Klk1b3 PE=2 SV=1
 2389 : Q9D960_MOUSE        0.31  0.51   29  174   34  165  146    6   14  264  Q9D960     Putative uncharacterized protein OS=Mus musculus GN=Ctrl PE=2 SV=1
 2390 : Q9GSM7_CHRBE        0.31  0.54   37  156    1  112  120    2    8  177  Q9GSM7     Serine protease K16/F1R1 (Fragment) OS=Chrysomya bezziana PE=2 SV=1
 2391 : Q9GSM9_CHRBE        0.31  0.47   37  154    1  112  121    4   12  179  Q9GSM9     Serine protease K15/F2R3 (Fragment) OS=Chrysomya bezziana PE=2 SV=1
 2392 : Q9NB49_AEDAE        0.31  0.47   29  170   26  155  146    7   20  257  Q9NB49     Late trypsin OS=Aedes aegypti PE=2 SV=1
 2393 : Q9NB89_AGRIP        0.31  0.51  178  272  101  192  101    5   15  197  Q9NB89     Trypsin AiD2 (Fragment) OS=Agrotis ipsilon PE=2 SV=1
 2394 : Q9VUG2_DROME        0.31  0.48   29  175  128  262  154    9   26  374  Q9VUG2     CG4914 OS=Drosophila melanogaster GN=CG4914 PE=2 SV=2
 2395 : Q9W7Q3_PAROL        0.31  0.50   29  170   31  157  147    8   25  260  Q9W7Q3     Chymotrypsinogen 2 OS=Paralichthys olivaceus PE=2 SV=1
 2396 : Q9W7Q6_PAROL        0.31  0.52   29  175   18  144  149    8   24  238  Q9W7Q6     Trypsinogen 2 (Fragment) OS=Paralichthys olivaceus PE=2 SV=1
 2397 : Q9XY55_CTEFE        0.31  0.48   29  175   29  163  149    7   16  265  Q9XY55     Trypsin-like serine protease OS=Ctenocephalides felis GN=SP-28 PE=2 SV=1
 2398 : Q9XYY0_RHYDO        0.31  0.45   29  175   33  163  148    7   18  254  Q9XYY0     Trypsinogen RdoT2 OS=Rhyzopertha dominica PE=2 SV=1
 2399 : Q9Z1R9_MOUSE        0.31  0.49   29  171   24  146  143    6   20  246  Q9Z1R9     MCG124046 OS=Mus musculus GN=Prss1 PE=2 SV=1
 2400 : R0JAU7_ANAPL        0.31  0.49   29  170    1  125  143    7   19  241  R0JAU7     Putative serine protease UNQ9391/PRO34284 (Fragment) OS=Anas platyrhynchos GN=Anapl_16237 PE=3 SV=1
 2401 : R0KLY7_ANAPL        0.31  0.50   29  175   35  167  149    7   18  265  R0KLY7     Chymotrypsin-like protease CTRL-1 (Fragment) OS=Anas platyrhynchos GN=Anapl_14699 PE=3 SV=1
 2402 : R0LW87_ANAPL        0.31  0.46   29  151   31  147  127    3   14  194  R0LW87     Chymotrypsin-C (Fragment) OS=Anas platyrhynchos GN=Anapl_04396 PE=3 SV=1
 2403 : R1DEK6_EMIHU        0.31  0.51  183  273    1   93   97    4   10   95  R1DEK6     Uncharacterized protein (Fragment) OS=Emiliania huxleyi CCMP1516 GN=EMIHUDRAFT_62191 PE=3 SV=1
 2404 : R1EJ14_EMIHU        0.31  0.51  183  273    1   93   97    4   10   95  R1EJ14     Uncharacterized protein (Fragment) OS=Emiliania huxleyi CCMP1516 GN=EMIHUDRAFT_48533 PE=3 SV=1
 2405 : R4GD27_ANOCA        0.31  0.52  179  278  104  201  106    7   14  202  R4GD27     Uncharacterized protein OS=Anolis carolinensis PE=3 SV=1
 2406 : R7VEX5_CAPTE        0.31  0.51   29  175   12  147  149    6   15  251  R7VEX5     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_127358 PE=3 SV=1
 2407 : R7VKE8_CAPTE        0.31  0.47   29  170    2  135  147   10   18  239  R7VKE8     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_113671 PE=3 SV=1
 2408 : R7VQZ4_COLLI        0.31  0.46  179  275   96  191  104    7   15  192  R7VQZ4     Proproteinase E (Fragment) OS=Columba livia GN=A306_15220 PE=3 SV=1
 2409 : S4RJT3_PETMA        0.31  0.50  179  275   95  190  104    7   15  207  S4RJT3     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 2410 : S4RNN4_PETMA        0.31  0.51  179  275   58  152  101    7   10  153  S4RNN4     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 2411 : S4RV87_PETMA        0.31  0.47   29  171   24  150  143    6   16  238  S4RV87     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 2412 : S4RVH1_PETMA        0.31  0.49   29  175   24  154  150   10   22  239  S4RVH1     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
 2413 : S4RVH5_PETMA        0.31  0.49   29  175   24  152  149    9   22  235  S4RVH5     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
 2414 : S4RXQ9_PETMA        0.31  0.44   29  171   16  142  144    6   18  246  S4RXQ9     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (5 of 11) PE=3 SV=1
 2415 : S7N3V3_MYOBR        0.31  0.50   29  175   48  185  149    9   13  295  S7N3V3     Testisin OS=Myotis brandtii GN=D623_10001663 PE=3 SV=1
 2416 : S7PHV8_MYOBR        0.31  0.50   29  175   31  166  150    9   17  275  S7PHV8     Tryptase beta-2 OS=Myotis brandtii GN=D623_10017231 PE=3 SV=1
 2417 : S9WWY6_9CETA        0.31  0.45   29  172  296  469  180   13   42  571  S9WWY6     Neurotrypsin OS=Camelus ferus GN=CB1_000816018 PE=3 SV=1
 2418 : S9XBU7_9CETA        0.31  0.49   29  172   34  183  156    6   18  301  S9XBU7     Chymotrypsinogen B OS=Camelus ferus GN=CB1_000407011 PE=3 SV=1
 2419 : S9XP19_9CETA        0.31  0.51   30  171   44  169  144    7   20  240  S9XP19     Tryptase-like protein OS=Camelus ferus GN=CB1_008058002 PE=3 SV=1
 2420 : S9YND7_9CETA        0.31  0.52   29  175   17  152  147    4   11  210  S9YND7     Prostasin isoform 2 OS=Camelus ferus GN=CB1_000144002 PE=3 SV=1
 2421 : T1DQA3_ANOAQ        0.31  0.53  178  278   67  174  111    5   13  176  T1DQA3     Putative clip-domain serine protease subfamily protein d (Fragment) OS=Anopheles aquasalis PE=2 SV=1
 2422 : T1DQL0_ANOAQ        0.31  0.49   29  171   25  162  151    9   21  265  T1DQL0     Putative serine-type enodpeptidase OS=Anopheles aquasalis PE=2 SV=1
 2423 : T1FNH7_HELRO        0.31  0.48   29  175   46  181  150    8   17  287  T1FNH7     Uncharacterized protein OS=Helobdella robusta GN=HELRODRAFT_185960 PE=3 SV=1
 2424 : T1FNH8_HELRO        0.31  0.49   29  175   46  181  150    7   17  284  T1FNH8     Uncharacterized protein OS=Helobdella robusta GN=HELRODRAFT_185962 PE=3 SV=1
 2425 : T1G1D8_HELRO        0.31  0.51  177  278   38  139  108    5   12  141  T1G1D8     Uncharacterized protein (Fragment) OS=Helobdella robusta GN=HELRODRAFT_73425 PE=3 SV=1
 2426 : T1H2L0_MEGSC        0.31  0.48   29  175   20  162  152    7   14  261  T1H2L0     Uncharacterized protein OS=Megaselia scalaris PE=3 SV=1
 2427 : T1H3L2_MEGSC        0.31  0.51  187  276   27  113   94    4   11  114  T1H3L2     Uncharacterized protein OS=Megaselia scalaris PE=3 SV=1
 2428 : T1H3X5_MEGSC        0.31  0.53   41  175    7  128  135    3   13  189  T1H3X5     Uncharacterized protein (Fragment) OS=Megaselia scalaris PE=3 SV=1
 2429 : T1HMX6_RHOPR        0.31  0.50   41  171    8  133  137    6   17  223  T1HMX6     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
 2430 : T1HVM9_RHOPR        0.31  0.51  190  277    1   89   93    4    9   93  T1HVM9     Uncharacterized protein OS=Rhodnius prolixus PE=3 SV=1
 2431 : T1IJ93_STRMM        0.31  0.53   43  174    2  126  133    5    9  243  T1IJ93     Uncharacterized protein OS=Strigamia maritima PE=3 SV=1
 2432 : T1J326_STRMM        0.31  0.50   29  175   73  206  150    8   19  309  T1J326     Uncharacterized protein OS=Strigamia maritima PE=3 SV=1
 2433 : T1L3A6_TETUR        0.31  0.46  177  278  108  209  108    6   12  212  T1L3A6     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 2434 : T1L3B4_TETUR        0.31  0.51   30  173   41  167  148    8   25  276  T1L3B4     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 2435 : T1PEV6_MUSDO        0.31  0.49   29  175   10  145  150    7   17  245  T1PEV6     Trypsin OS=Musca domestica PE=2 SV=1
 2436 : T1PNR5_MUSDO        0.31  0.49   29  175   35  170  150    7   17  270  T1PNR5     Trypsin OS=Musca domestica PE=2 SV=1
 2437 : T1RTT5_CARAU        0.31  0.51   29  175   17  152  147    4   11  210  T1RTT5     Coagulation factor X (Fragment) OS=Carassius auratus PE=2 SV=1
 2438 : TRY1_CANFA          0.31  0.49   29  174   24  149  147    6   22  246  P06871     Cationic trypsin OS=Canis familiaris PE=2 SV=1
 2439 : TRY6_HUMAN          0.31  0.49   29  171   24  146  144    7   22  247  Q8NHM4     Putative trypsin-6 OS=Homo sapiens GN=PRSS3P2 PE=5 SV=2
 2440 : TRYA_RAT            0.31  0.48   29  173   25  149  146    7   22  246  P32821     Trypsin V-A OS=Rattus norvegicus PE=2 SV=1
 2441 : TRYB_RAT            0.31  0.48   29  173   25  149  146    7   22  246  P32822     Trypsin V-B OS=Rattus norvegicus PE=2 SV=1
 2442 : TRYG1_MOUSE         0.31  0.45   29  175   30  162  152    9   24  311  Q9QUL7     Tryptase gamma OS=Mus musculus GN=Tpsg1 PE=2 SV=1
 2443 : TRYM_CANFA          0.31  0.48   29  174   31  171  154    8   21  280  P19236     Mastin OS=Canis familiaris PE=1 SV=2
 2444 : TRYP_SARBU          0.31  0.51   29  171   27  152  143    6   17  254  P51588     Trypsin OS=Sarcophaga bullata PE=1 SV=1
 2445 : TRYT_CANFA          0.31  0.50   29  175   31  166  149    8   15  275  P15944     Tryptase OS=Canis familiaris PE=3 SV=1
 2446 : TRYT_MERUN          0.31  0.49   29  175   26  161  152   10   21  270  P50342     Mast cell tryptase OS=Meriones unguiculatus PE=2 SV=1
 2447 : TRYT_PIG            0.31  0.46   29  175   31  166  154    8   25  275  Q9N2D1     Tryptase OS=Sus scrofa GN=MCT7 PE=2 SV=1
 2448 : U3IMX3_ANAPL        0.31  0.50   29  175   44  176  149    7   18  267  U3IMX3     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=CTRL PE=3 SV=1
 2449 : U3JVS3_FICAL        0.31  0.46   29  175    6  136  147    6   16  237  U3JVS3     Uncharacterized protein (Fragment) OS=Ficedula albicollis PE=3 SV=1
 2450 : U3K646_FICAL        0.31  0.47   29  175   30  167  153    6   21  270  U3K646     Uncharacterized protein OS=Ficedula albicollis PE=3 SV=1
 2451 : U3K7E1_FICAL        0.31  0.47   29  175   33  169  154    7   24  272  U3K7E1     Uncharacterized protein (Fragment) OS=Ficedula albicollis PE=3 SV=1
 2452 : U5EYE8_9DIPT        0.31  0.47   29  175   50  184  153    9   24  323  U5EYE8     Putative trypsin-like serine protease (Fragment) OS=Corethrella appendiculata PE=2 SV=1
 2453 : U5KFM4_9EUCA        0.31  0.49   29  175   32  161  150    8   23  257  U5KFM4     Chymotrypsin (Fragment) OS=Farfantepenaeus californiensis GN=CHY13 PE=2 SV=1
 2454 : U5KG35_9EUCA        0.31  0.49   29  175   32  161  150    8   23  257  U5KG35     Chymotrypsin (Fragment) OS=Farfantepenaeus californiensis GN=CHY14 PE=2 SV=1
 2455 : U5KGX4_9EUCA        0.31  0.49   29  175   32  161  150    8   23  257  U5KGX4     Chymotrypsin (Fragment) OS=Farfantepenaeus californiensis GN=CHY20 PE=2 SV=1
 2456 : U6D2K1_NEOVI        0.31  0.55   29  175   65  206  150    6   11  305  U6D2K1     Suppression of tumorigenicity 14 (Colon carcinoma) (Fragment) OS=Neovison vison GN=E9PNS7 PE=2 SV=1
 2457 : U6DW05_NEOVI        0.31  0.52   29  172   23  157  148   10   17  276  U6DW05     Coagulation factor VII (Serum prothrombin conversion accelerator) (Fragment) OS=Neovison vison GN=F5H8B0 PE=2 SV=1
 2458 : U6I3X6_HYMMI        0.31  0.46   29  170   97  256  167    9   32  357  U6I3X6     Chymotrypsin-like protein OS=Hymenolepis microstoma GN=HmN_000126100 PE=3 SV=1
 2459 : U6JRN4_TITSE        0.31  0.48   29  175  203  349  163   10   32  455  U6JRN4     CUB and LDL domains-containing trypsin-like serine peptidase 2 protein OS=Tityus serrulatus GN=prss PE=2 SV=1
 2460 : V5H0W6_IXORI        0.31  0.49   29  170   60  214  166   11   35  377  V5H0W6     Putative trypsin-like serine protease OS=Ixodes ricinus PE=2 SV=1
 2461 : V5H9H8_IXORI        0.31  0.50   29  175  215  351  157    9   30  436  V5H9H8     Putative serine protease OS=Ixodes ricinus PE=2 SV=1
 2462 : V5HE24_IXORI        0.31  0.51   29  175   43  181  154    8   22  300  V5HE24     Putative tick serine proteinase (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2463 : V5HKZ6_IXORI        0.31  0.51   29  175   16  154  153    9   20  273  V5HKZ6     Putative tick serine proteinase (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2464 : V5HWX4_IXORI        0.31  0.49   29  150   18  129  122    2   10  166  V5HWX4     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2465 : V5I2B4_IXORI        0.31  0.49   29  170   56  210  166   11   35  373  V5I2B4     Putative trypsin-like serine protease OS=Ixodes ricinus PE=2 SV=1
 2466 : V5IER6_IXORI        0.31  0.51   29  170   18  146  147   11   23  291  V5IER6     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2467 : V5UUY2_CTEID        0.31  0.51   29  174   21  154  147    6   14  250  V5UUY2     Complement factor D OS=Ctenopharyngodon idella PE=2 SV=1
 2468 : V9IKJ2_APICE        0.31  0.56  182  277    1   99  104    5   13   99  V9IKJ2     Serine protease 29 OS=Apis cerana GN=ACCB13433 PE=3 SV=1
 2469 : VSP21_CRODU         0.31  0.53   29  175    1  131  148    6   18  238  Q58G94     Thrombin-like enzyme gyroxin B2.1 OS=Crotalus durissus terrificus PE=2 SV=1
 2470 : W4W058_ATTCE        0.31  0.50   29  170   48  176  147   11   23  287  W4W058     Uncharacterized protein OS=Atta cephalotes PE=3 SV=1
 2471 : W4WDK0_ATTCE        0.31  0.49   29  175   40  178  154    9   22  284  W4WDK0     Uncharacterized protein (Fragment) OS=Atta cephalotes PE=3 SV=1
 2472 : W4X6M9_ATTCE        0.31  0.47   29  172  120  261  154   10   22  368  W4X6M9     Uncharacterized protein OS=Atta cephalotes PE=3 SV=1
 2473 : W4XDY0_STRPU        0.31  0.46   29  174   34  166  147    6   15  243  W4XDY0     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-GramarL2 PE=3 SV=1
 2474 : W4Y1J8_STRPU        0.31  0.54  182  278   87  180  104   11   17  180  W4Y1J8     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
 2475 : W4Z6Q7_STRPU        0.31  0.51  177  277  109  204  102    4    7  206  W4Z6Q7     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
 2476 : W5J9E4_ANODA        0.31  0.48   29  172   46  173  147    6   22  268  W5J9E4     Serine protease SP24D OS=Anopheles darlingi GN=AND_007755 PE=3 SV=1
 2477 : W5JEZ0_ANODA        0.31  0.53   29  175   64  197  150    8   19  304  W5JEZ0     Oviductin OS=Anopheles darlingi GN=AND_005381 PE=3 SV=1
 2478 : W5JW35_ANODA        0.31  0.51   29  170   32  156  148   11   29  259  W5JW35     Chymotrypsin 1 OS=Anopheles darlingi GN=AND_000483 PE=3 SV=1
 2479 : W5KEJ7_ASTMX        0.31  0.50   29  170   34  160  147    8   25  263  W5KEJ7     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 2480 : W5LWA6_LEPOC        0.31  0.52   29  175   11  149  151    7   16  246  W5LWA6     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 2481 : W5M332_LEPOC        0.31  0.45   29  172   29  161  148    6   19  267  W5M332     Uncharacterized protein OS=Lepisosteus oculatus GN=CTRC (1 of 2) PE=3 SV=1
 2482 : W5MA70_LEPOC        0.31  0.54  179  277   93  182  102    5   15  184  W5MA70     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 2483 : W5MB07_LEPOC        0.31  0.48   29  172   32  166  150    6   21  272  W5MB07     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 2484 : W5MB39_LEPOC        0.31  0.48   29  172   29  163  150    6   21  269  W5MB39     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 2485 : W5N3I8_LEPOC        0.31  0.48   29  174   27  157  147    7   17  263  W5N3I8     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 2486 : W5P9F4_SHEEP        0.31  0.46   29  173   34  156  147    6   26  256  W5P9F4     Uncharacterized protein OS=Ovis aries GN=CTRB1 PE=3 SV=1
 2487 : W5Q4Y9_SHEEP        0.31  0.47   29  171   21  143  144    7   22  244  W5Q4Y9     Uncharacterized protein OS=Ovis aries GN=LOC101112559 PE=3 SV=1
 2488 : W5Q4Z1_SHEEP        0.31  0.47   29  171   24  146  144    7   22  247  W5Q4Z1     Uncharacterized protein OS=Ovis aries GN=LOC101112559 PE=3 SV=1
 2489 : W6MEX2_PAGBR        0.31  0.53  178  278   22  117  105    8   13  163  W6MEX2     Prophenoloxidase-activating-factor2 protein (Fragment) OS=Pagurus bernhardus PE=3 SV=1
 2490 : W8AJI5_CERCA        0.31  0.53   29  175   56  196  154    8   20  299  W8AJI5     Serine proteinase stubble (Fragment) OS=Ceratitis capitata GN=STUB PE=2 SV=1
 2491 : W8B4K9_CERCA        0.31  0.54  178  278   49  153  110    9   14  154  W8B4K9     Enteropeptidase (Fragment) OS=Ceratitis capitata GN=ENTK PE=2 SV=1
 2492 : W8C8S9_CERCA        0.31  0.51   29  175  143  281  154    8   22  388  W8C8S9     Serine proteinase stubble OS=Ceratitis capitata GN=STUB PE=2 SV=1
 2493 : X1WC94_DANRE        0.31  0.55   29  175   35  170  150    7   17  284  X1WC94     Uncharacterized protein OS=Danio rerio GN=si:dkeyp-93a5.2 PE=4 SV=1
 2494 : X1XXH2_ANODA        0.31  0.49   29  175    9  147  151    6   16  253  X1XXH2     Uncharacterized protein OS=Anopheles darlingi PE=4 SV=1
 2495 : X1Y0K3_ANODA        0.31  0.53   29  175   64  197  150    8   19  304  X1Y0K3     Uncharacterized protein OS=Anopheles darlingi PE=4 SV=1
 2496 : X1YJ86_ANODA        0.31  0.47   34  148   36  133  115    3   17  158  X1YJ86     Uncharacterized protein OS=Anopheles darlingi PE=4 SV=1
 2497 : A1L119_RAT          0.30  0.44   29  172   21  151  147    7   19  246  A1L119     Gzmb protein OS=Rattus norvegicus GN=Gzmb PE=2 SV=1
 2498 : A1XG72_TENMO        0.30  0.47   29  175   46  176  149    7   20  275  A1XG72     Chymotrypsin 1 OS=Tenebrio molitor PE=2 SV=1
 2499 : A1XG86_TENMO        0.30  0.49   29  175   34  166  149    7   18  266  A1XG86     Putative serine proteinase OS=Tenebrio molitor PE=2 SV=1
 2500 : A2IBW0_DICLA        0.30  0.53  180  277   13  109  102    6    9  111  A2IBW0     Elastase 4-like protein (Fragment) OS=Dicentrarchus labrax PE=2 SV=1
 2501 : A2RSL0_MOUSE        0.30  0.48   29  175  208  343  155    7   27  445  A2RSL0     Transmembrane protease, serine 5 (Spinesin) OS=Mus musculus GN=Tmprss5 PE=2 SV=1
 2502 : A3EXU0_MACHI        0.30  0.51  182  276   85  180  104    7   17  182  A3EXU0     Serine protease-like protein (Fragment) OS=Maconellicoccus hirsutus PE=2 SV=1
 2503 : A3RKG7_HUMAN        0.30  0.52   29  172   20  154  147    8   15  273  A3RKG7     Coagulation factor VII (Fragment) OS=Homo sapiens PE=2 SV=1
 2504 : A4UWM7_ORYLA        0.30  0.48   29  175   21  147  149    7   24  242  A4UWM7     Trypsinogen OS=Oryzias latipes GN=tryp PE=2 SV=1
 2505 : A6QPI9_BOVIN        0.30  0.49   29  175   27  162  150    8   17  271  A6QPI9     TPSB1 protein OS=Bos taurus GN=TPSB1 PE=2 SV=1
 2506 : A7LD78_PAROL        0.30  0.48   29  175   21  147  149    7   24  241  A7LD78     Trypsinogen 2 OS=Paralichthys olivaceus GN=TRP2 PE=2 SV=1
 2507 : A7MCG1_DANRE        0.30  0.49   29  174   21  153  148    7   17  249  A7MCG1     Zgc:109940 OS=Danio rerio GN=cfd PE=2 SV=1
 2508 : A7RW61_NEMVE        0.30  0.49   29  175    3  138  151    9   19  235  A7RW61     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g25219 PE=3 SV=1
 2509 : A7RWF5_NEMVE        0.30  0.53   29  173    1  148  156    9   19  266  A7RWF5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g95672 PE=3 SV=1
 2510 : A7SBL1_NEMVE        0.30  0.49   29  172    2  128  145    6   19  229  A7SBL1     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g112440 PE=3 SV=1
 2511 : A7SBN0_NEMVE        0.30  0.48   29  175   31  163  150    8   20  279  A7SBN0     Predicted protein OS=Nematostella vectensis GN=v1g229839 PE=3 SV=1
 2512 : A7SNF6_NEMVE        0.30  0.49   29  174    3  133  148    8   19  227  A7SNF6     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g124717 PE=3 SV=1
 2513 : A7SYI8_NEMVE        0.30  0.55   30  174    3  139  150    7   18  261  A7SYI8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g137929 PE=3 SV=1
 2514 : A7VMR5_SOLSE        0.30  0.50   29  175   21  147  149    7   24  242  A7VMR5     Trypsinogen 1b OS=Solea senegalensis GN=TRP1b PE=2 SV=1
 2515 : A7VMR7_SOLSE        0.30  0.51   29  175   25  151  148    8   22  247  A7VMR7     Trypsinogen 2 OS=Solea senegalensis GN=Tryp2 PE=2 SV=1
 2516 : A7VMR9_SOLSE        0.30  0.46   29  172   23  148  145    7   20  249  A7VMR9     Trypsinogen Y OS=Solea senegalensis GN=TRPY PE=2 SV=1
 2517 : A8JE78_CHLRE        0.30  0.53  178  277   19  112  100    2    6  112  A8JE78     Predicted protein (Fragment) OS=Chlamydomonas reinhardtii GN=MOT50 PE=3 SV=1
 2518 : A9UMF4_XENTR        0.30  0.49   29  174   21  153  148    7   17  249  A9UMF4     LOC100135337 protein OS=Xenopus tropicalis GN=LOC100135337 PE=2 SV=1
 2519 : ACRO_HUMAN          0.30  0.48   29  174   43  187  158   11   25  421  P10323     Acrosin OS=Homo sapiens GN=ACR PE=2 SV=4
 2520 : ACRO_RAT            0.30  0.47   29  175   43  189  158   10   22  437  P29293     Acrosin OS=Rattus norvegicus GN=Acr PE=2 SV=2
 2521 : ACRO_SHEEP  1FIW    0.30  0.47   29  175   40  186  161   13   28  329  Q9GL10     Acrosin (Fragment) OS=Ovis aries GN=ACR PE=1 SV=1
 2522 : B0JYP7_BOVIN        0.30  0.47   29  172   30  163  148    7   18  268  B0JYP7     Chymotrypsin C (Caldecrin) OS=Bos taurus GN=CTRC PE=2 SV=1
 2523 : B0LM09_ELEED        0.30  0.46   29  170   17  158  154   10   24  276  B0LM09     Acrosin (Fragment) OS=Elephantulus edwardii GN=ACR PE=3 SV=1
 2524 : B0LM21_LAMGL        0.30  0.47   29  175   17  163  157   11   20  276  B0LM21     Acrosin (Fragment) OS=Lama glama GN=ACR PE=3 SV=1
 2525 : B0LM23_TADBR        0.30  0.49   29  175   17  163  156    9   18  276  B0LM23     Acrosin (Fragment) OS=Tadarida brasiliensis GN=ACR PE=3 SV=1
 2526 : B0LM29_9EUTH        0.30  0.50   29  174   17  162  153    7   14  244  B0LM29     Acrosin (Fragment) OS=Manis sp. DMR-2008 GN=ACR PE=3 SV=1
 2527 : B0LM30_CYNVO        0.30  0.54   29  174   17  161  151    5   11  234  B0LM30     Acrosin (Fragment) OS=Cynocephalus volans GN=ACR PE=3 SV=1
 2528 : B0LM37_RATFU        0.30  0.49   29  175   17  163  156   10   18  276  B0LM37     Acrosin (Fragment) OS=Rattus fuscipes GN=ACR PE=3 SV=1
 2529 : B0VXU2_SISCA        0.30  0.53   29  175   25  155  148    4   18  260  B0VXU2     Serine proteinase isoform 10 OS=Sistrurus catenatus edwardsii PE=2 SV=1
 2530 : B0W8L7_CULQU        0.30  0.51  178  278  118  215  106    5   13  215  B0W8L7     Anionic trypsin-2 OS=Culex quinquefasciatus GN=CpipJ_CPIJ003325 PE=3 SV=1
 2531 : B0WAK4_CULQU        0.30  0.47   29  175   35  164  148    7   19  261  B0WAK4     Chymotrypsin 1 OS=Culex quinquefasciatus GN=CpipJ_CPIJ003915 PE=3 SV=1
 2532 : B0XCB9_CULQU        0.30  0.48   29  172   59  200  158   11   30  317  B0XCB9     Prostasin OS=Culex quinquefasciatus GN=CpipJ_CPIJ016831 PE=3 SV=1
 2533 : B0ZBN7_9SCAR        0.30  0.52   29  175   47  183  150    8   16  282  B0ZBN7     Serine protease 9 OS=Costelytra zealandica GN=SP9 PE=2 SV=1
 2534 : B0ZBN8_9SCAR        0.30  0.52   29  175   47  183  150    8   16  282  B0ZBN8     Serine protease 10 OS=Costelytra zealandica GN=SP10 PE=2 SV=1
 2535 : B0ZBN9_9SCAR        0.30  0.52   29  175   47  183  150    8   16  283  B0ZBN9     Serine protease 11 OS=Costelytra zealandica GN=SP11 PE=2 SV=1
 2536 : B2FVT2_ANOAR        0.30  0.52   37  171    1  122  135    4   13  225  B2FVT2     CLIPD1 protein (Fragment) OS=Anopheles arabiensis GN=clipd1 PE=3 SV=1
 2537 : B2FVT3_ANOAR        0.30  0.52   37  171    1  122  135    4   13  225  B2FVT3     CLIPD1 protein (Fragment) OS=Anopheles arabiensis GN=clipd1 PE=3 SV=1
 2538 : B2FVT5_ANOAR        0.30  0.52   37  171    1  122  135    4   13  225  B2FVT5     CLIPD1 protein (Fragment) OS=Anopheles arabiensis GN=clipd1 PE=3 SV=1
 2539 : B2FVT6_ANOAR        0.30  0.52   37  171    1  122  135    4   13  225  B2FVT6     CLIPD1 protein (Fragment) OS=Anopheles arabiensis GN=clipd1 PE=3 SV=1
 2540 : B2FVU0_ANOGA        0.30  0.52   37  171    1  122  135    4   13  225  B2FVU0     CLIPD1 protein (Fragment) OS=Anopheles gambiae GN=clipd1 PE=3 SV=1
 2541 : B2FVU2_ANOGA        0.30  0.52   37  171    1  122  135    4   13  225  B2FVU2     CLIPD1 protein (Fragment) OS=Anopheles gambiae GN=clipd1 PE=3 SV=1
 2542 : B3GEG4_SINCH        0.30  0.51   29  175   21  147  148    8   22  242  B3GEG4     Trypsinogen 2 OS=Siniperca chuatsi GN=TRS-B PE=2 SV=1
 2543 : B3LXN6_DROAN        0.30  0.45   29  171   67  201  150    9   22  313  B3LXN6     GF16272 OS=Drosophila ananassae GN=Dana\GF16272 PE=3 SV=1
 2544 : B3LXZ8_DROAN        0.30  0.49   29  175  131  289  162   10   18  393  B3LXZ8     GF18202 OS=Drosophila ananassae GN=Dana\GF18202 PE=3 SV=1
 2545 : B3MP30_DROAN        0.30  0.52   29  174   53  181  146    6   17  279  B3MP30     GF14668 OS=Drosophila ananassae GN=Dana\GF14668 PE=3 SV=1
 2546 : B3N6X4_DROER        0.30  0.43   29  174   62  215  158    9   16  312  B3N6X4     GG24097 OS=Drosophila erecta GN=Dere\GG24097 PE=3 SV=1
 2547 : B3NYQ7_DROER        0.30  0.57   29  175  137  291  160    8   18  391  B3NYQ7     GG14174 OS=Drosophila erecta GN=Dere\GG14174 PE=3 SV=1
 2548 : B3Y8K5_ONCKE2ZPR    0.30  0.50   29  175    1  127  148    8   22  222  B3Y8K5     Anionic trypsin isoform 2 (Fragment) OS=Oncorhynchus keta PE=1 SV=1
 2549 : B3Y8K6_ONCKE2ZPS    0.30  0.50   29  175    1  127  148    8   22  222  B3Y8K6     Anionic trypsin isoform 3 (Fragment) OS=Oncorhynchus keta PE=1 SV=1
 2550 : B4GHA0_DROPE        0.30  0.45   29  175   54  186  150    8   20  304  B4GHA0     GL17487 OS=Drosophila persimilis GN=Dper\GL17487 PE=3 SV=1
 2551 : B4GR27_DROPE        0.30  0.47   29  175   30  164  150    8   18  263  B4GR27     GL25036 OS=Drosophila persimilis GN=Dper\GL25036 PE=3 SV=1
 2552 : B4GTK8_DROPE        0.30  0.55   29  170   26  155  145    7   18  282  B4GTK8     GL14376 OS=Drosophila persimilis GN=Dper\GL14376 PE=3 SV=1
 2553 : B4H6E4_DROPE        0.30  0.46   29  175   40  174  149    7   16  272  B4H6E4     GL15539 OS=Drosophila persimilis GN=Dper\GL15539 PE=3 SV=1
 2554 : B4H6F8_DROPE        0.30  0.49   29  170   26  159  148    7   20  270  B4H6F8     GL15524 OS=Drosophila persimilis GN=Dper\GL15524 PE=3 SV=1
 2555 : B4I2Z7_DROSE        0.30  0.51   29  174   51  179  146    6   17  277  B4I2Z7     GM18144 OS=Drosophila sechellia GN=Dsec\GM18144 PE=3 SV=1
 2556 : B4J002_DROGR        0.30  0.44   29  175   38  173  150    7   17  272  B4J002     GH15022 OS=Drosophila grimshawi GN=Dgri\GH15022 PE=3 SV=1
 2557 : B4JRS0_DROGR        0.30  0.45   29  174  138  285  160   11   26  388  B4JRS0     GH19618 OS=Drosophila grimshawi GN=Dgri\GH19618 PE=3 SV=1
 2558 : B4K759_DROMO        0.30  0.47   29  175  128  278  161   10   24  380  B4K759     GI22268 OS=Drosophila mojavensis GN=Dmoj\GI22268 PE=3 SV=1
 2559 : B4LLV2_DROVI        0.30  0.50   29  170   35  166  146    7   18  271  B4LLV2     GJ20009 OS=Drosophila virilis GN=Dvir\GJ20009 PE=3 SV=1
 2560 : B4LNQ2_DROVI        0.30  0.47   29  173   33  161  146    9   18  259  B4LNQ2     GJ21048 OS=Drosophila virilis GN=Dvir\GJ21048 PE=3 SV=1
 2561 : B4LRU7_DROVI        0.30  0.53   29  174   50  178  146    6   17  276  B4LRU7     GJ17600 OS=Drosophila virilis GN=Dvir\GJ17600 PE=3 SV=1
 2562 : B4M283_DROVI        0.30  0.52   29  173  108  264  161    9   20  371  B4M283     GJ19441 OS=Drosophila virilis GN=Dvir\GJ19441 PE=3 SV=1
 2563 : B4MAW9_DROVI        0.30  0.53   29  175   28  160  148    5   16  267  B4MAW9     GJ15994 OS=Drosophila virilis GN=Dvir\GJ15994 PE=3 SV=1
 2564 : B4MB26_DROVI        0.30  0.53   29  170   31  160  146    8   20  289  B4MB26     GJ16031 OS=Drosophila virilis GN=Dvir\GJ16031 PE=3 SV=1
 2565 : B4MBJ7_DROVI        0.30  0.47   29  175  134  292  163   11   20  396  B4MBJ7     GJ14460 OS=Drosophila virilis GN=Dvir\GJ14460 PE=3 SV=1
 2566 : B4N8B1_DROWI        0.30  0.50   29  172  130  281  159    9   22  384  B4N8B1     GK12018 OS=Drosophila willistoni GN=Dwil\GK12018 PE=3 SV=1
 2567 : B4N8X7_DROWI        0.30  0.45   29  175   29  163  149    7   16  263  B4N8X7     GK11558 OS=Drosophila willistoni GN=Dwil\GK11558 PE=3 SV=1
 2568 : B4PBJ1_DROYA        0.30  0.49   29  170   31  155  144    9   21  258  B4PBJ1     GE12601 OS=Drosophila yakuba GN=Dyak\GE12601 PE=3 SV=1
 2569 : B4QG48_DROSI        0.30  0.52   29  175   43  171  149    8   22  273  B4QG48     GD25188 OS=Drosophila simulans GN=Dsim\GD25188 PE=3 SV=1
 2570 : B4QHZ5_DROSI        0.30  0.48   29  173   38  169  147    6   17  266  B4QHZ5     GD11198 OS=Drosophila simulans GN=Dsim\GD11198 PE=3 SV=1
 2571 : B5BUM9_HUMAN        0.30  0.46   29  175   36  168  151    8   22  277  B5BUM9     Kallikrein 13 (Fragment) OS=Homo sapiens GN=KLK13 PE=2 SV=1
 2572 : B5DQM5_DROPS        0.30  0.47   29  175   30  164  150    8   18  263  B5DQM5     GA23594 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA23594 PE=3 SV=1
 2573 : B5X8S3_SALSA        0.30  0.47   29  175   27  158  148    6   17  257  B5X8S3     Complement factor D OS=Salmo salar GN=CFAD PE=2 SV=1
 2574 : B5XB02_SALSA        0.30  0.51   29  173   34  165  148    6   19  265  B5XB02     Chymotrypsin B OS=Salmo salar GN=CTRB PE=2 SV=1
 2575 : B6CGL8_SPAAU        0.30  0.51   29  175   21  147  148    8   22  241  B6CGL8     Trypsinogen OS=Sparus aurata PE=2 SV=1
 2576 : B6D5J2_PERMA        0.30  0.48   29  174   40  185  157   10   22  427  B6D5J2     Acrosin OS=Peromyscus maniculatus bairdii GN=Acr PE=2 SV=1
 2577 : B6D5J3_PERLE        0.30  0.48   29  174   40  185  157   10   22  427  B6D5J3     Acrosin OS=Peromyscus leucopus GN=Acr PE=2 SV=1
 2578 : B6D5J4_9RODE        0.30  0.47   29  175   40  186  158   10   22  427  B6D5J4     Acrosin OS=Peromyscus hylocetes GN=Acr PE=2 SV=1
 2579 : B6DDQ0_ANODA        0.30  0.51  178  278   67  174  111    5   13  176  B6DDQ0     CLIP-domain serine protease subfamily D (Fragment) OS=Anopheles darlingi PE=2 SV=1
 2580 : B6VRV4_PYGNA        0.30  0.48   29  175    1  127  148    7   22  222  B6VRV4     Trypsin (Fragment) OS=Pygocentrus nattereri GN=tryp PE=2 SV=1
 2581 : B6Z1W9_SEPLA        0.30  0.52   29  172   28  155  147    8   22  258  B6Z1W9     S1 type peptidase OS=Sepia latimanus PE=2 SV=1
 2582 : B7P5H8_IXOSC        0.30  0.49  179  277    2   99  102    5    7  103  B7P5H8     Ovochymase, putative OS=Ixodes scapularis GN=IscW_ISCW000363 PE=3 SV=1
 2583 : B7SMT7_FENCH        0.30  0.46   29  175   46  175  151    8   25  271  B7SMT7     Chymotrypsin-like serine proteinase OS=Fenneropenaeus chinensis PE=2 SV=1
 2584 : B7ZN60_MOUSE        0.30  0.48   29  175  202  337  155    7   27  439  B7ZN60     Tmprss5 protein OS=Mus musculus GN=Tmprss5 PE=2 SV=1
 2585 : B9EJ35_MOUSE        0.30  0.50   29  171   24  146  143    6   20  246  B9EJ35     Protease, serine, 3 OS=Mus musculus GN=Prss3 PE=2 SV=1
 2586 : C1BM54_OSMMO        0.30  0.48   29  175   29  166  153    6   21  268  C1BM54     Elastase-2A OS=Osmerus mordax GN=ELA2A PE=2 SV=1
 2587 : C1IHU0_PENJP        0.30  0.49   29  175   30  168  152    9   18  266  C1IHU0     Trypsin OS=Penaeus japonicus PE=2 SV=1
 2588 : C3KIJ2_ANOFI        0.30  0.46   29  175   21  147  149    7   24  242  C3KIJ2     Trypsin-1 OS=Anoplopoma fimbria GN=TRY1 PE=2 SV=1
 2589 : C3Y015_BRAFL        0.30  0.51   29  175   14  151  150    6   15  246  C3Y015     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_209214 PE=3 SV=1
 2590 : C3Y3E6_BRAFL        0.30  0.54  177  278   65  167  107    6    9  168  C3Y3E6     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_90656 PE=3 SV=1
 2591 : C3YC37_BRAFL        0.30  0.51   29  174   23  157  149    9   17  244  C3YC37     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_60382 PE=3 SV=1
 2592 : C3YMR7_BRAFL        0.30  0.51   29  170    4  130  142    5   15  236  C3YMR7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_56781 PE=3 SV=1
 2593 : C3YMS0_BRAFL        0.30  0.46   29  175   32  145  148    9   35  244  C3YMS0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_117038 PE=3 SV=1
 2594 : C3YXH9_BRAFL        0.30  0.48   29  170   15  145  145    5   17  200  C3YXH9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_74546 PE=3 SV=1
 2595 : C3ZIW4_BRAFL        0.30  0.48   29  170   45  186  153    8   22  298  C3ZIW4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_105242 PE=3 SV=1
 2596 : C5IBF3_DROMY        0.30  0.48   29  175   33  167  149    5   16  256  C5IBF3     Female reproductive tract protease mayaguana-2 (Fragment) OS=Drosophila mayaguana PE=3 SV=1
 2597 : C5IBF9_DROMT        0.30  0.47   29  175   33  162  148    7   19  256  C5IBF9     Female reproductive tract protease mettleri-1 (Fragment) OS=Drosophila mettleri PE=3 SV=1
 2598 : C5IBG0_DROMT        0.30  0.46   29  171   33  158  143    5   17  247  C5IBG0     Female reproductive tract protease mettleri-2 (Fragment) OS=Drosophila mettleri PE=3 SV=1
 2599 : COGS_UCAPU  1AZZ    0.30  0.48   29  170    1  125  144    7   21  226  P00771     Brachyurin OS=Uca pugilator PE=1 SV=2
 2600 : CTRA_GADMO          0.30  0.52   29  170   34  160  145    7   21  263  P47796     Chymotrypsin A OS=Gadus morhua PE=1 SV=1
 2601 : CTRB1_LITVA         0.30  0.47   29  175   46  175  151    8   25  271  Q00871     Chymotrypsin BI OS=Litopenaeus vannamei PE=1 SV=1
 2602 : CTRC_BOVIN  1PYT    0.30  0.47   29  172   30  163  148    7   18  268  Q7M3E1     Chymotrypsin-C OS=Bos taurus GN=CTRC PE=1 SV=2
 2603 : D0EL76_CTEFE        0.30  0.49   29  170   26  151  144    7   20  248  D0EL76     Chymotrypsin OS=Ctenocephalides felis PE=2 SV=1
 2604 : D0N4A7_PHYIT        0.30  0.53  179  278   61  157  103    5    9  161  D0N4A7     Putative uncharacterized protein OS=Phytophthora infestans (strain T30-4) GN=PITG_06191 PE=3 SV=1
 2605 : D2A5Q6_TRICA        0.30  0.55   29  175   34  164  148    5   18  266  D2A5Q6     Serine protease P160 OS=Tribolium castaneum GN=P160 PE=3 SV=1
 2606 : D2D388_9TELE        0.30  0.48   29  175   25  151  149    7   24  247  D2D388     Trypsinogen OS=Culter alburnus PE=2 SV=1
 2607 : D2GXR8_AILME        0.30  0.47   29  170   13  141  143    6   15  249  D2GXR8     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_001720 PE=3 SV=1
 2608 : D2HZX9_AILME        0.30  0.48   29  175  113  259  157    7   20  359  D2HZX9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_018402 PE=3 SV=1
 2609 : D2Y5C3_PANAR        0.30  0.49   29  175   30  168  152    9   18  278  D2Y5C3     Trypsin 4 OS=Panulirus argus GN=Try4 PE=2 SV=1
 2610 : D3Z3S5_MOUSE        0.30  0.47   34  173    2  121  141    8   22  219  D3Z3S5     Uncharacterized protein OS=Mus musculus GN=Gm4744 PE=3 SV=2
 2611 : D3ZQV0_RAT          0.30  0.50   29  171   24  146  144    7   22  246  D3ZQV0     Protein LOC100365995 OS=Rattus norvegicus GN=LOC100365995 PE=3 SV=1
 2612 : D6WT54_TRICA        0.30  0.51   29  172   16  151  149    8   18  258  D6WT54     Putative uncharacterized protein OS=Tribolium castaneum GN=TcasGA2_TC030711 PE=3 SV=1
 2613 : D6WT55_TRICA        0.30  0.51   29  175  128  266  154    9   22  369  D6WT55     Putative uncharacterized protein OS=Tribolium castaneum GN=TcasGA2_TC030609 PE=3 SV=1
 2614 : DDN1_BOVIN  1EUF    0.30  0.49   29  172   20  149  146    6   18  251  P80219     Duodenase-1 OS=Bos taurus GN=BDMD1 PE=1 SV=2
 2615 : E0VCQ1_PEDHC        0.30  0.46  177  278   77  184  113    6   16  209  E0VCQ1     Tripsin 3A1, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM092750 PE=3 SV=1
 2616 : E1BCU4_BOVIN        0.30  0.52   29  175   37  171  148    7   14  280  E1BCU4     Uncharacterized protein OS=Bos taurus GN=PRSS33 PE=3 SV=2
 2617 : E1BLW6_BOVIN        0.30  0.56   29  175   35  167  149    9   18  321  E1BLW6     Uncharacterized protein OS=Bos taurus PE=3 SV=1
 2618 : E2AFY9_CAMFO        0.30  0.50   29  175   38  169  149    6   19  277  E2AFY9     Trypsin-7 (Fragment) OS=Camponotus floridanus GN=EAG_11671 PE=3 SV=1
 2619 : E2AQW2_CAMFO        0.30  0.50   29  175   12  154  151    9   12  264  E2AQW2     Transmembrane protease, serine 9 (Fragment) OS=Camponotus floridanus GN=EAG_10255 PE=3 SV=1
 2620 : E2AY09_CAMFO        0.30  0.52   29  173   27  162  155   11   29  272  E2AY09     Trypsin-1 OS=Camponotus floridanus GN=EAG_12717 PE=3 SV=1
 2621 : E2B505_HARSA        0.30  0.46   29  175   25  157  151    7   22  248  E2B505     Chymotrypsin-1 OS=Harpegnathos saltator GN=EAI_07716 PE=3 SV=1
 2622 : E2B7U5_HARSA        0.30  0.47   29  171   72  209  150   10   19  320  E2B7U5     Ovochymase-2 OS=Harpegnathos saltator GN=EAI_08764 PE=3 SV=1
 2623 : E2BB96_HARSA        0.30  0.46   29  172  115  253  153    8   23  258  E2BB96     Serine protease snake (Fragment) OS=Harpegnathos saltator GN=EAI_03975 PE=3 SV=1
 2624 : E2BR08_HARSA        0.30  0.47   29  173   61  200  154   10   23  315  E2BR08     Serine protease snake OS=Harpegnathos saltator GN=EAI_06854 PE=3 SV=1
 2625 : E2BU37_HARSA        0.30  0.43  178  274   72  169  106    7   17  173  E2BU37     Vitamin K-dependent protein C OS=Harpegnathos saltator GN=EAI_06981 PE=3 SV=1
 2626 : E2BVV8_HARSA        0.30  0.48  178  274   12  109  104    5   13  113  E2BVV8     Putative uncharacterized protein OS=Harpegnathos saltator GN=EAI_05816 PE=3 SV=1
 2627 : E2FGH6_CANFA        0.30  0.49   29  175   24  151  148    6   21  246  E2FGH6     Kallikrein-related peptidase 6 (Precursor) OS=Canis familiaris GN=KLK6 PE=2 SV=1
 2628 : E2R8K5_CANFA        0.30  0.50   29  175   50  186  151    9   18  307  E2R8K5     Uncharacterized protein OS=Canis familiaris GN=PRSS22 PE=3 SV=1
 2629 : E4XN62_OIKDI        0.30  0.50   29  175   77  221  158    9   24  405  E4XN62     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_67 OS=Oikopleura dioica GN=GSOID_T00015616001 PE=3 SV=1
 2630 : E5G5V2_9PERO        0.30  0.47   40  172    1  124  135    3   13  166  E5G5V2     Elastase (Fragment) OS=Atractoscion nobilis PE=2 SV=1
 2631 : E5S025_TRISP        0.30  0.50   29  174   39  190  161   11   24  309  E5S025     Peptidase, S1A subfamily OS=Trichinella spiralis GN=Tsp_08945 PE=3 SV=1
 2632 : E5SMR2_TRISP        0.30  0.44   29  175   34  163  151   11   25  281  E5SMR2     Transmembrane protease, serine 2 OS=Trichinella spiralis GN=Tsp_08622 PE=3 SV=1
 2633 : E5T2Y0_TRISP        0.30  0.48   29  174   52  203  161   10   24  264  E5T2Y0     Putative ovochymase-2 (Fragment) OS=Trichinella spiralis GN=Tsp_13595 PE=3 SV=1
 2634 : E6ZHB9_DICLA        0.30  0.43   29  174  217  359  161   13   33  458  E6ZHB9     Habp2-prov protein (Fragment) OS=Dicentrarchus labrax GN=HABP2-PROV PE=3 SV=1
 2635 : E7BZE7_PORTR        0.30  0.53  182  277   69  167  103    5   11  183  E7BZE7     Masquerade-like protein (Fragment) OS=Portunus trituberculatus PE=2 SV=1
 2636 : E7CCH2_9DIPT        0.30  0.47   29  175   24  152  148    8   20  258  E7CCH2     Digestive serine protease OS=Sitodiplosis mosellana GN=PROT-1 PE=2 SV=1
 2637 : E9GE76_DAPPU        0.30  0.50   29  175    2  142  153    8   18  244  E9GE76     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_33543 PE=3 SV=1
 2638 : E9GEG7_DAPPU        0.30  0.45   29  175   33  169  154    8   24  365  E9GEG7     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_302578 PE=4 SV=1
 2639 : E9GFK3_DAPPU        0.30  0.50   29  172   69  211  147    5    7  311  E9GFK3     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_196039 PE=3 SV=1
 2640 : E9GLN3_DAPPU        0.30  0.49   29  175  130  271  154    6   19  371  E9GLN3     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_104231 PE=3 SV=1
 2641 : E9GLZ6_DAPPU        0.30  0.46   29  175   69  200  151    8   23  302  E9GLZ6     Chymotrypsin-like protein OS=Daphnia pulex GN=CHY1G PE=3 SV=1
 2642 : E9GQ28_DAPPU        0.30  0.46  177  273   91  188  104    7   13  193  E9GQ28     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_320718 PE=3 SV=1
 2643 : E9H7E6_DAPPU        0.30  0.44   29  175    7  147  154    8   20  257  E9H7E6     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_216144 PE=3 SV=1
 2644 : E9PWX9_MOUSE        0.30  0.48   29  175  144  279  155    7   27  381  E9PWX9     Transmembrane protease serine 5 OS=Mus musculus GN=Tmprss5 PE=2 SV=1
 2645 : F1DQG5_ANOGA        0.30  0.52   29  175   37  166  148    7   19  268  F1DQG5     Epithelial serine protease OS=Anopheles gambiae GN=ESP PE=2 SV=1
 2646 : F1MEZ5_BOVIN        0.30  0.49   29  172   20  149  146    6   18  251  F1MEZ5     Uncharacterized protein OS=Bos taurus GN=GZMB PE=3 SV=1
 2647 : F1MGR5_BOVIN        0.30  0.46   29  175   37  171  151    8   20  280  F1MGR5     Uncharacterized protein OS=Bos taurus GN=KLK13 PE=3 SV=2
 2648 : F1MW89_BOVIN        0.30  0.50   29  175   11  148  151   10   17  281  F1MW89     Uncharacterized protein (Fragment) OS=Bos taurus GN=PRSS21 PE=3 SV=2
 2649 : F1QKL3_DANRE        0.30  0.45   29  175  312  457  161   11   29  554  F1QKL3     Uncharacterized protein (Fragment) OS=Danio rerio GN=si:ch211-51a6.2 PE=3 SV=1
 2650 : F1QM78_DANRE        0.30  0.53   29  171   56  188  148    9   20  285  F1QM78     Uncharacterized protein (Fragment) OS=Danio rerio GN=tmprss12 PE=3 SV=1
 2651 : F1QX88_DANRE        0.30  0.45   29  175  584  729  161   11   29  832  F1QX88     Uncharacterized protein OS=Danio rerio GN=si:ch211-51a6.2 PE=3 SV=1
 2652 : F2XFW0_DISMA        0.30  0.51   29  175   21  147  148    8   22  242  F2XFW0     Trypsinogen H2_1g OS=Dissostichus mawsoni PE=3 SV=1
 2653 : F2XFX3_DISMA        0.30  0.51   29  175   21  147  148    8   22  242  F2XFX3     H2_1b OS=Dissostichus mawsoni PE=3 SV=1
 2654 : F4W815_ACREC        0.30  0.51   29  175    7  149  151    9   12  259  F4W815     Serine proteinase stubble OS=Acromyrmex echinatior GN=G5I_01592 PE=3 SV=1
 2655 : F4WQ97_ACREC        0.30  0.49   29  171  474  622  161   11   30  730  F4WQ97     Limulus clotting factor C OS=Acromyrmex echinatior GN=G5I_07981 PE=3 SV=1
 2656 : F4WTJ3_ACREC        0.30  0.51   29  175   20  152  148    6   16  248  F4WTJ3     Trypsin-7 OS=Acromyrmex echinatior GN=G5I_09191 PE=3 SV=1
 2657 : F4X4I5_ACREC        0.30  0.46   29  171    3  136  144    4   11  248  F4X4I5     Serine proteinase stubble (Fragment) OS=Acromyrmex echinatior GN=G5I_13247 PE=3 SV=1
 2658 : F6Q1M5_ORNAN        0.30  0.49   29  172   13  145  146    7   15  256  F6Q1M5     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=3 SV=1
 2659 : F6R493_XENTR        0.30  0.51   29  174   36  168  148    7   17  269  F6R493     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 2660 : F6R7M2_XENTR        0.30  0.47   29  175   32  169  151    8   17  272  F6R7M2     Uncharacterized protein OS=Xenopus tropicalis GN=LOC100488535 PE=3 SV=1
 2661 : F6R7T7_XENTR        0.30  0.43   40  175    1  127  140    5   17  230  F6R7T7     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 2662 : F6RND3_CIOIN        0.30  0.51  177  274   23  129  110    6   15  133  F6RND3     Uncharacterized protein OS=Ciona intestinalis GN=Cin.12900 PE=3 SV=1
 2663 : F6S8N8_ORNAN        0.30  0.48   29  175  191  321  156    9   34  423  F6S8N8     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100080880 PE=3 SV=1
 2664 : F6SCM4_MONDO        0.30  0.48   29  175   10  149  152    9   17  284  F6SCM4     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=PRSS42 PE=3 SV=1
 2665 : F6SCN4_MONDO        0.30  0.48   29  175   12  143  150    8   21  271  F6SCN4     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=PRSS42 PE=3 SV=1
 2666 : F6SLQ6_ORNAN        0.30  0.50   29  151    9  117  123    3   14  150  F6SLQ6     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=KLK15 PE=3 SV=1
 2667 : F6UJU5_HORSE        0.30  0.48   29  175   32  169  153    8   21  272  F6UJU5     Uncharacterized protein (Fragment) OS=Equus caballus GN=CELA2A PE=3 SV=1
 2668 : F6UMK0_CIOIN        0.30  0.55   29  175   13  152  150    9   13  256  F6UMK0     Uncharacterized protein OS=Ciona intestinalis GN=LOC100176264 PE=3 SV=2
 2669 : F6V9H9_MACMU        0.30  0.51   29  170   21  143  145    9   25  255  F6V9H9     Uncharacterized protein OS=Macaca mulatta GN=KLK15 PE=3 SV=1
 2670 : F6V9M1_XENTR        0.30  0.49   29  172   25  151  144    5   17  251  F6V9M1     Uncharacterized protein OS=Xenopus tropicalis GN=LOC100490788 PE=3 SV=1
 2671 : F6VNT7_HORSE        0.30  0.49   29  171   26  148  144    8   22  246  F6VNT7     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100050047 PE=3 SV=1
 2672 : F6VXB0_MONDO        0.30  0.56   29  175   44  180  151    7   18  309  F6VXB0     Uncharacterized protein OS=Monodelphis domestica GN=PRSS38 PE=3 SV=2
 2673 : F6WA08_CALJA        0.30  0.51   29  175   37  171  148    7   14  280  F6WA08     Uncharacterized protein OS=Callithrix jacchus GN=PRSS33 PE=3 SV=1
 2674 : F6WB66_HORSE        0.30  0.50   29  170    2  127  143    8   18  230  F6WB66     Uncharacterized protein (Fragment) OS=Equus caballus PE=3 SV=1
 2675 : F6WRX7_XENTR        0.30  0.53   29  175   80  214  154    9   26  344  F6WRX7     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC100495077 PE=3 SV=1
 2676 : F6WYI3_XENTR        0.30  0.54   29  174   16  154  148    6   11  265  F6WYI3     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=3 SV=1
 2677 : F6X2B2_MACMU        0.30  0.49   29  171   24  146  144    7   22  247  F6X2B2     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
 2678 : F6XGF0_CALJA        0.30  0.49   29  172   30  163  151    7   24  268  F6XGF0     Uncharacterized protein OS=Callithrix jacchus GN=CTRC PE=3 SV=1
 2679 : F6XIP4_MACMU        0.30  0.49   29  175   22  149  148    6   21  244  F6XIP4     Kallikrein-6 isoform A preproprotein OS=Macaca mulatta GN=KLK6 PE=2 SV=1
 2680 : F6XMJ9_CANFA        0.30  0.47   29  172   30  163  149    7   20  268  F6XMJ9     Uncharacterized protein OS=Canis familiaris GN=CTRC PE=3 SV=1
 2681 : F6XSU3_ORNAN        0.30  0.47   29  172   26  151  146    7   22  250  F6XSU3     Uncharacterized protein OS=Ornithorhynchus anatinus PE=3 SV=1
 2682 : F6Y4N7_CALJA        0.30  0.50   29  172   30  167  151    7   20  322  F6Y4N7     Uncharacterized protein OS=Callithrix jacchus GN=CTRC PE=3 SV=1
 2683 : F6YB65_CALJA        0.30  0.52   29  174    4  148  151    7   11  246  F6YB65     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=ACR PE=3 SV=1
 2684 : F6ZPN5_CALJA        0.30  0.46   29  175   29  166  153    8   21  269  F6ZPN5     Uncharacterized protein OS=Callithrix jacchus GN=CELA2A PE=3 SV=1
 2685 : F7AFK1_HORSE        0.30  0.51   29  175    2  131  148    7   19  228  F7AFK1     Uncharacterized protein (Fragment) OS=Equus caballus GN=KLK12 PE=3 SV=1
 2686 : F7B276_MOUSE        0.30  0.45   29  170   77  216  153    7   24  220  F7B276     Hyaluronan-binding protein 2 (Fragment) OS=Mus musculus GN=Habp2 PE=2 SV=1
 2687 : F7D3D3_MONDO        0.30  0.44   29  175   39  176  158   10   31  327  F7D3D3     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618901 PE=3 SV=2
 2688 : F7DST6_HORSE        0.30  0.49   29  171   24  146  144    8   22  246  F7DST6     Uncharacterized protein OS=Equus caballus GN=LOC100049983 PE=3 SV=1
 2689 : F7FNZ7_CALJA        0.30  0.49   29  171    1  135  147    6   16  247  F7FNZ7     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=LOC100410371 PE=3 SV=1
 2690 : F7G640_ORNAN        0.30  0.46   29  175   11  137  149    8   24  241  F7G640     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100088455 PE=3 SV=1
 2691 : F7GMS6_CALJA        0.30  0.49   29  172   49  184  148    8   16  296  F7GMS6     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=3 SV=1
 2692 : F7H824_CALJA        0.30  0.48   29  170   22  146  145    7   23  254  F7H824     Uncharacterized protein OS=Callithrix jacchus GN=KLK11 PE=3 SV=1
 2693 : F7HD86_CALJA        0.30  0.48   29  170   22  146  145    7   23  248  F7HD86     Uncharacterized protein OS=Callithrix jacchus GN=KLK11 PE=3 SV=1
 2694 : F7HPK3_MACMU        0.30  0.51   29  172   19  146  148    9   24  288  F7HPK3     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=LOC713258 PE=3 SV=1
 2695 : F7IUA2_ANOGA        0.30  0.49   29  175   22  155  148    5   15  259  F7IUA2     AGAP004570-PA OS=Anopheles gambiae GN=AgaP_AGAP004570 PE=3 SV=1
 2696 : F8S119_CROAD        0.30  0.55  179  277  111  204  104    7   15  213  F8S119     Serine proteinase 7 (Fragment) OS=Crotalus adamanteus PE=2 SV=1
 2697 : F8W5P2_DANRE        0.30  0.52   29  170   39  180  147    8   10  308  F8W5P2     Uncharacterized protein OS=Danio rerio GN=hp PE=3 SV=1
 2698 : FA9_RABIT           0.30  0.55   29  172   49  181  148    8   19  275  P16292     Coagulation factor IX (Fragment) OS=Oryctolagus cuniculus GN=F9 PE=2 SV=1
 2699 : G1FE64_9TELE        0.30  0.51   29  175   11  137  148    7   22  231  G1FE64     Trypsinogen I (Fragment) OS=Sardinops caeruleus GN=try1 PE=2 SV=1
 2700 : G1L9Y4_AILME        0.30  0.46   29  175   13  143  148    6   18  240  G1L9Y4     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=LOC100484715 PE=3 SV=1
 2701 : G1M7A3_AILME        0.30  0.50   29  171   24  147  145    9   23  248  G1M7A3     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=KLK15 PE=3 SV=1
 2702 : G1PBU5_MYOLU        0.30  0.47   29  175    5  145  153    6   18  247  G1PBU5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 2703 : G1PD12_MYOLU        0.30  0.49   29  170   28  153  144    7   20  263  G1PD12     Uncharacterized protein OS=Myotis lucifugus GN=GZMM PE=3 SV=1
 2704 : G1PFG9_MYOLU        0.30  0.45   29  175   43  189  157   10   20  389  G1PFG9     Acrosin OS=Myotis lucifugus GN=ACR PE=3 SV=1
 2705 : G1PIF1_MYOLU        0.30  0.46   29  170    2  134  151    9   27  273  G1PIF1     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=TMPRSS2 PE=3 SV=1
 2706 : G1Q8F0_MYOLU        0.30  0.46   29  175   38  178  153    6   18  278  G1Q8F0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 2707 : G1QEW8_MYOLU        0.30  0.47   30  170   32  167  148    8   19  269  G1QEW8     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
 2708 : G1R7S5_NOMLE        0.30  0.47   29  172   30  163  148    7   18  268  G1R7S5     Uncharacterized protein OS=Nomascus leucogenys GN=CTRC PE=3 SV=1
 2709 : G1T384_RABIT        0.30  0.53   29  175   12  143  150    9   21  290  G1T384     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=PRSS55 PE=3 SV=1
 2710 : G1T8X5_RABIT        0.30  0.49   29  175   28  165  152    8   19  267  G1T8X5     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100338830 PE=3 SV=1
 2711 : G3HL18_CRIGR        0.30  0.50   29  171   30  152  144    7   22  252  G3HL18     Anionic trypsin-2 OS=Cricetulus griseus GN=I79_011403 PE=3 SV=1
 2712 : G3NQX2_GASAC        0.30  0.48   29  173  164  302  158   10   32  419  G3NQX2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=TMPRSS11E PE=3 SV=1
 2713 : G3P0N2_GASAC        0.30  0.48   29  172   32  167  147    9   14  305  G3P0N2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2714 : G3P0N7_GASAC        0.30  0.48   29  172   33  168  147    9   14  274  G3P0N7     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2715 : G3P0P1_GASAC        0.30  0.49   29  171   19  153  146    9   14  263  G3P0P1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2716 : G3PQK7_GASAC        0.30  0.51   29  172   33  162  148    8   22  266  G3PQK7     Uncharacterized protein OS=Gasterosteus aculeatus GN=PRSS56 PE=3 SV=1
 2717 : G3Q0H7_GASAC        0.30  0.49   29  170   35  162  149    6   28  265  G3Q0H7     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 2718 : G3R1H5_GORGO        0.30  0.46   29  175   36  168  151    8   22  277  G3R1H5     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101150353 PE=3 SV=1
 2719 : G3R6P6_GORGO        0.30  0.50   29  175   24  151  148    6   21  246  G3R6P6     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101146873 PE=3 SV=1
 2720 : G3RUK8_GORGO        0.30  0.51   29  174   43  187  156    9   21  339  G3RUK8     Acrosin OS=Gorilla gorilla gorilla GN=101144239 PE=3 SV=1
 2721 : G3RXP7_GORGO        0.30  0.48   29  174   43  187  158   11   25  421  G3RXP7     Acrosin OS=Gorilla gorilla gorilla GN=101144239 PE=3 SV=1
 2722 : G3SPJ7_LOXAF        0.30  0.48   29  175  278  422  161   14   30  524  G3SPJ7     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=HABP2 PE=3 SV=1
 2723 : G3SSQ4_LOXAF        0.30  0.50   29  172   28  164  151    6   21  269  G3SSQ4     Uncharacterized protein OS=Loxodonta africana GN=LOC100668364 PE=3 SV=1
 2724 : G3SV15_LOXAF        0.30  0.52   29  175   66  203  151   10   17  316  G3SV15     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=PRSS21 PE=3 SV=1
 2725 : G3TMY8_LOXAF        0.30  0.48   29  171   24  147  143    5   19  247  G3TMY8     Uncharacterized protein OS=Loxodonta africana GN=LOC100661382 PE=3 SV=1
 2726 : G3U7B4_LOXAF        0.30  0.50   29  172   30  163  151    7   24  268  G3U7B4     Uncharacterized protein OS=Loxodonta africana GN=CTRC PE=3 SV=1
 2727 : G3U8B1_LOXAF        0.30  0.51   29  172   30  157  147    8   22  300  G3U8B1     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=PRSS46 PE=3 SV=1
 2728 : G3V7Q8_RAT          0.30  0.48   29  171   25  147  143    7   20  247  G3V7Q8     Cationic trypsinogen OS=Rattus norvegicus GN=Prss3 PE=3 SV=1
 2729 : G3V8E5_RAT          0.30  0.53   29  175   66  201  148    6   13  310  G3V8E5     Tryptase OS=Rattus norvegicus GN=Tpsab1 PE=3 SV=1
 2730 : G3VRI5_SARHA        0.30  0.52   29  175   16  151  148    5   13  286  G3VRI5     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=PRSS22 PE=3 SV=1
 2731 : G3VYA6_SARHA        0.30  0.48   29  174   35  165  152   10   27  305  G3VYA6     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=PRSS42 PE=3 SV=1
 2732 : G5B1K3_HETGA        0.30  0.55   29  175   22  156  148    7   14  265  G5B1K3     Serine protease 33 OS=Heterocephalus glaber GN=GW7_03664 PE=3 SV=1
 2733 : G6D300_DANPL        0.30  0.46   29  175   67  199  151    8   22  308  G6D300     Uncharacterized protein OS=Danaus plexippus GN=KGM_10936 PE=3 SV=1
 2734 : G6DJF5_DANPL        0.30  0.50   29  170   57  195  151    9   21  321  G6DJF5     Coagulation factor-like protein 3 OS=Danaus plexippus GN=KGM_06441 PE=3 SV=1
 2735 : G7NMC8_MACMU        0.30  0.51   29  170   22  144  145    9   25  256  G7NMC8     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_10941 PE=3 SV=1
 2736 : G7NXX2_MACFA        0.30  0.51   29  172   19  146  148    9   24  288  G7NXX2     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_10702 PE=3 SV=1
 2737 : G7PYF6_MACFA        0.30  0.51   29  170   22  144  145    9   25  256  G7PYF6     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_10021 PE=3 SV=1
 2738 : G7PYG1_MACFA        0.30  0.49   29  175   22  149  148    6   21  244  G7PYG1     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_10028 PE=3 SV=1
 2739 : G7PYG8_MACFA        0.30  0.46   29  175   36  168  152    8   24  277  G7PYG8     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_10035 PE=3 SV=1
 2740 : G7Z062_ORENI        0.30  0.47   29  175   27  155  148    6   20  255  G7Z062     Granzyme OS=Oreochromis niloticus PE=2 SV=1
 2741 : G9D485_9NEOP        0.30  0.55   29  175   79  209  149    7   20  299  G9D485     Seminal fluid protein HACP002 (Fragment) OS=Heliconius doris PE=2 SV=1
 2742 : G9D488_9NEOP        0.30  0.55   29  175   79  209  149    7   20  299  G9D488     Seminal fluid protein HACP002 (Fragment) OS=Heliconius hortense PE=2 SV=1
 2743 : G9D489_9NEOP        0.30  0.55   29  175   79  209  149    7   20  299  G9D489     Seminal fluid protein HACP002 (Fragment) OS=Heliconius hewitsoni PE=2 SV=1
 2744 : G9D490_HELSA        0.30  0.55   29  175   79  209  149    7   20  299  G9D490     Seminal fluid protein HACP002 (Fragment) OS=Heliconius sara PE=2 SV=1
 2745 : G9D491_9NEOP        0.30  0.54   29  175   79  209  149    7   20  299  G9D491     Seminal fluid protein HACP002 (Fragment) OS=Heliconius demeter PE=2 SV=1
 2746 : G9JKF3_EPICO        0.30  0.51   29  175   23  149  148    8   22  244  G9JKF3     Trypsinogens 2 OS=Epinephelus coioides PE=2 SV=1
 2747 : GRAB_RAT    1FI8    0.30  0.44   29  172   21  151  147    7   19  248  P18291     Granzyme B OS=Rattus norvegicus GN=Gzmb PE=1 SV=1
 2748 : H0VJF0_CAVPO        0.30  0.46   29  175   37  169  151    8   22  278  H0VJF0     Uncharacterized protein OS=Cavia porcellus GN=KLK13 PE=3 SV=1
 2749 : H0VMN6_CAVPO        0.30  0.53   29  175    2  140  151    9   16  283  H0VMN6     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=PRSS55 PE=3 SV=1
 2750 : H0WWZ5_OTOGA        0.30  0.51   29  175   55  189  150   11   18  293  H0WWZ5     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=PRSS33 PE=3 SV=1
 2751 : H0XNF9_OTOGA        0.30  0.53   29  174   56  192  149    9   15  324  H0XNF9     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
 2752 : H0XP91_OTOGA        0.30  0.51   34  153    2  113  120    2    8  131  H0XP91     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=3 SV=1
 2753 : H0XS24_OTOGA        0.30  0.54   29  175   14  150  150    9   16  301  H0XS24     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=3 SV=1
 2754 : H0XXF7_OTOGA        0.30  0.49   29  170   14  142  144    9   17  284  H0XXF7     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=PRSS48 PE=3 SV=1
 2755 : H0XYT5_OTOGA        0.30  0.51   29  175   65  202  151   10   17  331  H0XYT5     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=3 SV=1
 2756 : H0YBF5_HUMAN        0.30  0.49   29  156   49  166  128    3   10  182  H0YBF5     Serine protease 55 (Fragment) OS=Homo sapiens GN=PRSS55 PE=3 SV=1
 2757 : H0Z468_TAEGU        0.30  0.49   29  175   21  156  148    6   13  234  H0Z468     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=OVCH2 PE=3 SV=1
 2758 : H0ZSH5_TAEGU        0.30  0.48   29  172    6  129  146    7   24  228  H0ZSH5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
 2759 : H1A027_TAEGU        0.30  0.49   29  175   21  156  148    6   13  206  H1A027     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
 2760 : H2LIE2_ORYLA        0.30  0.44   29  172   28  162  148    5   17  268  H2LIE2     Uncharacterized protein OS=Oryzias latipes GN=LOC101168781 PE=3 SV=1
 2761 : H2LIE4_ORYLA        0.30  0.44   29  172   31  163  148    5   19  269  H2LIE4     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101168781 PE=3 SV=1
 2762 : H2LK99_ORYLA        0.30  0.54   29  170    2  132  144    7   15  269  H2LK99     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101167385 PE=3 SV=1
 2763 : H2MEM6_ORYLA        0.30  0.48   29  175   24  150  149    7   24  245  H2MEM6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101161921 PE=3 SV=1
 2764 : H2MEQ3_ORYLA        0.30  0.48   29  175   30  156  149    7   24  251  H2MEQ3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101161921 PE=3 SV=1
 2765 : H2N8Z7_PONAB        0.30  0.47   29  172   30  163  148    7   18  268  H2N8Z7     Uncharacterized protein OS=Pongo abelii GN=CTRC PE=3 SV=1
 2766 : H2NPV8_PONAB        0.30  0.51   29  175   35  168  148    7   15  277  H2NPV8     Uncharacterized protein OS=Pongo abelii GN=PRSS33 PE=3 SV=1
 2767 : H2NS25_PONAB        0.30  0.49   29  175   38  173  150    8   17  282  H2NS25     Uncharacterized protein OS=Pongo abelii GN=TPSD1 PE=3 SV=2
 2768 : H2NZV1_PONAB        0.30  0.46   29  175   36  168  151    8   22  277  H2NZV1     Uncharacterized protein OS=Pongo abelii GN=KLK13 PE=3 SV=1
 2769 : H2P4X8_PONAB        0.30  0.52   29  174   43  187  156    9   21  349  H2P4X8     Acrosin OS=Pongo abelii GN=ACR PE=3 SV=1
 2770 : H2PNU2_PONAB        0.30  0.49   29  175   24  150  148    7   22  247  H2PNU2     Uncharacterized protein OS=Pongo abelii GN=PRSS1 PE=3 SV=1
 2771 : H2QGZ4_PANTR        0.30  0.46   29  175   35  167  151    8   22  276  H2QGZ4     Uncharacterized protein OS=Pan troglodytes GN=KLK13 PE=3 SV=1
 2772 : H2S2H4_TAKRU        0.30  0.51   29  170   41  185  152    7   17  327  H2S2H4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=MASP1 PE=3 SV=1
 2773 : H2S4S3_TAKRU        0.30  0.50   29  170   35  161  147    8   25  264  H2S4S3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101074582 PE=3 SV=1
 2774 : H2TSM8_TAKRU        0.30  0.56   29  175   30  165  152    8   21  303  H2TSM8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071414 PE=3 SV=1
 2775 : H2Y806_CIOSA        0.30  0.47   29  174   16  148  147    5   15  251  H2Y806     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 2776 : H2YDU6_CIOSA        0.30  0.47   29  173  127  276  158    9   21  395  H2YDU6     Uncharacterized protein OS=Ciona savignyi PE=3 SV=1
 2777 : H2YK43_CIOSA        0.30  0.59  181  278   89  181  102    8   13  186  H2YK43     Uncharacterized protein OS=Ciona savignyi PE=3 SV=1
 2778 : H2YS64_CIOSA        0.30  0.47   29  171   30  156  144    6   18  198  H2YS64     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 2779 : H2YXI7_CIOSA        0.30  0.51   29  170   16  156  152   10   21  287  H2YXI7     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
 2780 : H2ZYY8_LATCH        0.30  0.50   29  175    9  144  151    9   19  274  H2ZYY8     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 2781 : H3BFT8_LATCH        0.30  0.46   29  175   29  169  151    7   14  272  H3BFT8     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 2782 : H3BG42_LATCH        0.30  0.46   29  170   30  157  148    9   26  256  H3BG42     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 2783 : H3CB18_TETNG        0.30  0.53   29  175   20  152  148    6   16  262  H3CB18     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=TMPRSS9 (3 of 6) PE=3 SV=1
 2784 : H9GJ56_ANOCA        0.30  0.50   29  172   29  165  149    6   17  271  H9GJ56     Uncharacterized protein OS=Anolis carolinensis GN=LOC100556283 PE=3 SV=2
 2785 : H9JJJ3_BOMMO        0.30  0.52   29  175   15  149  150    9   18  260  H9JJJ3     Uncharacterized protein OS=Bombyx mori PE=3 SV=1
 2786 : H9K0F6_APIME        0.30  0.47   29  172   63  193  148    8   21  304  H9K0F6     Uncharacterized protein OS=Apis mellifera GN=LOC100576352 PE=3 SV=1
 2787 : H9K5A1_APIME        0.30  0.53   29  175   92  225  152    9   23  329  H9K5A1     Uncharacterized protein OS=Apis mellifera GN=SP5 PE=3 SV=1
 2788 : H9KS56_APIME        0.30  0.48   29  171   15  140  144    6   19  237  H9KS56     Uncharacterized protein OS=Apis mellifera GN=LOC550827 PE=3 SV=1
 2789 : H9KYN7_CHICK        0.30  0.52   29  175   35  166  149    8   19  264  H9KYN7     Uncharacterized protein (Fragment) OS=Gallus gallus GN=LOC431235 PE=3 SV=2
 2790 : H9KZD3_CHICK        0.30  0.53   29  174   23  163  152    9   17  291  H9KZD3     Uncharacterized protein OS=Gallus gallus GN=TMPRSS12 PE=3 SV=2
 2791 : I2CYD9_MACMU        0.30  0.49   29  175   22  149  148    6   21  244  I2CYD9     Kallikrein-6 isoform A preproprotein OS=Macaca mulatta GN=KLK6 PE=2 SV=1
 2792 : I3J1C8_ORENI        0.30  0.45   29  172   28  160  148    7   19  266  I3J1C8     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100696175 PE=3 SV=1
 2793 : I3J946_ORENI        0.30  0.46   29  170   26  152  143    6   17  256  I3J946     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CMA1 (9 of 26) PE=3 SV=1
 2794 : I3JIM8_ORENI        0.30  0.52   29  171   13  140  144    7   17  253  I3JIM8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=3 SV=1
 2795 : I3JIS0_ORENI        0.30  0.51   29  174   38  170  152    8   25  310  I3JIS0     Uncharacterized protein OS=Oreochromis niloticus GN=TMPRSS9 (3 of 18) PE=3 SV=1
 2796 : I3JZS8_ORENI        0.30  0.50   29  171   22  146  145    7   22  246  I3JZS8     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100699793 PE=3 SV=1
 2797 : I3JZT2_ORENI        0.30  0.51   29  175   21  147  149    8   24  229  I3JZT2     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100700058 PE=3 SV=1
 2798 : I3K602_ORENI        0.30  0.43   29  175  581  726  161   10   29  830  I3K602     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100694100 PE=3 SV=1
 2799 : I3K9V0_ORENI        0.30  0.48   29  175   23  154  147    5   15  251  I3K9V0     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=GZMA (11 of 24) PE=3 SV=1
 2800 : I3MAQ1_SPETR        0.30  0.49   29  171   24  146  144    7   22  246  I3MAQ1     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
 2801 : I4DJI7_PAPXU        0.30  0.50  177  276   85  186  106    5   10  201  I4DJI7     Serine protease OS=Papilio xuthus PE=2 SV=1
 2802 : J7H295_9PERO        0.30  0.52   43  171    1  109  130    7   22  178  J7H295     Trypsin (Fragment) OS=Centropomus undecimalis PE=2 SV=1
 2803 : J9JWP0_ACYPI        0.30  0.46   29  175  165  305  159   10   30  415  J9JWP0     Uncharacterized protein (Fragment) OS=Acyrthosiphon pisum GN=LOC100166864 PE=3 SV=2
 2804 : J9M1T7_ACYPI        0.30  0.50   29  175   35  176  155    9   21  285  J9M1T7     Uncharacterized protein OS=Acyrthosiphon pisum GN=LOC100167460 PE=3 SV=2
 2805 : K7F234_PELSI        0.30  0.47   29  175   21  148  148    8   21  245  K7F234     Uncharacterized protein OS=Pelodiscus sinensis PE=3 SV=1
 2806 : K7GDI1_PELSI        0.30  0.46   29  170   21  148  144    6   18  244  K7GDI1     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=3 SV=1
 2807 : K7J1M8_NASVI        0.30  0.46   29  173  107  249  157   11   26  351  K7J1M8     Uncharacterized protein OS=Nasonia vitripennis GN=SP45 PE=3 SV=1
 2808 : K7J4K9_NASVI        0.30  0.45   29  175   12  141  148    5   19  236  K7J4K9     Uncharacterized protein OS=Nasonia vitripennis GN=SP63 PE=3 SV=1
 2809 : K7JNQ1_NASVI        0.30  0.51   29  175   19  150  148    6   17  253  K7JNQ1     Uncharacterized protein OS=Nasonia vitripennis GN=LOC100678766 PE=3 SV=1
 2810 : K7Z7R9_BDEBC        0.30  0.45   29  170   22  157  150   10   22  271  K7Z7R9     Trypsin OS=Bdellovibrio bacteriovorus str. Tiberius GN=Bdt_0672 PE=3 SV=1
 2811 : KLK13_HUMAN         0.30  0.46   29  175   36  168  151    8   22  277  Q9UKR3     Kallikrein-13 OS=Homo sapiens GN=KLK13 PE=1 SV=1
 2812 : KLK6_HUMAN  4D8N    0.30  0.50   29  175   22  149  148    6   21  244  Q92876     Kallikrein-6 OS=Homo sapiens GN=KLK6 PE=1 SV=1
 2813 : KLK8_MOUSE  1NPM    0.30  0.49   29  175   33  163  150    7   22  260  Q61955     Kallikrein-8 OS=Mus musculus GN=Klk8 PE=1 SV=1
 2814 : L5KJP6_PTEAL        0.30  0.52   29  175   26  160  149    7   16  259  L5KJP6     Serine protease 33 OS=Pteropus alecto GN=PAL_GLEAN10011663 PE=3 SV=1
 2815 : L5LRH9_MYODS        0.30  0.54   29  171   41  183  153    8   20  291  L5LRH9     Mannan-binding lectin serine protease 1 OS=Myotis davidii GN=MDA_GLEAN10014143 PE=3 SV=1
 2816 : L7N1R7_MYOLU        0.30  0.47   31  170    1  135  146    6   17  222  L7N1R7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
 2817 : L7N362_XENTR        0.30  0.54   29  174   16  154  148    6   11  265  L7N362     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC100497408 PE=3 SV=1
 2818 : L8IE38_9CETA        0.30  0.50   29  175   40  169  150    9   23  267  L8IE38     Kallikrein-14 (Fragment) OS=Bos mutus GN=M91_05453 PE=3 SV=1
 2819 : L8IE46_9CETA        0.30  0.48   32  170   13  132  141    7   23  244  L8IE46     Kallikrein-15 (Fragment) OS=Bos mutus GN=M91_05464 PE=3 SV=1
 2820 : L8IG06_9CETA        0.30  0.46   29  175   36  168  151    8   22  277  L8IG06     Kallikrein-13 (Fragment) OS=Bos mutus GN=M91_05454 PE=3 SV=1
 2821 : L8ILJ9_9CETA        0.30  0.50   29  170    6  131  143    8   18  227  L8ILJ9     Uncharacterized protein (Fragment) OS=Bos mutus GN=M91_00451 PE=3 SV=1
 2822 : L8ISS6_9CETA        0.30  0.45   29  170   13  139  145    8   21  249  L8ISS6     Granzyme M (Fragment) OS=Bos mutus GN=M91_01905 PE=3 SV=1
 2823 : L9JF88_TUPCH        0.30  0.45   29  175   42  187  160   13   27  399  L9JF88     Acrosin OS=Tupaia chinensis GN=TREES_T100000884 PE=3 SV=1
 2824 : L9JJE7_TUPCH        0.30  0.51   29  175   25  145  148    8   28  306  L9JJE7     Serine protease 48 OS=Tupaia chinensis GN=TREES_T100010949 PE=3 SV=1
 2825 : L9JQ44_TUPCH        0.30  0.47   29  175  640  790  161   12   24  888  L9JQ44     Transmembrane protease serine 6 OS=Tupaia chinensis GN=TREES_T100003241 PE=3 SV=1
 2826 : L9L0P2_TUPCH        0.30  0.47   29  172   30  163  151    7   24  268  L9L0P2     Chymotrypsin-C OS=Tupaia chinensis GN=TREES_T100008745 PE=3 SV=1
 2827 : M0QZI8_HUMAN        0.30  0.45   29  151   22  134  126    4   16  170  M0QZI8     Kallikrein-11 (Fragment) OS=Homo sapiens GN=KLK11 PE=2 SV=1
 2828 : M0RD41_RAT          0.30  0.45   29  172   21  151  148    8   21  247  M0RD41     Protein Mcpt1l1 OS=Rattus norvegicus GN=Mcpt1l1 PE=3 SV=1
 2829 : M3VY57_FELCA        0.30  0.56  180  277  142  249  113    7   20  256  M3VY57     Uncharacterized protein (Fragment) OS=Felis catus GN=OVCH2 PE=3 SV=1
 2830 : M3W994_FELCA        0.30  0.49   29  175   28  155  148    6   21  250  M3W994     Uncharacterized protein (Fragment) OS=Felis catus GN=KLK6 PE=3 SV=1
 2831 : M3WFU5_FELCA        0.30  0.47   29  175  285  429  162   15   32  531  M3WFU5     Uncharacterized protein (Fragment) OS=Felis catus GN=HABP2 PE=3 SV=1
 2832 : M3WT01_FELCA        0.30  0.49   29  175   33  162  149    6   21  259  M3WT01     Uncharacterized protein OS=Felis catus GN=KLK8 PE=3 SV=1
 2833 : M3XIN5_LATCH        0.30  0.50   29  170   40  174  148    8   19  304  M3XIN5     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
 2834 : M3XR46_MUSPF        0.30  0.50   29  175   24  151  148    8   21  246  M3XR46     Uncharacterized protein OS=Mustela putorius furo GN=KLK6 PE=3 SV=1
 2835 : M3YY32_MUSPF        0.30  0.48   29  172   30  163  149    7   20  268  M3YY32     Uncharacterized protein OS=Mustela putorius furo GN=CTRC PE=3 SV=1
 2836 : M3ZEX2_XIPMA        0.30  0.51   29  170   21  169  154    7   17  277  M3ZEX2     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=MASP1 PE=3 SV=1
 2837 : M4A844_XIPMA        0.30  0.46   29  172   23  146  146    7   24  245  M4A844     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 2838 : M4AHD4_XIPMA        0.30  0.48   29  172   20  154  149    7   19  259  M4AHD4     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 2839 : M4VEY6_9DELT        0.30  0.44   29  175   50  180  149    7   20  281  M4VEY6     Uncharacterized protein OS=Bdellovibrio exovorus JSS GN=A11Q_2385 PE=3 SV=1
 2840 : M5FHZ7_BOVIN        0.30  0.52   29  175   26  160  148    7   14  273  M5FHZ7     Protease, serine, 33-like OS=Bos taurus GN=PRSS33 PE=3 SV=1
 2841 : M7CIF3_CHEMY        0.30  0.52   29  150   12  130  126    2   11  165  M7CIF3     Serine protease 27 OS=Chelonia mydas GN=UY3_02013 PE=3 SV=1
 2842 : M7CKE4_CHEMY        0.30  0.51  182  272   52  146  100    4   14  187  M7CKE4     Prostasin OS=Chelonia mydas GN=UY3_01204 PE=3 SV=1
 2843 : N6TM40_DENPD        0.30  0.43   29  170   38  163  146   10   24  269  N6TM40     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=YQE_12831 PE=3 SV=1
 2844 : O18487_LITVA        0.30  0.47   29  175   46  175  151    8   25  271  O18487     Chymotrypsin BI (Fragment) OS=Litopenaeus vannamei GN=chymotrypsin A PE=3 SV=1
 2845 : O18488_LITVA        0.30  0.46   29  175   40  169  151    8   25  265  O18488     Chymotrypsin BII (Precursor) OS=Litopenaeus vannamei GN=chymotrypsin B PE=3 SV=1
 2846 : O42159_PETMA        0.30  0.49   29  175   21  149  148    7   20  244  O42159     Trypsinogen B1 (Precursor) OS=Petromyzon marinus GN=TRYPB1 PE=2 SV=1
 2847 : O42160_PETMA        0.30  0.49   29  175   22  150  148    7   20  245  O42160     Trypsinogen b2 (Precursor) OS=Petromyzon marinus GN=TRYPB2 PE=2 SV=1
 2848 : O45029_DROME        0.30  0.52   29  175  114  252  154    9   22  358  O45029     Serine protease (Fragment) OS=Drosophila melanogaster GN=Tequila PE=2 SV=1
 2849 : O46507_PAPHA        0.30  0.45   29  175  105  234  151    9   25  334  O46507     Plasminogen (Fragment) OS=Papio hamadryas GN=BABPEPSG PE=2 SV=1
 2850 : Q16GK2_AEDAE        0.30  0.50   29  171   34  184  151    4    8  191  Q16GK2     AAEL014353-PA OS=Aedes aegypti GN=AAEL014353 PE=3 SV=1
 2851 : Q16ID5_AEDAE        0.30  0.50   29  158   40  157  131    5   14  190  Q16ID5     AAEL013714-PA OS=Aedes aegypti GN=AAEL013714 PE=3 SV=1
 2852 : Q16JN3_AEDAE        0.30  0.47   29  170   26  155  146    7   20  257  Q16JN3     AAEL013284-PA OS=Aedes aegypti GN=AAEL013284 PE=3 SV=1
 2853 : Q16UP3_AEDAE        0.30  0.53   29  175   26  165  153    9   19  273  Q16UP3     AAEL009843-PA OS=Aedes aegypti GN=AAEL009843 PE=3 SV=1
 2854 : Q16ZH0_AEDAE        0.30  0.52   29  175   25  161  151    8   18  266  Q16ZH0     AAEL008215-PA OS=Aedes aegypti GN=AAEL008215 PE=3 SV=1
 2855 : Q16ZZ9_AEDAE        0.30  0.50   29  173   70  203  152   10   25  316  Q16ZZ9     AAEL007969-PA OS=Aedes aegypti GN=AAEL007969 PE=3 SV=1
 2856 : Q170E3_AEDAE        0.30  0.49   29  175   32  161  149    8   21  256  Q170E3     AAEL007938-PA OS=Aedes aegypti GN=AAEL007938 PE=3 SV=1
 2857 : Q171W2_AEDAE        0.30  0.50   29  174   40  170  149    8   21  287  Q171W2     AAEL007508-PA OS=Aedes aegypti GN=AAEL007508 PE=3 SV=1
 2858 : Q175S1_AEDAE        0.30  0.46   29  175   60  213  157    9   13  314  Q175S1     AAEL006586-PA (Fragment) OS=Aedes aegypti GN=AAEL006586 PE=3 SV=1
 2859 : Q176U9_AEDAE        0.30  0.48   29  175  111  251  155   10   22  355  Q176U9     AAEL006260-PA OS=Aedes aegypti GN=AAEL006260 PE=3 SV=1
 2860 : Q179I8_AEDAE        0.30  0.49   29  170   50  175  144    8   20  275  Q179I8     AAEL005594-PA OS=Aedes aegypti GN=AAEL005594 PE=3 SV=1
 2861 : Q17CJ3_AEDAE        0.30  0.48  177  278  111  209  107    5   13  209  Q17CJ3     AAEL004543-PA OS=Aedes aegypti GN=AAEL004543 PE=3 SV=1
 2862 : Q17EX9_AEDAE        0.30  0.50   29  173  126  284  161    9   18  403  Q17EX9     AAEL003631-PA OS=Aedes aegypti GN=CLIPB41 PE=3 SV=1
 2863 : Q17J63_AEDAE        0.30  0.49   29  173   98  240  158   11   28  351  Q17J63     AAEL002128-PA OS=Aedes aegypti GN=AAEL002128 PE=3 SV=1
 2864 : Q27440_AEDAE        0.30  0.47   29  170   26  155  146    7   20  257  Q27440     Trypsin (Precursor) OS=Aedes aegypti PE=2 SV=1
 2865 : Q2LZC3_DROPS        0.30  0.46   29  175   40  174  149    7   16  272  Q2LZC3     GA19610 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA19610 PE=3 SV=1
 2866 : Q2LZD5_DROPS        0.30  0.49   29  170   26  159  148    7   20  270  Q2LZD5     GA10333 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA10333 PE=3 SV=2
 2867 : Q3I1U9_NOMGA        0.30  0.50  178  277   93  189  102    4    7  189  Q3I1U9     Transmembrane protease serine 2 (Fragment) OS=Nomascus gabriellae GN=TMPRSS2 PE=3 SV=1
 2868 : Q3V2E0_MOUSE        0.30  0.49   29  171   24  146  144    8   22  255  Q3V2E0     Putative uncharacterized protein OS=Mus musculus GN=Try5 PE=2 SV=1
 2869 : Q3V2G3_MOUSE        0.30  0.50   29  171   24  146  143    6   20  246  Q3V2G3     Putative uncharacterized protein OS=Mus musculus GN=Prss3 PE=2 SV=1
 2870 : Q4G0C2_MOUSE        0.30  0.50   29  171   23  145  143    6   20  245  Q4G0C2     Prss3 protein (Fragment) OS=Mus musculus GN=Prss3 PE=2 SV=1
 2871 : Q4L1L4_9NEOP        0.30  0.47  177  272  121  215  104    5   17  220  Q4L1L4     Trypsin Ib2 (Fragment) OS=Sesamia nonagrioides GN=TrIb2 PE=2 SV=1
 2872 : Q4QY73_SPAAU        0.30  0.51   29  175   21  147  148    8   22  241  Q4QY73     Trypsinogen-like protein OS=Sparus aurata PE=2 SV=1
 2873 : Q4QY74_SPAAU        0.30  0.51   40  170    4  120  132    6   16  223  Q4QY74     Chymotrypsin B-like protein (Fragment) OS=Sparus aurata PE=2 SV=1
 2874 : Q4QY78_SPAAU        0.30  0.48   29  170   35  161  147    8   25  264  Q4QY78     Chymotrypsinogen 2-like protein (Fragment) OS=Sparus aurata GN=CHTRII PE=2 SV=1
 2875 : Q5I0Q6_XENTR        0.30  0.49   29  172   25  151  144    5   17  251  Q5I0Q6     Hypothetical LOC496920 OS=Xenopus tropicalis GN=klk15 PE=2 SV=1
 2876 : Q5M925_XENTR        0.30  0.47   29  175   28  167  152    6   17  269  Q5M925     Elastase 3B, pancreatic OS=Xenopus tropicalis GN=ela3b PE=2 SV=1
 2877 : Q5M959_XENTR        0.30  0.49   29  175   21  147  148    8   22  243  Q5M959     Hypothetical LOC496627 OS=Xenopus tropicalis GN=prss2 PE=2 SV=1
 2878 : Q5M976_XENTR        0.30  0.50   29  172   21  144  146    7   24  243  Q5M976     Hypothetical LOC496623 OS=Xenopus tropicalis GN=LOC496623 PE=2 SV=1
 2879 : Q5QBF4_CULSO        0.30  0.49   29  175   34  163  147    6   17  259  Q5QBF4     Serine protease OS=Culicoides sonorensis PE=2 SV=1
 2880 : Q66L05_XENLA        0.30  0.49   29  172   23  149  144    6   17  248  Q66L05     MGC85264 protein OS=Xenopus laevis GN=prss3 PE=2 SV=1
 2881 : Q6BD14_DROEU        0.30  0.54   29  175  102  256  163    8   24  324  Q6BD14     CG3066 (Fragment) OS=Drosophila eugracilis PE=2 SV=1
 2882 : Q6DBS8_DANRE        0.30  0.49   29  174   21  153  148    7   17  249  Q6DBS8     Uncharacterized protein OS=Danio rerio GN=cfd PE=2 SV=2
 2883 : Q6DIW2_XENTR        0.30  0.50   29  175   23  152  147    6   17  249  Q6DIW2     MGC89184 protein OS=Xenopus tropicalis GN=prss3 PE=2 SV=1
 2884 : Q6GPX7_XENLA        0.30  0.51   29  171   23  148  143    6   17  248  Q6GPX7     MGC82534 protein OS=Xenopus laevis GN=prss1.2 PE=2 SV=1
 2885 : Q6IE57_RAT          0.30  0.43   29  172   21  151  148    8   21  247  Q6IE57     Mast cell protease 1-like 4 (Precursor) OS=Rattus norvegicus GN=Mcpt1l4 PE=2 SV=1
 2886 : Q6P2N5_HUMAN        0.30  0.49   29  156   48  165  128    3   10  181  Q6P2N5     UNQ9391 protein (Fragment) OS=Homo sapiens GN=UNQ9391 PE=2 SV=1
 2887 : Q6P2V9_XENTR        0.30  0.52   29  173   31  160  145    5   15  260  Q6P2V9     Ctrb2-prov protein (Fragment) OS=Xenopus tropicalis GN=ctrb2-prov PE=2 SV=1
 2888 : Q6P6W8_RAT          0.30  0.53   29  175   29  164  148    6   13  273  Q6P6W8     Tryptase alpha/beta 1 OS=Rattus norvegicus GN=Tpsab1 PE=2 SV=1
 2889 : Q6PK75_HUMAN        0.30  0.47   29  156   24  136  128    3   15  187  Q6PK75     PRSS2 protein (Fragment) OS=Homo sapiens GN=PRSS2 PE=2 SV=1
 2890 : Q792Y8_MOUSE        0.30  0.50   29  171   24  146  143    6   20  246  Q792Y8     MCG15081 OS=Mus musculus GN=Gm10334 PE=3 SV=1
 2891 : Q792Y9_MOUSE        0.30  0.50   29  171   23  145  143    6   20  245  Q792Y9     MCG140783 OS=Mus musculus GN=Gm5771 PE=2 SV=1
 2892 : Q792Z0_MOUSE        0.30  0.50   29  171   24  146  143    6   20  246  Q792Z0     Protein Prss3 OS=Mus musculus GN=Prss3 PE=3 SV=1
 2893 : Q7PWE3_ANOGA        0.30  0.49   29  175    8  142  150    6   18  248  Q7PWE3     AGAP008997-PA (Fragment) OS=Anopheles gambiae GN=AGAP008997 PE=3 SV=4
 2894 : Q7SYQ8_XENLA        0.30  0.50   29  175   29  166  151    7   17  240  Q7SYQ8     Ela2-prov protein OS=Xenopus laevis GN=cela2a PE=2 SV=1
 2895 : Q7SZ06_XENLA        0.30  0.49   29  172   21  144  146    7   24  243  Q7SZ06     MGC64344 protein OS=Xenopus laevis GN=MGC64344 PE=2 SV=1
 2896 : Q7YS62_HORSE        0.30  0.49   29  175   31  166  151   10   19  275  Q7YS62     Tryptase OS=Equus caballus GN=mtc1 PE=2 SV=1
 2897 : Q802E9_GLOHA        0.30  0.51  179  277   21  114  103    5   13  123  Q802E9     Thrombin-like enzyme PTLE2 OS=Gloydius halys PE=2 SV=1
 2898 : Q86TM8_HUMAN        0.30  0.49   29  175   31  166  150    8   17  275  Q86TM8     TPSAB1 protein OS=Homo sapiens GN=TPSAB1 PE=2 SV=1
 2899 : Q86UA5_HUMAN        0.30  0.49   29  175   32  167  150    8   17  276  Q86UA5     TPSAB1 protein (Fragment) OS=Homo sapiens GN=TPSAB1 PE=2 SV=1
 2900 : Q8AV11_ONCKE1MBQ    0.30  0.50   29  175    1  127  148    8   22  222  Q8AV11     Anionic trypsin (Fragment) OS=Oncorhynchus keta PE=1 SV=1
 2901 : Q8AV83_DANRE        0.30  0.50   29  175   25  151  148    7   22  243  Q8AV83     Trypsin OS=Danio rerio GN=try PE=2 SV=1
 2902 : Q8AXQ8_XENLA        0.30  0.47   29  170   15  161  158    5   27  284  Q8AXQ8     Mannose-binding lectin-associated serine protease (Fragment) OS=Xenopus laevis GN=MASP PE=3 SV=1
 2903 : Q8CJ16_RAT          0.30  0.49   29  175  134  269  154    6   25  371  Q8CJ16     Adrenal mitochondrial protease short variant OS=Rattus norvegicus GN=Amp PE=2 SV=1
 2904 : Q8I8E2_OCHTR        0.30  0.48   29  175   26  160  151    7   20  257  Q8I8E2     Late trypsin OS=Ochlerotatus triseriatus PE=3 SV=1
 2905 : Q8I8E4_9DIPT        0.30  0.48   29  170   26  155  147    9   22  257  Q8I8E4     Late trypsin OS=Ochlerotatus epactius PE=3 SV=1
 2906 : Q8IS83_AEDAL        0.30  0.47   29  175   26  160  150    7   18  257  Q8IS83     Late trypsin OS=Aedes albopictus PE=3 SV=1
 2907 : Q8T9T2_AEDAE        0.30  0.50   29  173  126  284  161    9   18  413  Q8T9T2     Putative prophenoloxidase activating protein OS=Aedes aegypti PE=2 SV=1
 2908 : Q9BJL7_TRISP        0.30  0.48   29  175   82  229  163   11   31  465  Q9BJL7     Newborn larvae-specific serine protease SS2 OS=Trichinella spiralis PE=2 SV=1
 2909 : Q9PWQ6_GADMO        0.30  0.51   29  170   32  159  145    6   20  263  Q9PWQ6     Chymotrypsin B (Precursor) OS=Gadus morhua GN=chyB PE=2 SV=1
 2910 : Q9QUK9_MOUSE        0.30  0.49   29  171   24  146  144    7   22  246  Q9QUK9     MCG15083 OS=Mus musculus GN=Try5 PE=2 SV=1
 2911 : Q9R0T7_MOUSE        0.30  0.49   29  171   24  146  144    7   22  246  Q9R0T7     MCG15085 OS=Mus musculus GN=Try4 PE=2 SV=1
 2912 : Q9V3Z2_DROME        0.30  0.55   29  175  137  291  161    7   20  391  Q9V3Z2     Serine protease 7, isoform A OS=Drosophila melanogaster GN=Sp7 PE=2 SV=1
 2913 : Q9VAQ2_DROME        0.30  0.45   29  172   68  204  152    8   23  316  Q9VAQ2     CG11843 OS=Drosophila melanogaster GN=CG11843 PE=3 SV=1
 2914 : Q9XSM1_SHEEP        0.30  0.52   29  175   29  164  149    7   15  273  Q9XSM1     Tryptase OS=Ovis aries PE=2 SV=1
 2915 : Q9XY51_CTEFE        0.30  0.48   29  175   24  156  149    7   18  256  Q9XY51     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-2 PE=2 SV=1
 2916 : Q9XY62_CTEFE        0.30  0.53   29  171   23  155  146    5   16  255  Q9XY62     Chymotrypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-7 PE=2 SV=1
 2917 : R0JGZ4_ANAPL        0.30  0.47   29  175    5  132  149    6   23  229  R0JGZ4     Kallikrein-6 (Fragment) OS=Anas platyrhynchos GN=Anapl_17536 PE=3 SV=1
 2918 : R0LMT0_ANAPL        0.30  0.47   29  175    3  139  147    5   10  234  R0LMT0     Transmembrane protease, serine 11E2 (Fragment) OS=Anas platyrhynchos GN=Anapl_10489 PE=3 SV=1
 2919 : R4UL29_COPFO        0.30  0.48   30  175    8  134  146    5   19  240  R4UL29     Trypsin-like serine protease OS=Coptotermes formosanus PE=2 SV=1
 2920 : R7TU68_CAPTE        0.30  0.45   29  175   25  163  153   11   20  262  R7TU68     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_103892 PE=3 SV=1
 2921 : S4R8S7_PETMA        0.30  0.51  179  278   51  148  104    7   10  154  S4R8S7     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 2922 : S4R9Q9_PETMA        0.30  0.48   29  158   24  142  130    4   11  174  S4R9Q9     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
 2923 : S4RCK0_PETMA        0.30  0.53   29  174   36  167  147    6   16  268  S4RCK0     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (1 of 11) PE=3 SV=1
 2924 : S4RJU0_PETMA        0.30  0.51   29  174   27  158  148    7   18  259  S4RJU0     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=CTRL (2 of 11) PE=3 SV=1
 2925 : S4RSR1_PETMA        0.30  0.49   29  175   26  155  148    7   19  253  S4RSR1     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
 2926 : S4RVG1_PETMA        0.30  0.47   29  175   24  154  148    8   18  223  S4RVG1     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
 2927 : S4RVG6_PETMA        0.30  0.47   29  175   24  154  148    8   18  232  S4RVG6     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
 2928 : S4RVH9_PETMA        0.30  0.49   29  175   22  150  148    7   20  245  S4RVH9     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=Pma.9336 PE=3 SV=1
 2929 : S6B566_9TELE        0.30  0.52   29  170   34  160  145    7   21  263  S6B566     Chymotrypsin OS=Gadus macrocephalus GN=chytryp PE=2 SV=1
 2930 : S7NC50_MYOBR        0.30  0.56   29  171   61  203  151    6   16  311  S7NC50     Mannan-binding lectin serine protease 1 OS=Myotis brandtii GN=D623_10016112 PE=3 SV=1
 2931 : S7PQQ8_MYOBR        0.30  0.50   29  174   24  149  148    8   24  246  S7PQQ8     Cationic trypsin-3 OS=Myotis brandtii GN=D623_10020783 PE=3 SV=1
 2932 : S9XB36_9CETA        0.30  0.47  177  278  170  298  131    6   31  300  S9XB36     Tryptase beta-2 OS=Camelus ferus GN=CB1_090697001 PE=3 SV=1
 2933 : S9YTE3_9CETA        0.30  0.46   29  175   27  157  149    8   20  262  S9YTE3     Granzyme M OS=Camelus ferus GN=CB1_000257012 PE=3 SV=1
 2934 : T1DPW5_ANOAQ        0.30  0.53   29  175   18  156  152   10   18  263  T1DPW5     Putative chymotrypsin bi chymotrypsin bi (Fragment) OS=Anopheles aquasalis PE=2 SV=1
 2935 : T1DRW4_ANOAQ        0.30  0.49   29  174   36  177  152    9   16  282  T1DRW4     Putative trypsin-like serine protease (Fragment) OS=Anopheles aquasalis PE=2 SV=1
 2936 : T1EG34_HELRO        0.30  0.53   29  175   46  181  152    8   21  284  T1EG34     Uncharacterized protein OS=Helobdella robusta GN=HELRODRAFT_114601 PE=3 SV=1
 2937 : T1ELH4_HELRO        0.30  0.48   29  175   46  181  149    7   15  282  T1ELH4     Uncharacterized protein OS=Helobdella robusta GN=HELRODRAFT_155168 PE=3 SV=1
 2938 : T1GEI2_MEGSC        0.30  0.46  177  272   24  108   97    4   13  117  T1GEI2     Uncharacterized protein (Fragment) OS=Megaselia scalaris PE=3 SV=1
 2939 : T1H2V5_MEGSC        0.30  0.46   29  173   31  166  150    7   19  277  T1H2V5     Uncharacterized protein (Fragment) OS=Megaselia scalaris PE=3 SV=1
 2940 : T1HFU7_RHOPR        0.30  0.45   29  175   92  231  154    9   21  337  T1HFU7     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
 2941 : T1I0A0_RHOPR        0.30  0.47   29  173    5  141  150    8   18  262  T1I0A0     Uncharacterized protein OS=Rhodnius prolixus PE=3 SV=1
 2942 : T1I447_RHOPR        0.30  0.44   29  175   22  162  153    8   18  261  T1I447     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
 2943 : T1I8M7_RHOPR        0.30  0.46   29  171   49  178  145    7   17  250  T1I8M7     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
 2944 : T1IX45_STRMM        0.30  0.50   29  172   14  153  149    7   14  249  T1IX45     Uncharacterized protein (Fragment) OS=Strigamia maritima PE=3 SV=1
 2945 : T1KRU4_TETUR        0.30  0.48   29  175   50  198  158    8   20  299  T1KRU4     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 2946 : T1KZ00_TETUR        0.30  0.51   29  174   25  166  154    7   20  295  T1KZ00     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 2947 : T1L3I3_TETUR        0.30  0.48   32  175   24  152  148    7   23  275  T1L3I3     Uncharacterized protein OS=Tetranychus urticae PE=3 SV=1
 2948 : T1PLT8_MUSDO        0.30  0.51   29  175  156  300  156    8   20  414  T1PLT8     Trypsin OS=Musca domestica PE=2 SV=1
 2949 : T2HRU2_PROFL        0.30  0.51   29  173   25  153  148    6   22  260  T2HRU2     Serine protease (Precursor) OS=Protobothrops flavoviridis PE=2 SV=1
 2950 : TRY1_HUMAN  1FXY    0.30  0.50   29  175   24  150  148    7   22  247  P07477     Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1
 2951 : TRY1_XENLA          0.30  0.49   29  172   21  144  146    7   24  243  P19799     Trypsin OS=Xenopus laevis PE=2 SV=1
 2952 : TRY3_SALSA  1A0J    0.30  0.49   29  175   16  142  148    7   22  238  P35033     Trypsin-3 (Fragment) OS=Salmo salar PE=1 SV=1
 2953 : TRY7_ANOGA          0.30  0.53   29  175   42  172  148    7   18  267  P35041     Trypsin-7 OS=Anopheles gambiae GN=TRYP7 PE=2 SV=2
 2954 : TRYB1_RAT           0.30  0.53   29  175   29  164  148    6   13  273  P27435     Tryptase OS=Rattus norvegicus GN=Tpsab1 PE=1 SV=2
 2955 : U3IND6_ANAPL        0.30  0.45   29  153   30  148  130    4   16  199  U3IND6     Uncharacterized protein OS=Anas platyrhynchos GN=CTRC PE=3 SV=1
 2956 : U3J739_ANAPL        0.30  0.51   29  170   34  161  146    9   22  259  U3J739     Uncharacterized protein OS=Anas platyrhynchos PE=3 SV=1
 2957 : U3JV08_FICAL        0.30  0.47   29  175  584  719  163   10   43  821  U3JV08     Uncharacterized protein (Fragment) OS=Ficedula albicollis GN=TMPRSS7 PE=3 SV=1
 2958 : U4TZZ2_DENPD        0.30  0.43   29  170   38  163  146   10   24  269  U4TZZ2     Uncharacterized protein OS=Dendroctonus ponderosae GN=D910_00257 PE=3 SV=1
 2959 : U4U2F6_DENPD        0.30  0.49   29  174    8  139  148    6   18  236  U4U2F6     Uncharacterized protein OS=Dendroctonus ponderosae GN=D910_05443 PE=3 SV=1
 2960 : U4UZ32_DENPD        0.30  0.52   29  175  162  286  150    8   28  298  U4UZ32     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=D910_00087 PE=3 SV=1
 2961 : V4BQ38_LOTGI        0.30  0.55   29  171    1  128  143    7   15  232  V4BQ38     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_122334 PE=3 SV=1
 2962 : V5FZI1_ANOGL        0.30  0.52   29  174   44  177  149    9   18  295  V5FZI1     Chymotrypsin OS=Anoplophora glabripennis GN=CTR PE=3 SV=1
 2963 : V5GHJ2_ANOGL        0.30  0.50   56  172   12  120  117    4    8  158  V5GHJ2     Venom protease (Fragment) OS=Anoplophora glabripennis GN=SP4 PE=3 SV=1
 2964 : V5GUK7_ANOGL        0.30  0.50   29  175   55  186  150    8   21  284  V5GUK7     Chymotrypsin (Fragment) OS=Anoplophora glabripennis GN=CTRB1 PE=3 SV=1
 2965 : V5H0E9_IXORI        0.30  0.50   29  170   40  169  147   10   22  286  V5H0E9     Putative tick serine proteinase OS=Ixodes ricinus PE=2 SV=1
 2966 : V5H4M9_IXORI        0.30  0.48   29  175   40  175  150    6   17  286  V5H4M9     Putative trypsin-like serine protease OS=Ixodes ricinus PE=2 SV=1
 2967 : V5H7C9_IXORI        0.30  0.45   29  174   38  168  150   10   23  283  V5H7C9     Putative trypsin-like serine protease OS=Ixodes ricinus PE=2 SV=1
 2968 : V5H7Y9_IXORI        0.30  0.51   29  174   37  173  150   10   17  288  V5H7Y9     Putative serin proteinase 2 OS=Ixodes ricinus PE=2 SV=1
 2969 : V5H8D0_IXORI        0.30  0.48   29  175   42  177  150   10   17  259  V5H8D0     Putative tick serine proteinase OS=Ixodes ricinus PE=2 SV=1
 2970 : V5HTG0_IXORI        0.30  0.49   29  175   43  178  150    6   17  289  V5HTG0     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2971 : V5HW91_IXORI        0.30  0.50   29  170   34  163  147   10   22  280  V5HW91     Putative tick serine proteinase (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2972 : V5HWG8_IXORI        0.30  0.45   29  174   35  165  150   10   23  280  V5HWG8     Putative trypsin-like serine protease (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2973 : V5IGW7_IXORI        0.30  0.55   35  174    3  126  141    7   18  230  V5IGW7     Putative serine protease 110 (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2974 : V5IJW3_IXORI        0.30  0.51   29  174   38  174  150   10   17  289  V5IJW3     Putative serin proteinase 2 (Fragment) OS=Ixodes ricinus PE=2 SV=1
 2975 : V9LCI2_CALMI        0.30  0.52  177  277   82  179  104    7    9  180  V9LCI2     Suppressor of tumorigenicity 14 protein-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
 2976 : VSP1_PROFL          0.30  0.51   29  173   25  153  148    6   22  260  P05620     Thrombin-like enzyme flavoxobin OS=Protobothrops flavoviridis GN=TLF1 PE=1 SV=2
 2977 : W4YUM5_STRPU        0.30  0.52  177  278   27  129  109    6   13  129  W4YUM5     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=3 SV=1
 2978 : W5JA92_ANODA        0.30  0.46   29  174  132  284  158    7   17  391  W5JA92     CLIP-domain serine protease subfamily B OS=Anopheles darlingi GN=AND_006968 PE=3 SV=1
 2979 : W5JJI7_ANODA        0.30  0.48   29  175   85  218  149    6   17  322  W5JJI7     Coagulation factor XI OS=Anopheles darlingi GN=AND_005379 PE=3 SV=1
 2980 : W5K016_ASTMX        0.30  0.51  179  276   49  144  102    7   10  147  W5K016     Uncharacterized protein OS=Astyanax mexicanus GN=CELA3A PE=3 SV=1
 2981 : W5K9T7_ASTMX        0.30  0.47   29  175  264  399  160   11   37  504  W5K9T7     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 2982 : W5L0Z6_ASTMX        0.30  0.45   29  174  323  466  160   12   30  571  W5L0Z6     Uncharacterized protein OS=Astyanax mexicanus PE=3 SV=1
 2983 : W5LYA1_LEPOC        0.30  0.49   29  175   12  143  148    5   17  186  W5LYA1     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 2984 : W5LYQ2_LEPOC        0.30  0.54   29  175   12  146  149    9   16  296  W5LYQ2     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 2985 : W5MA73_LEPOC        0.30  0.54   29  151   26  137  124    5   13  186  W5MA73     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=3 SV=1
 2986 : W5N5D2_LEPOC        0.30  0.47   29  175  586  731  160   11   27  834  W5N5D2     Uncharacterized protein OS=Lepisosteus oculatus PE=3 SV=1
 2987 : W5NQ61_SHEEP        0.30  0.51   29  175    5  142  149    7   13  242  W5NQ61     Uncharacterized protein OS=Ovis aries GN=PRSS21 PE=3 SV=1
 2988 : W5P3L7_SHEEP        0.30  0.47   29  173  163  301  155    9   26  418  W5P3L7     Uncharacterized protein OS=Ovis aries GN=HPN PE=3 SV=1
 2989 : W5P918_SHEEP        0.30  0.49   29  173   34  158  146    6   22  258  W5P918     Uncharacterized protein OS=Ovis aries GN=LOC101116249 PE=3 SV=1
 2990 : W5PB60_SHEEP        0.30  0.46   29  171    3  130  143    4   15  226  W5PB60     Uncharacterized protein OS=Ovis aries PE=3 SV=1
 2991 : W5PJN4_SHEEP        0.30  0.47   29  172   30  163  149    7   20  268  W5PJN4     Uncharacterized protein OS=Ovis aries GN=CTRC PE=3 SV=1
 2992 : W5PXT4_SHEEP        0.30  0.49   29  174   23  148  149   10   26  256  W5PXT4     Uncharacterized protein OS=Ovis aries GN=KLK15 PE=3 SV=1
 2993 : W5PY03_SHEEP        0.30  0.51   29  175   24  152  148    7   20  247  W5PY03     Uncharacterized protein OS=Ovis aries GN=KLK6 PE=3 SV=1
 2994 : W5PZ72_SHEEP        0.30  0.52   29  175   33  168  149    7   15  268  W5PZ72     Uncharacterized protein (Fragment) OS=Ovis aries GN=TRYPTASE-1 PE=3 SV=1
 2995 : W5QFL6_SHEEP        0.30  0.47   29  175   43  189  161   13   28  416  W5QFL6     Acrosin (Fragment) OS=Ovis aries GN=ACR PE=3 SV=1
 2996 : W5UJ96_ICTPU        0.30  0.50   29  172   30  164  148    6   17  269  W5UJ96     Chymotrypsin-like elastase family member 3B OS=Ictalurus punctatus GN=Cela3b PE=2 SV=1
 2997 : W8AUL1_CERCA        0.30  0.49   29  175   40  165  148    7   23  265  W8AUL1     Serine protease SP24D (Fragment) OS=Ceratitis capitata GN=SP24D PE=2 SV=1
 2998 : W8B599_CERCA        0.30  0.46   29  175   80  214  155   10   28  326  W8B599     Serine proteinase stubble (Fragment) OS=Ceratitis capitata GN=STUB PE=2 SV=1
 2999 : W8B758_CERCA        0.30  0.47   29  171   32  156  144    8   20  259  W8B758     Trypsin (Fragment) OS=Ceratitis capitata GN=TRYP PE=2 SV=1
 3000 : W8BLL3_CERCA        0.30  0.51   29  172  148  299  157    7   18  402  W8BLL3     Serine protease easter OS=Ceratitis capitata GN=EAST PE=2 SV=1
 3001 : W8BSR7_CERCA        0.30  0.46   34  171    2  151  150    6   12  254  W8BSR7     Serine protease easter (Fragment) OS=Ceratitis capitata GN=EAST PE=2 SV=1
 3002 : W8BZU5_CERCA        0.30  0.48   29  175   51  185  149    7   16  283  W8BZU5     Serine proteases 1/2 (Fragment) OS=Ceratitis capitata GN=SER1 PE=2 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    7 A A              0   0  126   81   38  A AA A AAA  AA         AAAA                    AAAA AAAAAAA           
     2    8 A D    >   +     0   0   69   86   15  D DD D DDD  DD         DDDD                    DDDD DDDDDDD           
     3    9 A a  T 3   +     0   0   24   96    0  C CC C CCC  CC         CCCC                    CCCC CCCCCCC           
     4   10 A G  T 3  S+     0   0    0   96    0  G GG G GGG  GG         GGGG                    GGGG GGGGGGG           
     5   11 A L    <   -     0   0   36   96   65  L LL L LLL  LL         LLLL                    LLLL LLLLLLL           
     6   12 A R    > > -     0   0    0   96    0  R RR R RRR  RR         RRRR                    RRRR RRRRRRR           
     7   13 A P  T 3 5S+     0   0   15   96    0  P PP P PPP  PP         PPPP                    PPPP PPPPPPP           
     8   14 A L  T 3 5S+     0   0   34   96    1  L LL L LLL  LL         LLLL                    LLLL LLLLLLL           
     9   15 A F  T X >S+     0   0   14   96    0  F FF F FFF  FF         FFFF                    FFFF FFFFFFF           
    10   16 A E  G > 5S+     0   0   27   96    0  E EE E EEE  EE         EEEE                    EEEE EEEEEEE           
    11   17 A K  G 3 > S+     0   0   41   95   61  T TT T TTT  TT         TTTT                    TTTR TTTTTTT           
    19   25 A E  H 3> S+     0   0    3   96    0  E EE E EEE  EE         EEEE                    EEEE EEEEEEE           
    20   26 A R  H 3> S+     0   0  124   96   65  R RR R RRR  RR         GGGG                    KKKK KDQKEKK           
    21   27 A E  H <> S+     0   0   37   96    4  E EE E EEE  EE         EEEE                    EEEE EEEEEEE           
    22   28 A L  H  < S+     0   0    0   96    0  L LL L LLL  LL         LLLL                    LLLL LLLLLLL           
    23   29 A L  H >< S+     0   0   40   96   12  L LL L LLL  LL         LLLL                    FFLL LLLLLFL           
    24   30 A E  H >< S+     0   0  122   96   34  E EE E EEE  EE         EEEE                    EEDD DEEDDED           
    25   31 A S  T 3< S+     0   0   13   96    0  S SS S SSS  SS         SSSS                    SSSS SSSSSSS           
    26   32 A Y  T <         0   0   26   96    0  Y YY Y YYY  YY         YYYY                    YYYY YYYYYYY           
    27   33 A I    <         0   0  194   71   23  I II I III  II         IIII                    IIII IIIIIII           
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10   I  I I   II  II   IIII     I IIIIIIIIVVIIIIIII    I       IIIII   III
    30   38 B V  B     +A  221   0A  13 2209   20   V  V V   VV  VV   VVVV     V VVVVVVVVVVVVVVVVV    V       VVVVV   VVV
    31   39 B E  S    S+     0   0  131 2214   31   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEKEKEE    E       EAEEE   EEG
    32   40 B G        -     0   0   30 2221    1   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG   GGG
    33   41 B S  E     -B  184   0B  74 2221   88   S  S S   SS  SS   WWWW     W WWWSWWSSWWWWWWWWW    W       SRWWW   WWR
    34   42 B D  E     -B  183   0B  99 2227   62   D  D D   DD  DD   DDDD     D DDDDDDDDDDDDDDDDD    D       DDDDD   DDD
    35   43 B A        -     0   0    5 2227   45   A  A A   AA  AA   AAAA     A AAAAAAAAAAAAAAAAA    A       AAAAA   AAA
    36   44 B E    >   -     0   0   41 2228   84   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    E       EEEEE   EEQ
    37   45 B I  T 3  S+     0   0   90 2237   79   I  I I   II  II   IIII     I IMIIVIIIIIKKVKIKK    Q       MKKKT   LKI
    38   46 B G  T 3  S+     0   0   11 2241   60   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG   GGG
    39   47 B M  S <  S+     0   0    7 2243   67   M  M M   MM  MM   MMMM     I IILLILLLLLIILIIII    I       ILLLV   LLS
    40   48 B S  S >  S+     0   0   11 2247   63   S  S S   SS  SS   SSSS     S SAAAAAAAAAAAAAAAA    A       AAAAA   AAA
    41   49 B P  T 3  S+     0   0    5 2251    4   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP   PPP
    42   50 B W  T 3  S+     0   0    2 2253   18   W  W W   WW  WW   WWWW     W WWWWWWWWWWWWWWWWW    W       WWWWW   WWW
    43   51 B Q  E <   -J   59   0C   2 2256   32   Q  Q Q   QQ  QQ   QQQQ     Q QQQQQQQQQQQQQQQQQ    Q       QQQQQ   QQQ
    44   52 B V  E     -JK  58  91C   0 2257   34   V  V V   VV  VV   VVVV     V VVVVVVVVVVVVVVVVV    V       VVVVV   VVV
    45   53 B M  E     -JK  57  90C   0 2256   51   M  M M   MM  MM   MMMM     M MMMMMMMMMMMMMMMMM    M       MMMMM   MMM
    46   54 B L  E     -JK  56  89C   0 2257   14   L  L L   LL  LL   LLLL     L LLLILLIILLLLLLLLL    L       LLLLL   ILI
    47   55 B F  E     -JK  54  88C   0 2256   82   F  F F   FF  FF   FFFF     F FFFFFFFFFFFFFFFFF    F       fFFFF   FYF
    48   56 B R  E   > -JK  53  87C  76 1547   74   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       .RRRR   RRR
    49   57 B K  T > 5S+     0   0   41  951   80   K  K K   KK  KK   KKKK     K KKKKKKKKKKKKKKKKK    K       kKKKK   KKK
    50   58 B S  T 3 5S+     0   0   72 1192   73   S  S S   SS  SS   SSSS     A ASSSSSSSSSSSSSSSS    S       SNSST   SSS
    51   59 B P  T 3 5S-     0   0   69 2030   82   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP   PPP
    52   60 B Q  T < 5 +     0   0   62 2193   78   Q  Q Q   QQ  QQ   QQQQ     Q QQQQQQQQQQQQQQQQQ    Q       QQQQQ Q QQQ
    53   61 B E  E   < -J   48   0C  77 2221   95   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    E       EEEEE E EEE
    54   62 B L  E     +J   47   0C  17 2246   57   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
    55   63 B L  E     -     0   0C  17 2261   70   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
    56   64 B b  E     -J   46   0C   1 2264    1   C  C C   CC  CC   CCCC     C CCCCCCCCCCCCCCCCC    C       CCCCC C CCC
    57   65 B G  E     +J   45   0C   2 2264    3   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG A GGG
    58   66 B A  E     -J   44   0C   0 2264   13   A  A A   AA  AA   AAAA     A AAAAAAAAAAAAAAAAA    A       AAAAA A AAA
    59   67 B S  E     -JL  43  67C   0 2264   40   S  S S   SS  TT   SSSS     S SSSSSSSSSSSSSSSSS    S       SSSSS S SSS
    60   68 B L  E     + L   0  66C   0 2264   10   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
    61   69 B I        -     0   0   23 2264   15   I  I I   II  II   IIII     I IIIIIIIIIIIIIIIII    I       IIIII I III
    62   70 B S  S    S-     0   0   32 2264   62   S  S S   SS  SS   SSSS     S SSSSSSSSSSSSSSSSS    S       SSSSS S SSS
    63   71 B D  S    S+     0   0   61 2210   68   D  D D   DD  DD   DDDD     D DDDDDDDDDDDDDDDDD    D       DDDDD D DDD
    64   72 B R  S    S+     0   0   80 2263   73   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
    65   73 B W  E     - M   0 132C  12 2264   12   W  W W   WW  WW   WWWW     W WWWWWWWWWWWWWWWWW    W       WWWWW W WWW
    66   74 B V  E     -LM  60 131C   0 2262   11   V  V V   VV  VV   VVVV     V VVVVVVVVVVVVVVVVV    I       VVVVA V VVV
    67   75 B L  E     +LM  59 130C   0 2263   23   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
    68   76 B T  E     - M   0 129C   0 2263   28   T  T T   TT  TT   TTTT     T TTTTTTTTTTTTTTTTT    T       TTTTT T TTT
    69   77 B A    >   -     0   0    0 2262    2   A  A A   AA  AA   AAAA     A AAAAAAAAAAAAAAAAA    A       AAAAA A AAA
    70   78 B A  G >> S+     0   0    0 2263    6   A  A A   AA  AA   AAAA     A AAAAAAAAAAAAAAAAA    A       AAAAA A AAA
    71   79 B H  G 34 S+     0   0   10 2264    3   H  H H   HH  HH   HHHH     H HHHHHHHHHHHHHHHHH    H       HHHHH H HHH
    72   80 B b  G <4 S+     0   0    0 2264    1   C  C C   CC  CC   CCCC     C CCCCCCCCCCCCCCCCC    C       CCCCC C CCC
    73   81 B L  T <4 S+     0   0    1 2264   68   L  L L   LL  LL   LLLL     L LLLLLLLLLLIILILII    L       LLLLV L LLL
    74   82 B L  E  <  +P   81   0D  46 2264   89   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
    75   83 B Y  E > > -P   80   0D  49 2249   82   Y  Y Y   YY  YY   YYYY     Y YYYYYYYYYYYYYYYYY    Y       YYYYY Y YYY
    76   84 B P  G > 5S+     0   0   52 2249   88   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP P PPP
    77   85 B P  G 3 5S+     0   0   75  844   90   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP P PPP
    78   86 B W  G < 5S-     0   0  166  852   93   W  W W   WW  WW   WWWW     W WWWWWWWWWWWWWWWWW    W       WWWWW W WWW
    79   87 B D  T < 5 +     0   0  152  869   93   D  D D   DD  DD   DDDD     D DDDDDDDDDDDDDDDDD    D       DDDDD D DDD
    80   88 B K  E   < +P   75   0D  51  904   83   K  K K   KK  KK   KKKK     K KKKKKKKKKKKKKKKKK    K       KKKKK K KKK
    81   89 B N  E     +P   74   0D 110  936   80   N  N N   NN  NN   NNNN     N NNNNNNNNNNNNNNNNN    N       NNNNN N NNN
    82   90 B F        -     0   0   28 1017   94   F  F F   FF  FF   FFFF     F FFFFFFFFFFFFFFFFF    F       FFFFF F FFF
    83   91 B T    >>  -     0   0   70 1164   86   T  T T   TT  TT   TTTT     T TTTTTTTTTTTTTTTTT    T       TTTTT T TTT
    84   92 B E  G >4 S+     0   0   35 1455   85   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    E       EEAAE V EAV
    85   93 B N  G 34 S+     0   0  127 1677   87   N  N N   NN  NN   NNNN     N NNNNNNNNNNNNNNNNN    N       NNDDN N NDN
    86   94 B D  G <4 S+     0   0   49 1292   82   D  D D   DD  DD   DDDD     D DDDDDDDDDDDDDDDDD    D       DDDDD D DDD
    87   95 B L  E <<  +K   48   0C   0 1493   89   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       ILLLL I LLI
    88   96 B L  E     -KN  47 108C   3 2025   51   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
    89   97 B V  E     -KN  46 107C   0 1516   29   V  V V   VV  VV   VVVV     V VVVVVVVVVVVVVVVVV    V       VVVVL V VVV
    90   98 B R  E     -KN  45 106C   0 1577   87   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
    91   99 B I  E     +KN  44 105C   0 1674   49   I  I I   II  II   IIII     I IIIIIIIIIIIIIIIII    L       IIMII I III
    92  100 B G  S    S+     0   0    7 1756   23   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG G GGG
    93  101 B K        +     0   0   13 1789   76   K  K K   KK  KK   KKKK     K KKKKKKKKKKKKKKKKK    K       KKKKK K KKK
    94  102 B H        +     0   0   36 1883   76   H  H H   HH  HH   HHHH     H HHHHHHHHHHHHHHHHH    H       HHHHH Y HHY
    95  103 B S  B     -Q  181   0E  21 1965   75   S  S S   SS  SS   SSSS     A ASSSSSSSSSSSSSSSS    S       SSSSS A SSA
    96  104 B R  S    S+     0   0   16 2018   82   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
    97  105 B T  S    S+     0   0   31 2112   87   T  T T   TT  TT   TTTT     T TTTTTTTTTTTTTTTTT    T       TTTTS S TTS
    98  106 B R  S    S-     0   0   85 2151   87   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
    99  107 B Y        -     0   0   21 2204   90   Y  Y Y   YY  YY   YYYY     Y YYYYYYYYYYYYYYYYY    Y       YYYYY Y YYY
   100  108 B E    >>  -     0   0   22 2250   66   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    E       EEEEE E EEE
   101  109 B R  T 34 S+     0   0  143 2252   78   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
   102  110 B N  T 34 S+     0   0  133 2255   82   N  N N   NN  NN   NNNN     N NNSNNSNNSSNNSNSNN    N       NGGGN N GGN
   103  111 B I  T <4 S+     0   0   58 2257   77   I  I I   II  II   IIII     I IIIIIIIIIIVVIVIVV    F       IIIIM M VIM
   104  112 B E     <  -     0   0    0 2258   77   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    E       EEEEE E EEE
   105  113 B K  E     -N   91   0C  69 2257   91   K  K K   KK  KK   KKKK     K KKKKKKKKKKKKKKKKK    K       KKKKK K KKK
   106  114 B I  E     -N   90   0C  11 2259   71   I  I I   II  II   IIII     I IIIIIIIIIIIIIIIII    I       IIIII I III
   107  115 B S  E     -N   89   0C  12 2260   84   S  S S   SS  SS   SSSS     S SSSSSSSSSSSSSSSSS    S       SSSSS S SSS
   108  116 B M  E     -N   88   0C  58 2260   71   M  M M   MM  MM   MMMM     M MMMMMMMMMMMMMMMMM    M       MMMMM T MMT
   109  117 B L  E     +O  133   0C   6  452   51   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
   110  118 B E  E    S+     0   0C  92 1908   74   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    E       EEEEE E EEE
   111  119 B K  E     -O  132   0C  92 2029   65   K  K K   KK  KK   KKKK     K KKKKKKKKKKKKKKKKK    K       KKKKK K KKK
   112  120 B I  E     -O  131   0C  20 2160   45   I  I I   II  II   IIII     I IIIIIIIIIIIIIIIII    I       VIIII I IVI
   113  121 B Y  E     -O  130   0C  66 2224   50   Y  Y Y   YY  YY   YYYY     Y YYYYYYYYYYYYYYYYY    Y       YYYYF I YYI
   114  122 B I  E     -O  129   0C  52 2228   82   I  I I   II  II   IIII     I IIIIIIIIIIIIIVIVV    I       IIIII I III
   115  123 B H    >   -     0   0   25 2247   20   H  H H   HH  HH   HHHH     H HHHHHHHHHHHHHHHHH    H       HHHHH H HHH
   116  124 B P  T 3  S+     0   0  106 2258   50   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP P PPP
   117  125 B R  T 3  S+     0   0  162 2261   76   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR G KRG
   118  126 B Y    <   -     0   0   15 2261   15   Y  Y Y   YY  YY   YYYY     Y YYYYYYYYYYYYYYYYY    Y       YYYYY Y YYY
   119  127 B N  B > > +R  125   0F  41 2262   68   N  N N   NN  NN   NNNN     N NNNNNNNNNNNNNNNNN    N       NNNNN N NNN
   120  128 B W  T 3 5 +     0   0   62 1485   76   W  W W   WW  WW   WWWW     W WWWWWWWWWWWWWWWWW    W       WWWWW W WWW
   121  129 B R  T 3 5S+     0   0  192 1311   77   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
   122  130 B E  T < 5S-     0   0  101 1657   80   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    D       EDDDE E DDE
   123  131 B N  T   5S-     0   0    4 2142   69   N  N N   NN  NN   NNNN     N NNNNNNNNNNNNNNNNN    N       NIMIN N NIN
   124  132 B L    > < +     0   0   25 1817   69   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
   125  133 B D  B 3   +R  119   0F   7 2115   65   D  D D   DD  DD   DDDD     D DDDDDDDDDDDDDDDDD    D       DDDDD D DDD
   126  134 B R  T 3  S-     0   0   43 2196   57   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
   127  135 B D    <   +     0   0    0 2261    0   D  D D   DD  DD   DDDD     D DDDDDDDDDDDDDDDDD    D       DDDDD D DDD
   128  136 B I        +     0   0    0 2264   11   I  I I   II  II   IIII     I IIIIIIIIIIIIIIIII    I       IIIII I III
   129  137 B A  E     -MO  68 114C   0 2263   48   A  A A   AA  AA   AAAA     A AAAAAAAAAAAAAAAAA    A       AAAAA A AAA
   130  138 B L  E     -MO  67 113C   0 2264    6   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
   131  139 B M  E     -MO  66 112C   0 2264   30   M  M M   MM  MM   MMMM     L LLLLLLLLLLLLLLLLL    L       LLLLL M LLM
   132  140 B K  E     -MO  65 111C  19 2264   49   K  K K   KK  KK   KKKK     K KKKKKKKKRRKKKKKKK    K       KKKKK K KKK
   133  141 B L  E     - O   0 109C   0 2264    8   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
   134  142 B K  S    S+     0   0  111 2264   73   K  K K   KK  KK   KKKK     K KKKRKKRRKKKKKKKKK    K       KRKKK K RKK
   135  143 B K  S    S-     0   0  171 2264   76   K  K K   KK  KK   KKKK     K KKKKKKKKKKKKKKKKK    K       KKRRR K RRK
   136  144 B P        -     0   0   73 2264   40   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP P PPP
   137  145 B V        -     0   0   11 2220   48   V  V V   VV  VV   IIII     I IVVIIVIIIIVVIVIVV    I       IIIIV V IIV
   138  146 B A        -     0   0   75 2253   81   A  A A   AA  AA   TTTT     T TPNTTNTTAAPPIPAPP    A       TSTAP A ASA
   139  147 B F        +     0   0   87 2257   43   F  F F   FF  FF   FFFF     F FFFFFFFFFFFFFFFFF    F       FFFFF F FFF
   140  148 B S        -     0   0   40 2259   60   S  S S   SS  SS   SSSS     S SSSSSSSSSSSSSSSSS    S       SSSSS S SSS
   141  149 B D  S    S+     0   0   81 2262   69   D  D D   DD  DD   DDDD     D DDNDENDDNNDDDDSDD    N       DDNND D DND
   142  150 B Y  S    S+     0   0   81 2252   87   Y  Y Y   YY  YY   YYYY     Y YYYYHYYFYYYYYYYYY    Y       YYYYY Y HYY
   143  151 B I        +     0   0    0 2256   24   I  I I   II  II   IIII     I IIIIIIIIIIIIIIIII    I       IIIII I VII
   144  152 B H        -     0   0    4 2256   79   H  H H   HH  HH   HHHH     H HHHHHHHHHHHHHHHHH    H       RHHHH H HHH
   145  153 B P        -     0   0    9 2256   44   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP P PPP
   146  154 B V        -     0   0    1 2260   37   V  V V   VV  VV   VVVV     V VVVVVVVVVVVVVVVVV    V       VVVVV V VVV
   147  155 B a  B     -c  242   0B   3 2260   46   C  C C   CC  CC   CCCC     C CCCCCCCCCCCCCCCCC    C       CCCCC C CCC
   148  156 B L        -     0   0   32 2260    9   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
   149  157 B P        -     0   0    0 2259   30   P  P P   PP  PP   PPPP     P PPPPPPPPPPPPPPPPP    P       PPPPP P PPP
   150  158 B D     >  -     0   0   51 2255   78   D  D D   DD  DD   DDDD     D DDDDDDDDDDDDDDDDD    D       DDDDD D DDD
   151  159 B R  H  > S+     0   0  148 1806   76   R  R R   RR  RR   RRRR     R RRRKKRKKRRKKKKKKK    K       KKKKK K KKK
   152  160 B E  H  > S+     0   0  122 1873   75   E  E E   EE  EE   EEEE     E EQDEQDEEDDQQEQAQQ    E       EQQQQ Q EQQ
   153  161 B T  H  > S+     0   0   10 2003   82   T  T T   TT  TT   TTTT     T TTTTTTTTTTTTTTTTT    P       ITTTT I TTI
   154  162 B A  H  X S+     0   0    7 2020   84   A  A A   AA  AA   AAAA     A AAAAAAAAAAVVAVVVV    L       VAAAV V TAV
   155  163 B A  H  < S+     0   0   70 2078   68   A  A A   AA  AA   AAAA     A ATTTATTTVVTTITATT    S       AAAAV T TAT
   156  164 B S  H  < S+     0   0   36 2215   78   S  S S   SS  SS   SSSS     S SSRKSRKKRRSSRSRSS    K       RRRRS S RRS
   157  165 B L  H  < S+     0   0    1  515   98   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
   158  166 B L     <  +     0   0   34  711   82   L  L L   LL  LL   FFFF     L LLLLLLLLLLLLLLILL    L       FLLLL L FLL
   159  167 B Q  S >  S-     0   0   87  836   93   Q  Q Q   QQ  QQ   QQQQ     Q QQQRQQRRRRQQRRQRR    Q       RQQQQ Q HQQ
   160  168 B A  T 3  S+     0   0   51 2039   74   A  A A   AA  AA   AAAA     S SAAAAAAAAAAAAATAA    A       AAAAA A AAA
   161  169 B G  T 3  S+     0   0   42 1713   37   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG G GGG
   162  170 B Y    <   -     0   0   46 1826   85   Y  Y Y   YY  YY   YYYY     Y YYYYYYYYYYYYYYYYY    Y       YYYFY H YFH
   163  171 B K  E     -D  188   0B  33 2112   87   K  K K   KK  KK   KKKK     L LKKKKKKKKKKKKKKKK    K       KKKKK K KKK
   164  172 B G  E     -D  187   0B   0 2154   45   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG G GGG
   165  173 B R  E     -DE 186 232B   3 2164   80   R  R R   RR  RR   RRRR     R RRRRRRRRRRRRRRRRR    R       RRRRR R RRR
   166  174 B V  E     -DE 185 231B   0 2189   33   V  V V   VV  VV   VVVV     V VVVVVVVVVVVVVVVVV    V       VVVVV V VVV
   167  175 B T  E     +D  184   0B   0 2202   48   T  T T   TT  TT   TTTT     T TTTTTTTTTTTTTTTTT    T       TTTTT T TTT
   168  176 B G  E     -D  183   0B   1 2202    0   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG G GGG
   169  177 B W  S    S+     0   0    1 2202    1   W  W W   WW  WW   WWWW     W WWWWWWWWWWWWWWWWW    W       WWWWW W WWW
   170  178 B G  S    S-     0   0    0 2198    1   G  G G   GG  GG   GGGG     G GGGGGGGGGGGGGGGGG    G       GGGGG G GGG
   171  179 B N        -     0   0   33 2021   77   N  N N   NN  NN   NNNN     N NNNNNNNNNNNNNNNNN    N       NNNNN N NNN
   172  180 B L  S    S+     0   0   55 1822   62   L  L L   LL  LL   LLLL     L LLLLLLLLLLLLLLLLL    L       LLLLL L LLL
   173  181 B K  S    S-     0   0  147 1551   78   K  K K   KK  KK   KKKK     K KRRKKRKKKKRRKRKRR    K       RRKKR K KKK
   174  182 B E              0   0   49 1397   62   E  E E   EE  EE   EEEE     E EEEEEEEEEEEEEEEEE    E       EEEEE E EEE
   175  183 B T              0   0  181 1202   57   T  T T   TT  TT   TTTT     T TTTTTTTT  TT TTTT    T        TTT    TT 
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                  GGG                                                   
   178  186 C Q        -     0   0   64  328   73                  QQQ        Q                                    Q Q   
   179  187 C P        -     0   0    8  503   39                  PPP        P P                                  P P   
   180  188 C S  S    S+     0   0   81  526   81                  SSS        S S                                  S S   
   181  189 C V  B    S-Q   95   0E  21  534   82                  VVV        V V                                  V V   
   182  190 C L        -     0   0    5  625    5                  LLL        L L                                  L L   
   183  191 C Q  E     -BD  34 168B   9  629   50                  QQQ        Q Q                                  Q Q   
   184  192 C V  E     +BD  33 167B   6  628   86                  VVV        V V                                  M V   
   185  193 C V  E     - D   0 166B  15  634   49                  VVV        A V                                  V V   
   186  194 C N  E     + D   0 165B   7  634   77                  NNN        N N                                  N N   
   187  195 C L  E     - D   0 164B   0  638   34                  LLL        L L                                  L L   
   188  196 C P  E     - D   0 163B  12  639   46                  PPP        P P                                  P L   
   189  197 C I  E     -F  210   0B   9  640   33                  III        I I                                  L I   
   190  198 C V  E     -F  209   0B  10  641   39                  VVV        V V                                  V M   
   191  199 C E    >>  -     0   0   75  641   66                  EEE        E E                                  E K   
   192  200 C R  H 3> S+     0   0   86  640   78                  RRR        R R                                  R R   
   193  201 C P  H 3> S+     0   0   77  641   74                  PPP        L P                                  P P   
   194  202 C V  H <4 S+     0   0   41  641   84                  VVV        V V                                  I V   
   195  203 C c  H >< S+     0   0    5  645    1                  CCC        C C                                  C C   
   196  204 C K  H >< S+     0   0   91  645   74                  KKK        K K                                  K K   
   197  205 C D  T 3< S+     0   0  141  645   80                  DDD        A A                                  A A   
   198  206 C S  T <  S+     0   0   15  645   87                  SSS        S S                                  S S   
   199  207 C T    <   -     0   0   25  645   71                  TTT        T T                                  T T   
   200  208 C R  S    S+     0   0  249  645   89                  rrR        R r                                  G R   
   201  209 C I  S    S-     0   0   56  565   53                  ..I        I .                                  I T   
   202  210 C R        -     0   0  123  556   82                  rrR        R r                                  R R   
   203  211 C I        -     0   0   12  633   24                  III        I I                                  V I   
   204  212 C T    >   -     0   0   12  638   73                  TTT        T T                                  T T   
   205  213 C D  T 3  S+     0   0   82  642   69                  DDD        D D                                  D D   
   206  214 C N  T 3  S+     0   0   11  645   72                  NNN        N N                                  N N   
   207  215 C M  E <   - G   0 263B   9  637   30                  MMM        M M                                  M M   
   208  216 C F  E     - G   0 262B  19  643   34                  FFF        F F                                  F F   
   209  217 C c  E     -FG 190 261B   0  643    1                  CCC        C C                                  C C   
   210  218 C A  E     +FG 189 260B   0  643   10                  AAA        A A                                  A V   
   211  219 C G        -     0   0    4  643   18                  GGG        G G                                  G G   
   212  220 C Y        -     0   0   31  452   71                  YYY        Y Y                                  Y Y   
   213  221 C K     >  -     0   0   67  484   87                  KKK        K K                                  K K   
   214  222 C P  T >4 S+     0   0   63  534   70                  PPP        P P                                  P P   
   215  223 C D  T 34 S+     0   0  132  572   39                  DDD        D D                                  E D   
   216  224 C E  T 34 S-     0   0   83  609   46                  EEE        E E                                  E E   
   217  225 C G    <<  +     0   0   49  117   85                  GGG        G G                                  G G   
   218  226 C K        -     0   0  124  137   84                  KKK        K K                                  K K   
   219  227 C R        +     0   0   81  180   80                  RRR        R R                                  R R   
   220  228 C G        +     0   0    3  583   68                  GGG        G G                                  G G   
   221  229 C D  B     -A   30   0A  12  624   16                  DDD        D D                                  D D   
   222  230 C A        +     0   0    9  640   48                  AAA        A A                                  A S   
   223  231 C d    >>  -     0   0   13  644    1                  CCC        C C                                  C C   
   224  232 C E  T 34 S+     0   0   95  644   57                  EEE        E E                                  E E   
   225  233 C G  T 34 S+     0   0   20  645    8                  GGG        G G                                  G G   
   226  234 C D  T X4  +     0   0    0  645    0                  DDD        D D                                  D D   
   227  235 C S  T 3< S+     0   0   16  645    6                  SSS        S S                                  S S   
   228  236 C G  T 3  S+     0   0    0  645    1                  GGG        G G                                  G G   
   229  237 C G    <   -     0   0    0  645    4                  GGG        G G                                  G G   
   230  238 C P  E     - H   0 246B   0  645    7                  PPP        P P                                  P P   
   231  239 C F  E     -EH 166 245B   0  644   24                  FFF        F F                                  F L   
   232  240 C V  E     -EH 165 243B   2  643   42                  VVV        V V                                  V V   
   233  241 C M  E     - H   0 242B   0  643   64                  MMM        M M                                  M M   
   234  242 C K  E     - H   0 241B  11  644   80                  KKK        K K                                  K K   
   235  243 C S     >  -     0   0    1  642   84                  SSS        S N                                  N S   
   236  244 C P  T  4 S+     0   0   47  109   82                  PPP        P P                                  P P   
   237  245 C F  T  4 S+     0   0  145  304   83                  FFF        F S                                  Y Y   
   238  246 C N  T  4 S-     0   0   63  501   60                  NNN        N N                                  N N   
   239  247 C N     <  +     0   0   85  373   58                  NNN        N N                                  N N   
   240  248 C R        -     0   0   59  432   80                  RRR        R R                                  R R   
   241  249 C W  E     - H   0 234B   1  442   42                  WWW        W W                                  W W   
   242  250 C Y  E     -cH 147 233B  19  521   85                  YYY        Y Y                                  Y Y   
   243  251 C Q  E     + H   0 232B   0  638   57                  QQQ        Q Q                                  Q Q   
   244  252 C M  E     +     0   0B   0  642   82                  MMM        M M                                  M M   
   245  253 C G  E     -IH 264 231B   0  645    0                  GGG        G G                                  G G   
   246  254 C I  E     -IH 263 230B   0  645   23                  III        I I                                  I I   
   247  255 C V  E     +I  262   0B   5  643   28                  VVV        V V                                  V V   
   248  256 C S  E     -     0   0B   6  644    5                  SSS        S S                                  S S   
   249  257 C W  E     +I  261   0B  35  642   16                  WWA        W W                                  W W   
   250  258 C G        -     0   0   36  645    5                  GGG        G G                                  G G   
   251  259 C E  S    S-     0   0   61  627   89                  EEA        E E                                  E E   
   252  260 C G  S    S-     0   0   21  637   41                  GGG        G G                                  G G   
   253  261 C d  S    S-     0   0   12  642    1                  CCC        C C                                  C C   
   254  262 C D  S    S+     0   0   28  643   37                  DDD        D D                                  D D   
   255  263 C R    >   -     0   0  128  645   82                  RRR        R R                                  R R   
   256  264 C D  T 3  S+     0   0   93  645   73                  DDD        D D                                  D N   
   257  265 C G  T 3  S+     0   0   29  629   69                  GGG          G                                  G G   
   258  266 C K    <   -     0   0   90  639   88                  KKK          K                                  K K   
   259  267 C Y        -     0   0   14  641   48                  YYY          Y                                  Y Y   
   260  268 C G  E     -G  210   0B   3  618   10                  GGG          G                                  G G   
   261  269 C F  E     -GI 209 249B   3  639   18                  FFF          F                                  F F   
   262  270 C Y  E     -GI 208 247B   2  644    4                  YYY          Y                                  Y Y   
   263  271 C T  E     -GI 207 246B   2  644   35                  TTT          T                                  T A   
   264  272 C H  E  >  - I   0 245B  31  644   59                  HHH          H                                  H H   
   265  273 C V  T >4 S+     0   0    0  643   15                  VVV          V                                  V V   
   266  274 C F  G >4 S+     0   0   39  642   74                  FFF          F                                  F F   
   267  275 C R  G 34 S+     0   0  132  642   86                  RRR          R                                  R R   
   268  276 C L  G  S+     0   0   57  641   79                  KKK          K                                  K K   
   270  278 C K  H  > S+     0   0  164  641   65                  KKK          K                                  K R   
   271  279 C W  H  > S+     0   0   37  641    0                  WWW          W                                  W W   
   272  280 C I  H  X S+     0   0    1  641   10                  III          I                                  I I   
   273  281 C Q  H >X S+     0   0   79  605   76                  QQQ          K                                  R Q   
   274  282 C K  H >X S+     0   0  135  595   73                  KKK          K                                  K K   
   275  283 C V  H 3< S+     0   0   15  570   82                  VVV          V                                  M V   
   276  284 C I  H << S+     0   0   49  556   45                  III          I                                  V I   
   277  285 C D  H <<        0   0  114  506   74                  DDD          D                                  D D   
   278  286 C Q     <        0   0  142  322   66                  QQQ          Q                                  R R   
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    7 A A              0   0  126   81   38     A ASSAAA AA AAAAAAAAAA   AAA  A AAA AA       AA                    
     2    8 A D    >   +     0   0   69   86   15     D DDDDDD DD DDDDDDDDDD   DDD  E DDD DD       DD                    
     3    9 A a  T 3   +     0   0   24   96    0     C CCCCCC CC CCCCCCCCCCCCCCCC  C CCC CCCC     CC           C        
     4   10 A G  T 3  S+     0   0    0   96    0     G GGGGGG GG GGGGGGGGGGGGGGGG  G GGG GGGG     GG           G        
     5   11 A L    <   -     0   0   36   96   65     L LLLLLL LL LLLLLLLLTTLLLLLL  L IIL TTLL     LI           L        
     6   12 A R    > > -     0   0    0   96    0     R RRRRRR RR RRRRRRRRRRRRRRRR  R RRR RRRR     RR           R        
     7   13 A P  T 3 5S+     0   0   15   96    0     P PPPPPP PP PPPPPPPPPPPPPPPP  P PPP PPPP     PP           P        
     8   14 A L  T 3 5S+     0   0   34   96    1     L LLLLLL LL LLLLLLLLLLLLLLLL  L LLL LLLL     LL           L        
     9   15 A F  T X >S+     0   0   14   96    0     F FFFFFF FF FFFFFFFFFFFFFFFF  F FFF FFFF     FF           F        
    10   16 A E  G > 5S+     0   0   27   96    0     E EEEEEE EE EEEEEEEEEEEEEEEE  E EEE EEEE     EE           E        
    11   17 A K  G 3 > S+     0   0   41   95   61     T TTTTRT TT TTTTTTTTSSGGGTTS  S TST SSGG     TT           T        
    19   25 A E  H 3> S+     0   0    3   96    0     E EEEEEE EE EEEEEEEEEEEEEEEE  E EEE EEEE     EE           D        
    20   26 A R  H 3> S+     0   0  124   96   65     A GKKHEK KG KHKHADHKKKKKKHHQ  K KKK RRKK     LN           Q        
    21   27 A E  H <> S+     0   0   37   96    4     E EEEEEE EE EEEEEEEEEEEEEEEE  E DEE EEEE     KE           E        
    22   28 A L  H  < S+     0   0    0   96    0     L LLLLLL LL LLLLLLLLLLLLLLLL  L LLL LLLL     LL           L        
    23   29 A L  H >< S+     0   0   40   96   12     F LLLLLL LL LLLLFLLFLLLLLLLL  L LLF LLMM     LL           L        
    24   30 A E  H >< S+     0   0  122   96   34     E EEEEED DE DEDEEDEEEEEEEDDD  E EEE DDEE     DE           D        
    25   31 A S  T 3< S+     0   0   13   96    0     S SSSSSS SS SSSSSSSSSSSSSSSS  S SSS SSSS     SS           S        
    26   32 A Y  T <         0   0   26   96    0     Y YYYYYY YY YYYYYYYYYYYYYYYY  Y YYY YYYY     YY           Y        
    27   33 A I    <         0   0  194   71   23     I IIIIII II IIIIIIIIIIMMMIII  M III   MM     IL           V        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  III I      I  I                II V         V      VIIIIVIIVV VII IVVI
    30   38 B V  B     +A  221   0A  13 2209   20  VVV V      V  V                VV V         V      VVVVVVVVVV VVV VVVV
    31   39 B E  S    S+     0   0  131 2214   31  EEE E      E  K                KK A         K      HHKKHKKKHH GKK KHHN
    32   40 B G        -     0   0   30 2221    1  GGG G      G  G                GG G         G      GGGGGGGGGG GGG GGGG
    33   41 B S  E     -B  184   0B  74 2221   88  QQQ Q      W  R                EE E         E      DHEEHSEENN DEE VDDD
    34   42 B D  E     -B  183   0B  99 2227   62  DDD D      D  E                DN D         D      DNTTNDTTDD DNN DDDE
    35   43 B A        -     0   0    5 2227   45  AAA A      A  A                AA A         A      AVAAVAAAAA AAA AAAA
    36   44 B E    >   -     0   0   41 2228   84  EEE E      E  E                EE E         E      EEEEEDEEEE EEE EEEE
    37   45 B I  T 3  S+     0   0   90 2237   79  VVV V      I  V                VV V         V      VPPPPLPPVV VPP VLLV
    38   46 B G  T 3  S+     0   0   11 2241   60  GGG G      G  G                GG G         G      GGGGGGGGGG GGG GGGG
    39   47 B M  S <  S+     0   0    7 2243   67  LLL L      S  S                SS S         S      STSSTSSSSS SSS SSSS
    40   48 B S  S >  S+     0   0   11 2247   63  SSA A      A  A                AA A         A      SAAAAAAAAS SAA ASSS
    41   49 B P  T 3  S+     0   0    5 2251    4  PPP P      P  P                PP P         P      PPPPPPPPPP PPP PPPP
    42   50 B W  T 3  S+     0   0    2 2253   18  WWW W      W  W                WW W         W      WWWWWWWWWW WWW WWWW
    43   51 B Q  E <   -J   59   0C   2 2256   32  QQQ Q      Q  Q                QQ Q         Q      QQQQQQQQQQ QQQ QQQQ
    44   52 B V  E     -JK  58  91C   0 2257   34  VVV V      V  V                VV V         V      VVVVVVVVVV VVV VVVV
    45   53 B M  E     -JK  57  90C   0 2256   51  MMM M      M  M                MM M         M      MMMMMMMMMM MMM MMMM
    46   54 B L  E     -JK  56  89C   0 2257   14  LLL L      L  L                LL L         L      LLLLLLLLLL LLL LLLL
    47   55 B F  E     -JK  54  88C   0 2256   82  FFF F      F  F                FF F         F      yFffFfffyy yff Fyyy
    48   56 B R  E   > -JK  53  87C  76 1547   74  RRR R      R  R                RR R         R      .R..R..... ... K...
    49   57 B K  T > 5S+     0   0   41  951   80  KKK K      K  K                KK K         K      kQkkQkkkkk kkk Kkkk
    50   58 B S  T 3 5S+     0   0   72 1192   73  SSS S      T  H                SS S         N      SRSSRSSSSS SSS KSSS
    51   59 B P  T 3 5S-     0   0   69 2030   82  PPP P      P  P                PP P         P      PPPPPPPPPP PPP PPPP
    52   60 B Q  T < 5 +     0   0   62 2193   78  QQQ Q      Q  Q                QQ Q         Q     QQQQQQQQQQQ QQQ QQQQ
    53   61 B E  E   < -J   48   0C  77 2221   95  EEE E      E  E                EE E         E     DEEEEEEEEEE EEE EEEE
    54   62 B L  E     +J   47   0C  17 2246   57  LLL L      L  L                LL L         L     LLMLLMLLLLL LLL LLLL
    55   63 B L  E     -     0   0C  17 2261   70  LLL L      L  L                LV L         L     LLLLLLVLLLL LLL VLLL
    56   64 B b  E     -J   46   0C   1 2264    1  CCC C      C  C                CC C         C     CCCCCCCCCCC CCC CCCC
    57   65 B G  E     +J   45   0C   2 2264    3  GGG G      G  G                GG G         G     GGGGGGGGGGG GGG GGGG
    58   66 B A  E     -J   44   0C   0 2264   13  AAA A      A  A                AA A         A     AAAAAAAAAAA AAA AAAA
    59   67 B S  E     -JL  43  67C   0 2264   40  SSS S      S  S                SS S         S     SSSSSSSSSSS SSS SSSS
    60   68 B L  E     + L   0  66C   0 2264   10  LLL L      L  L                LL L         L     LLLLLLLLLLL LLL LLLL
    61   69 B I        -     0   0   23 2264   15  III I      I  L                II I         I     IIILLIILLII ILL IIII
    62   70 B S  S    S-     0   0   32 2264   62  SSS S      S  S                SS S         S     SSSSSSSSSSS SSS SSSS
    63   71 B D  S    S+     0   0   61 2210   68  DDD D      D  D                DD D         D     DDDDDDNDDNN DDD NSSD
    64   72 B R  S    S+     0   0   80 2263   73  RRR R      R  R                RR R         R     RSRRRRRRRSS SRR RNNS
    65   73 B W  E     - M   0 132C  12 2264   12  WWW W      W  W                WW W         W     WWWWWWWWWWW WWW WWWW
    66   74 B V  E     -LM  60 131C   0 2262   11  VVV V      V  I                VI V         I     IVVVVVVVVIV IVV VVVI
    67   75 B L  E     +LM  59 130C   0 2263   23  LLL L      L  L                LL L         L     LLLLLLLLLLL LLL LLLL
    68   76 B T  E     - M   0 129C   0 2263   28  TTT T      T  T                TT T         T     TTTSSTTSTTT TTT TTTT
    69   77 B A    >   -     0   0    0 2262    2  AAA A      A  A                AA A         A     AAAAAAAAAAA AAA AAAA
    70   78 B A  G >> S+     0   0    0 2263    6  AAA A      A  A                AA A         A     AAAAAAAAAAA AAA AAAA
    71   79 B H  G 34 S+     0   0   10 2264    3  HHH H      H  H                HH H         H     HHHHHHHHHHH HHH HHHH
    72   80 B b  G <4 S+     0   0    0 2264    1  CCC C      C  C                CC C         C     CCCCCCCCCCC CCC CCCC
    73   81 B L  T <4 S+     0   0    1 2264   68  LLL L      I  L                LL L         L     ILIIIIIIILL LII ILLL
    74   82 B L  E  <  +P   81   0D  46 2264   89  LLL L      L  L                FF L         F     FYFFFFFFFLL FFF FFFF
    75   83 B Y  E > > -P   80   0D  49 2249   82  YYY Y      Y  Y                YY Y         Y     YYYYYYYYYYY YYY YYYY
    76   84 B P  G > 5S+     0   0   52 2249   88  PPP P      P  P                PP P         P     PPPPPPPPPPP PPP PPPP
    77   85 B P  G 3 5S+     0   0   75  844   90  PPP P      P  P                PP P         P     PPPPPPPPPPP PPP PPPP
    78   86 B W  G < 5S-     0   0  166  852   93  WWW W      W  W                WW W         W     WWWWWWWWWWW WWW WWWW
    79   87 B D  T < 5 +     0   0  152  869   93  DDD D      D  D                DD D         D     DDDDDDDDDDE DDD DDDD
    80   88 B K  E   < +P   75   0D  51  904   83  KKK K      K  K                KK K         K     KKKKKKKKKKK KKK KKKK
    81   89 B N  E     +P   74   0D 110  936   80  NNN S      N  N                NN N         N     NNNNNNNNNNN NNN NNNN
    82   90 B F        -     0   0   28 1017   94  FFF F      Y  F                FF F         F     FLYYYYFYYLL LYY YLLL
    83   91 B T    >>  -     0   0   70 1164   86  TTT T      T  T                TT T         T     TTTTTTTTTTT STT TTTS
    84   92 B E  G >4 S+     0   0   35 1455   85  VVE E      V  E                TT T         T     ATVTTVTTTTT TTT TTTT
    85   93 B N  G 34 S+     0   0  127 1677   87  DDA A      N  N                DD D         D     DNQDDQDDDNN SDD DDDS
    86   94 B D  G <4 S+     0   0   49 1292   82  DDD D      D  E                DD D         D     DDDDDDDDDDD DDD DDDD
    87   95 B L  E <<  +K   48   0C   0 1493   89  LLL L      L  L                II I         L     LILIILLIIII III LIII
    88   96 B L  E     -KN  47 108C   3 2025   51  LLL L      L  L                LL L         L     VLLLLLLLLLL LLL LLLL
    89   97 B V  E     -KN  46 107C   0 1516   29  VVV V      V  V                VV V         V     VVVVVVVVVVV VVV VVVV
    90   98 B R  E     -KN  45 106C   0 1577   87  RRR R      R  R                RR R         R     RRRRRRRRRRR RRR RRRR
    91   99 B I  E     +KN  44 105C   0 1674   49  III I      I  I                II I         I     IIIIIIIIIII III IIII
    92  100 B G  S    S+     0   0    7 1756   23  GGG G      G  G                GG G         G     GGGGGGGGGGG GGG GGGG
    93  101 B K        +     0   0   13 1789   76  KKK K      K  K                KK K         K     KKKKKKKKKKK KKK KKKK
    94  102 B H        +     0   0   36 1883   76  HHH H      H  H                HH H         H     HHHHHHHHHHH HHH HHHH
    95  103 B S  B     -Q  181   0E  21 1965   75  SSS S      S  S                QE Q         Y     NFQFFQNFYFF VYY NFFI
    96  104 B R  S    S+     0   0   16 2018   82  RRR R      R  R                RR R         R     RRRRRRRRRRR RRR RRRR
    97  105 B T  S    S+     0   0   31 2112   87  TTT T      S  N                AT T         A     RAATTAKTTAA ATT IAAA
    98  106 B R  S    S-     0   0   85 2151   87  RRR R      R  R                KK K         K     IKKKKKKKKKK KKK RKKK
    99  107 B Y        -     0   0   21 2204   90  YYY Y      Y  Y                YY Y         Y     HYYYYYYYYYY YYY YYYY
   100  108 B E    >>  -     0   0   22 2250   66  EEE E      E  E                EE E         E     EEEEEEEEEEE EEE EEEE
   101  109 B R  T 34 S+     0   0  143 2252   78  RRR R      R  R                RR K         R     KKRRRRIRRRK KRR QKKK
   102  110 B N  T 34 S+     0   0  133 2255   82  KKK K      N  N                NH N         N     TNPAAPKAANN NTA GNNN
   103  111 B I  T <4 S+     0   0   58 2257   77  VVV V      M  I                II I         Q     RKITTIMTTKK KTT KKKK
   104  112 B E     <  -     0   0    0 2258   77  EEE E      E  E                EE E         E     EEEEEEEEEEE EEE EEEE
   105  113 B K  E     -N   91   0C  69 2257   91  KKK K      K  K                KK K         K     KKKRRKKRRKK KRR KKKK
   106  114 B I  E     -N   90   0C  11 2259   71  III I      I  I                II I         I     IIIIIIIIIII III IIII
   107  115 B S  E     -N   89   0C  12 2260   84  SSS S      S  A                AS A         V     AAAAAAVAAVV AAA IAAA
   108  116 B M  E     -N   88   0C  58 2260   71  MMM M      L  M                LM L         L     LLKQQKLQLLL LQQ FLLL
   109  117 B L  E     +O  133   0C   6  452   51  LLL L      L  L                LL L         L     LLLLLLLLLLL LLL LLLL
   110  118 B E  E    S+     0   0C  92 1908   74  DDD D      E  E                DD D         D     DDEEEEDEEDD DEE DDDD
   111  119 B K  E     -O  132   0C  92 2029   65  KKK K      K  K                KK K         K     KKKRRKKRRKK KRR KKKK
   112  120 B I  E     -O  131   0C  20 2160   45  III I      I  I                II I         I     IIVIIVIIIVI III IIII
   113  121 B Y  E     -O  130   0C  66 2224   50  YYY Y      H  Y                II I         I     IIIIIIIIIII III IIII
   114  122 B I  E     -O  129   0C  52 2228   82  III I      I  I                II I         I     IIIVVIIVVII IVV FLLI
   115  123 B H    >   -     0   0   25 2247   20  HHH H      H  H                HH H         H     HHHHHHHHHHH HHH HHHH
   116  124 B P  T 3  S+     0   0  106 2258   50  PPP P      P  P                PP P         P     PPPPPPPPPPP PPP PPPP
   117  125 B R  T 3  S+     0   0  162 2261   76  RRR R      R  R                KK K         R     KKKKKKKKKKK KKK KKKK
   118  126 B Y    <   -     0   0   15 2261   15  YYY Y      Y  Y                YY Y         Y     YYYYYYYYYYY YYY YYYY
   119  127 B N  B > > +R  125   0F  41 2262   68  NNN N      N  N                NN N         N     NNNNNNNNNNN NNN NNNN
   120  128 B W  T 3 5 +     0   0   62 1485   76  WWW W      W  W                WW W         W     WWWWWWWWWWW WWW WWWW
   121  129 B R  T 3 5S+     0   0  192 1311   77  KKK K      R  R                KR R         K     KKKKKKKKKKK KKK MKKK
   122  130 B E  T < 5S-     0   0  101 1657   80  EEE E      E  E                EE E         D     EEEEEEEEEEE EEE EEEE
   123  131 B N  T   5S-     0   0    4 2142   69  NNN N      N  N                NN N         N     NNNNNNNNNNN NNN NNNN
   124  132 B L    > < +     0   0   25 1817   69  LLL L      L  L                LL L         L     LMLLLLLLLMM MLL LMMM
   125  133 B D  B 3   +R  119   0F   7 2115   65  DDD D      D  D                DD D         D     DDDDDDDDDDD DDD DDDD
   126  134 B R  T 3  S-     0   0   43 2196   57  RRR R      R  R                RR R         R     RRRRRRRRRRR RRR RRRR
   127  135 B D    <   +     0   0    0 2261    0  DDD D      D  D                DD D         D     DDDDDDDDDDD DDD DDDD
   128  136 B I        +     0   0    0 2264   11  III I      I  I                II I         I     IIIIIIIIIII III IIII
   129  137 B A  E     -MO  68 114C   0 2263   48  AAA A      A  A                AA A         A     AAAAAAAAAAA AAA AAAA
   130  138 B L  E     -MO  67 113C   0 2264    6  LLL L      L  L                LL L         L     LLLLLLLLLLL LLL LLLL
   131  139 B M  E     -MO  66 112C   0 2264   30  LLL L      L  L                MI L         M     LMLIILLIILL MII LLLM
   132  140 B K  E     -MO  65 111C  19 2264   49  KKK K      K  K                LL L         H     RHKQQKRQQHH HQQ RHHH
   133  141 B L  E     - O   0 109C   0 2264    8  LLL L      L  L                LL L         L     LLLLLLLLLLL LLL LLLL
   134  142 B K  S    S+     0   0  111 2264   73  KKK K      K  K                KK K         K     RKKKKKKKKKK KKK SKKK
   135  143 B K  S    S-     0   0  171 2264   76  RRR R      R  N                KK K         K     KRNRRNKRRRR RRR KRRR
   136  144 B P        -     0   0   73 2264   40  PPP P      P  P                PP P         P     PPPPPPPPPPP PPP PPPP
   137  145 B V        -     0   0   11 2220   48  III I      V  I                II I         V     VVIVVIVVVVV IVV VIII
   138  146 B A        -     0   0   75 2253   81  EEE E      S  T                VV V         T     PITAATAAAII SAA PAAS
   139  147 B F        +     0   0   87 2257   43  LLF F      F  F                LF F         F     FFFFFFFFFFF FLL FFFF
   140  148 B S        -     0   0   40 2259   60  SSS S      S  S                SS S         S     SSSSSSSSSSS SSS SSSS
   141  149 B D  S    S+     0   0   81 2262   69  DDE E      D  D                DD D         N     DDDNNDDNNDD DNN DDDD
   142  150 B Y  S    S+     0   0   81 2252   87  YYY Y      Y  R                YR R         F     YYYYYYFYYYY YYY YYYY
   143  151 B I        +     0   0    0 2256   24  III I      I  I                II I         I     IIIIIIIIIII III IIII
   144  152 B H        -     0   0    4 2256   79  HHH H      H  H                HH H         H     QHHHHHLHHHH HHH HHHH
   145  153 B P        -     0   0    9 2256   44  PPP P      P  P                PP P         P     PPPPPPPPPPP PPP PPPP
   146  154 B V        -     0   0    1 2260   37  VVV V      V  V                VV V         I     VVIVVIVVVVV VVV IVVV
   147  155 B a  B     -c  242   0B   3 2260   46  CCC C      C  C                CC C         C     CCCCCCCCCCC CCC CCCC
   148  156 B L        -     0   0   32 2260    9  LLL L      L  L                LL L         L     LLLLLLLLLLL LLL LLLL
   149  157 B P        -     0   0    0 2259   30  PPP P      P  P                PP P         P     PPPPPPPPPPP PPP PPPP
   150  158 B D     >  -     0   0   51 2255   78  DDD D      D  D                TT T         T     TTSTTSTTTTT TTT TTTT
   151  159 B R  H  > S+     0   0  148 1806   76  KKK K      K  K                KR R         K     K.KKKK.KK.. .KK K...
   152  160 B E  H  > S+     0   0  122 1873   75  QQE E      Q  E                EE E         E     EKEDDEKDDKK KDD QKKK
   153  161 B T  H  > S+     0   0   10 2003   82  TTT T      T  T                LL L         I     TEMTTMETIEE EAA VEEE
   154  162 B A  H  X S+     0   0    7 2020   84  AAA A      V  A                VV V         V     VVVVVVIVVLL VVV VVVV
   155  163 B A  H  < S+     0   0   70 2078   68  AAA A      L  V                QQ Q         Q     QVQVVQVVVVV VVV QVVV
   156  164 B S  H  < S+     0   0   36 2215   78  KKK K      R  R                SS S         R     SqKKKKqKKqq qKK Sqqk
   157  165 B L  H  < S+     0   0    1  515   98  LLL L      L  L                LL L         L     LlLLLLlLLll lLL Llll
   158  166 B L     <  +     0   0   34  711   82  LLL L      L  L                MM M         M     LMFLLFLLLMM MLL LMMM
   159  167 B Q  S >  S-     0   0   87  836   93  HHR R      Q  V                LL L         L     LLLAALLASLL LAA LLLL
   160  168 B A  T 3  S+     0   0   51 2039   74  AAV V      V  S                TT S         E     TASAASTAAAA AAA TAAA
   161  169 B G  T 3  S+     0   0   42 1713   37  GGG G      G  G                GG G         G     GGGGGGGGGGG GGG GGGG
   162  170 B Y    <   -     0   0   46 1826   85  FFF F      H  Y                FF F         Y     YYHYYHYYYFF YYY YYYY
   163  171 B K  E     -D  188   0B  33 2112   87  KKK K      K  K                KK K         K     KKKKKKKKKKK KKK KKKK
   164  172 B G  E     -D  187   0B   0 2154   45  GGG G      G  G                GG G         G     GGGGGGGGGGG GGG GGGG
   165  173 B R  E     -DE 186 232B   3 2164   80  RRR R      R  R                RR R         R     RRRRRRRRRRR RRR RRRR
   166  174 B V  E     -DE 185 231B   0 2189   33  VVV V      V  V                VV V         V     VVVVVVVVVVV VVV VVVV
   167  175 B T  E     +D  184   0B   0 2202   48  TTT T      T  T                SS S         S     TTTTTTTTTTT TTT TTTT
   168  176 B G  E     -D  183   0B   1 2202    0  GGG G      G  G                GG G         G     GGGGGGGGGGG GGG GGGG
   169  177 B W  S    S+     0   0    1 2202    1  WWW W      W  W                WW W         W     WWWWWWWWWWW WWW WWWW
   170  178 B G  S    S-     0   0    0 2198    1  GGG G      G  G                GG G         G     GGGGGGGGGGG GGG GGGG
   171  179 B N        -     0   0   33 2021   77  NNN N      N  N                NN N         N     NNNNNNNNNNN NNN NNNN
   172  180 B L  S    S+     0   0   55 1822   62  RRR R      L  L                LL L         L     LLLLLLLLLLL LLL LLLL
   173  181 B K  S    S-     0   0  147 1551   78  RRR R      R  K                 Y Y         F     FKKQQK QQKK KQQ FKKK
   174  182 B E              0   0   49 1397   62  EEE E      E  E                 E E         E     EEEEEE EEEE EEE DEEE
   175  183 B T              0   0  181 1202   57  TTT T         T                 T T         T     TTTTTT TTTT TTT TTTT
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                                                 S                      
   178  186 C Q        -     0   0   64  328   73                                                 Q                      
   179  187 C P        -     0   0    8  503   39                                        P    P PPP                 P    
   180  188 C S  S    S+     0   0   81  526   81                                        S    E TTT                 Q    
   181  189 C V  B    S-Q   95   0E  21  534   82                                        V    I YVV                 V    
   182  190 C L        -     0   0    5  625    5                                        L    M LLL                 L    
   183  191 C Q  E     -BD  34 168B   9  629   50                                        Q    Q QQQ                 Q    
   184  192 C V  E     +BD  33 167B   6  628   86                                        E    K LQQ                 Q    
   185  193 C V  E     - D   0 166B  15  634   49                                        V    I VII                 V    
   186  194 C N  E     + D   0 165B   7  634   77                                        N    S NHH                 N    
   187  195 C L  E     - D   0 164B   0  638   34                                        L    L LLL                 L    
   188  196 C P  E     - D   0 163B  12  639   46                                        P    P PPP                 P    
   189  197 C I  E     -F  210   0B   9  640   33                                        I    I III                 I    
   190  198 C V  E     -F  209   0B  10  641   39                                        V    V VVV                 V    
   191  199 C E    >>  -     0   0   75  641   66                                        S    E DEE                 D    
   192  200 C R  H 3> S+     0   0   86  640   78                                        R    Q RQQ                 Q    
   193  201 C P  H 3> S+     0   0   77  641   74                                        D    N DDD                 E    
   194  202 C V  H <4 S+     0   0   41  641   84                                        I    L TII                 T    
   195  203 C c  H >< S+     0   0    5  645    1                                        C    C CCC                 C    
   196  204 C K  H >< S+     0   0   91  645   74                                        K    R KRR                 K    
   197  205 C D  T 3< S+     0   0  141  645   80                                        A    A ADD                 A    
   198  206 C S  T <  S+     0   0   15  645   87                                        S    S SSS                 S    
   199  207 C T    <   -     0   0   25  645   71                                        T    T TTT                 T    
   200  208 C R  S    S+     0   0  249  645   89                                        K    r ksS                 k    
   201  209 C I  S    S-     0   0   56  565   53                                        I    . ..I                 .    
   202  210 C R        -     0   0  123  556   82                                        K    k krR                 k    
   203  211 C I        -     0   0   12  633   24                                        V    I III                 V    
   204  212 C T    >   -     0   0   12  638   73                                        T    T TTT                 T    
   205  213 C D  T 3  S+     0   0   82  642   69                                        D    D DDD                 S    
   206  214 C N  T 3  S+     0   0   11  645   72                                        N    N NNN                 N    
   207  215 C M  E <   - G   0 263B   9  637   30                                        M    M MMM                 M    
   208  216 C F  E     - G   0 262B  19  643   34                                        F    F FFF                 F    
   209  217 C c  E     -FG 190 261B   0  643    1                                        C    C CCC                 C    
   210  218 C A  E     +FG 189 260B   0  643   10                                        A    A AAA                 A    
   211  219 C G        -     0   0    4  643   18                                        G    G GGG                 G    
   212  220 C Y        -     0   0   31  452   71                                        Y    Y YFF                 Y    
   213  221 C K     >  -     0   0   67  484   87                                        S    P SKK                 K    
   214  222 C P  T >4 S+     0   0   63  534   70                                        P    P PPP                 P    
   215  223 C D  T 34 S+     0   0  132  572   39                                        A    N EEE                 D    
   216  224 C E  T 34 S-     0   0   83  609   46                                        E    V DEE                 E    
   217  225 C G    <<  +     0   0   49  117   85                                        S    E SQQ                 P    
   218  226 C K        -     0   0  124  137   84                                        K    E KKK                 N    
   219  227 C R        +     0   0   81  180   80                                        R    R RTT                 R    
   220  228 C G        +     0   0    3  583   68                                        G    G GGG                 G    
   221  229 C D  B     -A   30   0A  12  624   16                                        D    D DDD                 D    
   222  230 C A        +     0   0    9  640   48                                        A    S AAA                 A    
   223  231 C d    >>  -     0   0   13  644    1                                        C    C CCY                 C    
   224  232 C E  T 34 S+     0   0   95  644   57                                        E    E EEE                 E    
   225  233 C G  T 34 S+     0   0   20  645    8                                        G    G GGG                 G    
   226  234 C D  T X4  +     0   0    0  645    0                                        D    D DDD                 D    
   227  235 C S  T 3< S+     0   0   16  645    6                                        S    S SSS                 S    
   228  236 C G  T 3  S+     0   0    0  645    1                                        G    G GGG                 G    
   229  237 C G    <   -     0   0    0  645    4                                        G    G GGG                 G    
   230  238 C P  E     - H   0 246B   0  645    7                                        P    P PPP                 P    
   231  239 C F  E     -EH 166 245B   0  644   24                                        F    F FFF                 F    
   232  240 C V  E     -EH 165 243B   2  643   42                                        V    V VVV                 V    
   233  241 C M  E     - H   0 242B   0  643   64                                        M    M MMM                 M    
   234  242 C K  E     - H   0 241B  11  644   80                                        K    K KKK                 K    
   235  243 C S     >  -     0   0    1  642   84                                        .    N NSN                 S    
   236  244 C P  T  4 S+     0   0   47  109   82                                        .    P PPP                 P    
   237  245 C F  T  4 S+     0   0  145  304   83                                        G    F QDD                 D    
   238  246 C N  T  4 S-     0   0   63  501   60                                        P    D DDD                 D    
   239  247 C N     <  +     0   0   85  373   58                                        K    K NNN                 N    
   240  248 C R        -     0   0   59  432   80                                        R    R RRR                 R    
   241  249 C W  E     - H   0 234B   1  442   42                                        W    W WWW                 W    
   242  250 C Y  E     -cH 147 233B  19  521   85                                        Y    Y YYY                 Y    
   243  251 C Q  E     + H   0 232B   0  638   57                                        Q    Q QQQ                 Q    
   244  252 C M  E     +     0   0B   0  642   82                                        V    M VII                 V    
   245  253 C G  E     -IH 264 231B   0  645    0                                        G    G GGG                 G    
   246  254 C I  E     -IH 263 230B   0  645   23                                        I    I III                 I    
   247  255 C V  E     +I  262   0B   5  643   28                                        V    V VVV                 V    
   248  256 C S  E     -     0   0B   6  644    5                                        S    S SSS                 S    
   249  257 C W  E     +I  261   0B  35  642   16                                        W    W WWW                 W    
   250  258 C G        -     0   0   36  645    5                                        G    G GGG                 G    
   251  259 C E  S    S-     0   0   61  627   89                                        E    E EEE                 E    
   252  260 C G  S    S-     0   0   21  637   41                                        G    G GGG                 G    
   253  261 C d  S    S-     0   0   12  642    1                                        C    C CCC                 C    
   254  262 C D  S    S+     0   0   28  643   37                                        D    D DDD                 D    
   255  263 C R    >   -     0   0  128  645   82                                        R    R RRR                 R    
   256  264 C D  T 3  S+     0   0   93  645   73                                        D    D DDD                 D    
   257  265 C G  T 3  S+     0   0   29  629   69                                        G    G GGG                 G    
   258  266 C K    <   -     0   0   90  639   88                                        K    K KKK                 K    
   259  267 C Y        -     0   0   14  641   48                                        Y    Y YYY                 Y    
   260  268 C G  E     -G  210   0B   3  618   10                                        G    G GGG                 G    
   261  269 C F  E     -GI 209 249B   3  639   18                                        F    F FFF                 F    
   262  270 C Y  E     -GI 208 247B   2  644    4                                        Y    Y YYY                 Y    
   263  271 C T  E     -GI 207 246B   2  644   35                                        T    T TTT                 T    
   264  272 C H  E  >  - I   0 245B  31  644   59                                        H    H HHH                 H    
   265  273 C V  T >4 S+     0   0    0  643   15                                        L    V VLL                 L    
   266  274 C F  G >4 S+     0   0   39  642   74                                        F    F FFF                 H    
   267  275 C R  G 34 S+     0   0  132  642   86                                        R    R RRR                 R    
   268  276 C L  G  S+     0   0   57  641   79                                        K    K KRR                 R    
   270  278 C K  H  > S+     0   0  164  641   65                                        K    K KRR                 Q    
   271  279 C W  H  > S+     0   0   37  641    0                                        W    W WWW                 W    
   272  280 C I  H  X S+     0   0    1  641   10                                        M    I LMM                 M    
   273  281 C Q  H >X S+     0   0   79  605   76                                        Q    Q KKK                 M    
   274  282 C K  H >X S+     0   0  135  595   73                                        K    K KKK                 K    
   275  283 C V  H 3< S+     0   0   15  570   82                                        T    A TVV                 I    
   276  284 C I  H << S+     0   0   49  556   45                                        I    I VII                 I    
   277  285 C D  H <<        0   0  114  506   74                                        E    D EDD                 E    
   278  286 C Q     <        0   0  142  322   66                                        K    K KKK                 K    
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    7 A A              0   0  126   81   38    NNTT AAANDTN         A         S S  E   A  A AAA          ADDDDD    
     2    8 A D    >   +     0   0   69   86   15    GGDD DDGDDDDD D   DEDD         S N  E   D  D DDD          DEEEEE    
     3    9 A a  T 3   +     0   0   24   96    0  C CCCC CCCCCCCC C   CCCCCCC      C C  C   C  C CCC          CCCCCC    
     4   10 A G  T 3  S+     0   0    0   96    0  G GGGG GGGGGGGG G   GGGGGGG      G G  G   G  G GGG          GGGGGG    
     5   11 A L    <   -     0   0   36   96   65  Q LLII IVLQQIQE E   EVETEEE      L L  V   T  T III          IRRRRR    
     6   12 A R    > > -     0   0    0   96    0  R RRRR RRRRRRRR R   RRRRRRR      R R  R   R  R RRR          RRRRRR    
     7   13 A P  T 3 5S+     0   0   15   96    0  P PPPP PPPPPPPP P   PPPPPPP      P P  P   P  P PPP          PPPPPP    
     8   14 A L  T 3 5S+     0   0   34   96    1  L LLLL LLLLLLLL L   LLLLLLL      L L  L   L  L MMM          LLLLLL    
     9   15 A F  T X >S+     0   0   14   96    0  F FFFF FFFFFFFF F   FFFFFFF      F F  F   F  F FFF          FFFFFF    
    10   16 A E  G > 5S+     0   0   27   96    0  E EEEE EEEEEEEE E   EEEEEEE      E E  E   E  E EEE          EEEEEE    
    11   17 A K  G 3 > S+     0   0   41   95   61  N GGSX TSKKKSKN N   NNNSNNK      K K  T   S  S TTT          DSSSSS    
    19   25 A E  H 3> S+     0   0    3   96    0  E EEEE EEEEEEEE E   EEEEEEE      E E  E   E  E EEE          EEEEEE    
    20   26 A R  H 3> S+     0   0  124   96   65  N KKQR NQQDAQDK K   KKKKAAA      Q Q  V   K  K KKK          KDDDDD    
    21   27 A E  H <> S+     0   0   37   96    4  E EEEE EEEEEEEE E   EEEEEEE      E E  E   E  E EEE          HEEEEE    
    22   28 A L  H  < S+     0   0    0   96    0  L LLLL LLLLLLLL L   LLLLLLL      L L  L   L  L LLL          LLLLLL    
    23   29 A L  H >< S+     0   0   40   96   12  L LLLL LLLLLLLL L   LLLLLLL      L L  L   M  M TTT          LLLLLL    
    24   30 A E  H >< S+     0   0  122   96   34  E EEDD EDDEEDEM M   MAMDEEE      D E  K   D  D EEE          NQQQQQ    
    25   31 A S  T 3< S+     0   0   13   96    0  S SSSS SSSSSSSS S   SSSSSSS      S S  S   S  S SSS          SSSSSS    
    26   32 A Y  T <         0   0   26   96    0  Y YYYY YYYYYYYY Y   YYYYYYY      Y Y  Y   Y  Y YYY          YYYYYY    
    27   33 A I    <         0   0  194   71   23    IIIF L               M                  M  M III          L         
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10        V        I III        I  II I II III II       IIIIII V          
    30   38 B V  B     +A  221   0A  13 2209   20        V        V VVV        V  VV V VV VVV VV       VVVVVV V          
    31   39 B E  S    S+     0   0  131 2214   31        H        G GGG        G  GG G GG KGG GK       GGGGGG K          
    32   40 B G        -     0   0   30 2221    1        G        G GGG        G  GG G GG GGG GG       GGGGGG G          
    33   41 B S  E     -B  184   0B  74 2221   88        N        D EED        D  ED D DD LDV DI       DDDDDD Q          
    34   42 B D  E     -B  183   0B  99 2227   62        D        E DDE        E  EE D DD DDS ED       EEEEEE N          
    35   43 B A        -     0   0    5 2227   45        A        A AAA        A  AA A AA AAA AA       AAAAAA A          
    36   44 B E    >   -     0   0   41 2228   84        E        E QQE        E  EE E EE EDE EE       EEEEEE E          
    37   45 B I  T 3  S+     0   0   90 2237   79        V        V VVV        V  VV V VV VVV VV       VVVVVV P          
    38   46 B G  T 3  S+     0   0   11 2241   60        G        A GGA        A  GA A GA AAG AA       AAAAAA G          
    39   47 B M  S <  S+     0   0    7 2243   67        S        S SSS        S  SS S SS SSS SS       SSSSSS S          
    40   48 B S  S >  S+     0   0   11 2247   63        A        A SSA        A  AA A AA AAA AA       AAAAAA A          
    41   49 B P  T 3  S+     0   0    5 2251    4        P        P PPP        P  PP P PP PPP PP       PPPPPP P          
    42   50 B W  T 3  S+     0   0    2 2253   18        W        W WWW        W  WW W WW WWW WW       WWWWWW W          
    43   51 B Q  E <   -J   59   0C   2 2256   32        Q        Q QQQ        Q  QQ Q QQ QQQ QQ       QQQQQQQQ          
    44   52 B V  E     -JK  58  91C   0 2257   34        V        V VVV        V  VV V VV VVV VV       VVVVVVVV          
    45   53 B M  E     -JK  57  90C   0 2256   51        M        M MMM        M  MM M MM MMM MM       MMMMMMMM          
    46   54 B L  E     -JK  56  89C   0 2257   14        L        L LLL        L  LL L LL LLL LL       LLLLLLLL          
    47   55 B F  E     -JK  54  88C   0 2256   82        y        y ffy        y  Yy y yy yyf yy       yyyyyyYF          
    48   56 B R  E   > -JK  53  87C  76 1547   74        .        r ..r        r  Kr r rr rrr r.       rrrrrrKK          
    49   57 B K  T > 5S+     0   0   41  951   80        k        . kk.        .  R. . .. ... .k       ......RK          
    50   58 B S  T 3 5S+     0   0   72 1192   73        S        S SSS        S  SS S SS SNS SS       SSSSSSNS          
    51   59 B P  T 3 5S-     0   0   69 2030   82        P        P PPP        P  PP P PP PPP PP       PPPPPPPP          
    52   60 B Q  T < 5 +     0   0   62 2193   78   Q    Q        Q QQQ        QQQQQ Q QQ QQQ QQ       QQQQQQQQ          
    53   61 B E  E   < -J   48   0C  77 2221   95   E    E        E EEE        EEEEE E EE EEE EE       EEEEEEEE          
    54   62 B L  E     +J   47   0C  17 2246   57   L    L        L LLL        LLLLL L LL LLL LL       LLLLLLFL          
    55   63 B L  E     -     0   0C  17 2261   70   I    L        L LLL        LLLLL L LL LLL LL       LLLLLLLL          
    56   64 B b  E     -J   46   0C   1 2264    1   C    C        C CCC        CCCCC C CC CCC CC       CCCCCCCC          
    57   65 B G  E     +J   45   0C   2 2264    3   G    G        G GGG        GGGGG G GG GGG GG       GGGGGGGG          
    58   66 B A  E     -J   44   0C   0 2264   13   A    A        A AAA        AAAAA A AA AAA AA       AAAAAAAA          
    59   67 B S  E     -JL  43  67C   0 2264   40   S    S        S SSS        SSSSS S SS SSS SS       SSSSSSSS          
    60   68 B L  E     + L   0  66C   0 2264   10   I    L        L LLL        LLLLL L LL LLL LL       LLLLLLLL          
    61   69 B I        -     0   0   23 2264   15   I    I        I III        IIIII I II III II       IIIIIIIL          
    62   70 B S  S    S-     0   0   32 2264   62   S    S        S SSS        SSSSS S SS SSS SS       SSSSSSSS          
    63   71 B D  S    S+     0   0   61 2210   68   D    N        D DDD        DDDED D DD DDN DD       NNNNNNDD          
    64   72 B R  S    S+     0   0   80 2263   73   R    S        E EEE        EQEEE E QE EQE EE       EEEEEEQR          
    65   73 B W  E     - M   0 132C  12 2264   12   W    W        W WWW        WWWWW W WW WWW WW       WWWWWWWW          
    66   74 B V  E     -LM  60 131C   0 2262   11   V    I        I VVI        IIIII V IV III II       VVVVVVIV          
    67   75 B L  E     +LM  59 130C   0 2263   23   L    L        L LLL        LLLLL L LL LLL LL       LLLLLLLL          
    68   76 B T  E     - M   0 129C   0 2263   28   T    T        T TTT        TTTTT T TT TTT TT       TTTTTTTT          
    69   77 B A    >   -     0   0    0 2262    2   A    A        A AAA        AAAAA A AA AAA AA       AAAAAAAA          
    70   78 B A  G >> S+     0   0    0 2263    6   A    A        A AAA        AAAAA A AA AAA AA       AAAAAAAA          
    71   79 B H  G 34 S+     0   0   10 2264    3   H    H        H HHH        HHHHH H HH HHH HH       HHHHHHHH          
    72   80 B b  G <4 S+     0   0    0 2264    1   C    C        C CCC        CCCCC C CC CCC CC       CCCCCCCC          
    73   81 B L  T <4 S+     0   0    1 2264   68   I    L        I LLI        IIIII I II III VI       IIIIIIII          
    74   82 B L  E  <  +P   81   0D  46 2264   89   F    L        L LLL        LLLFF L LL LLL LL       LLLLLLLY          
    75   83 B Y  E > > -P   80   0D  49 2249   82   Y    Y        Y YYY        YYYYY Y YY YYY YY       YYYYYYYY          
    76   84 B P  G > 5S+     0   0   52 2249   88   P    P        P PPP        PPPPP P PP PPP PP       PPPPPPPP          
    77   85 B P  G 3 5S+     0   0   75  844   90   P    P        P PPP        PPPPP P PP PPP PP       PPPPPPPP          
    78   86 B W  G < 5S-     0   0  166  852   93   W    W        W WWW        WWWWW W WW WWW WW       WWWWWWWW          
    79   87 B D  T < 5 +     0   0  152  869   93   D    D        N DDN        NNNNN N NN NNN NN       NNNNNNND          
    80   88 B K  E   < +P   75   0D  51  904   83   K    K        K KKK        KKKKK K KK KKK KK       KKKKKKRK          
    81   89 B N  E     +P   74   0D 110  936   80   N    N        N NNN        NNNNN N NN NNN NN       NNNNNNNN          
    82   90 B F        -     0   0   28 1017   94   Y    L        F FFF        FFFFF F FF FFF YF       FFFFFFLF          
    83   91 B T    >>  -     0   0   70 1164   86   T    T        T TTT        TTTTT S TS TTT TT       SSSSSSTT          
    84   92 B E  G >4 S+     0   0   35 1455   85   T    T        I SSI        IAIII A IA ITI VI       AAAAAAVT          
    85   93 B N  G 34 S+     0   0  127 1677   87   E    N        N SSN        NNNDN S NS NND DN       SSSSSSND          
    86   94 B D  G <4 S+     0   0   49 1292   82   D    D        D DDD        DDDDD D DD DDD DD       DDDDDDDD          
    87   95 B L  E <<  +K   48   0C   0 1493   89   I    I        I III        IIIII I II III II       IIIIIIII          
    88   96 B L  E     -KN  47 108C   3 2025   51   L    L        I LLI        ILLII L LL LLL LL       LLLLLLLL          
    89   97 B V  E     -KN  46 107C   0 1516   29   V    V        V VVV        VVVVV V VV VVV VV       VVVVVVV.          
    90   98 B R  E     -KN  45 106C   0 1577   87   R    R        R RRR        RRRRR R RR RRR RR       RRRRRRR.          
    91   99 B I  E     +KN  44 105C   0 1674   49   I    M        L VVL        LVLLL L LL LLL LL       LLLLLLL.          
    92  100 B G  S    S+     0   0    7 1756   23   G    G        G GGG        GGGGG G GG GGG GG       GGGGGGG.          
    93  101 B K        +     0   0   13 1789   76   K    L        K KKK        KKKKK K KK KKK KK       KKKKKKK.          
    94  102 B H        +     0   0   36 1883   76   H    H        H HHH        HHHHH H HH HHH HH       HHHHHHH.          
    95  103 B S  B     -Q  181   0E  21 1965   75   Y    F        S SSS        SYNSS N NN NNN NN       NNNNNNRV          
    96  104 B R  S    S+     0   0   16 2018   82   R    R        R RRR        RRRRR R RR RRR RR       RRRRRRSR          
    97  105 B T  S    S+     0   0   31 2112   87   T    A        T AAT        TAATI A AA AAA AA       AAAAAANI          
    98  106 B R  S    S-     0   0   85 2151   87   K    K        K RRK        KKKKK K QK KKK KK       KKKKKKMG          
    99  107 B Y        -     0   0   21 2204   90   Y    Y        Y YYY        YFFYY F FF FFY FF       FFFFFFFK          
   100  108 B E    >>  -     0   0   22 2250   66   E    E        E EEE        EEEEE E EE EEE EE       EEEEEEEH          
   101  109 B R  T 34 S+     0   0  143 2252   78   R    R        R MMR        RKKRR R RR RRR RK       QQQQQQRY          
   102  110 B N  T 34 S+     0   0  133 2255   82   Q    N        G DDG        GQGGG G NG GNG GG       GGGGGGNR          
   103  111 B I  T <4 S+     0   0   58 2257   77   Q    K        I AAI        ITTTT I II ITT IT       IIIIIIIT          
   104  112 B E     <  -     0   0    0 2258   77   E    E        E EEE        EEEEE E EE EEE EE       EEEEEEEK          
   105  113 B K  E     -N   91   0C  69 2257   91   K    K        K RRK        KKKKK K KK KRK KK       KKKKKKKY          
   106  114 B I  E     -N   90   0C  11 2259   71   I    I        I III        IIIII I II III II       IIIIIIII          
   107  115 B S  E     -N   89   0C  12 2260   84   R    V        V TTV        VVVVV M VM VVV VV       MMMMMMVA          
   108  116 B M  E     -N   88   0C  58 2260   71   M    L        A AAA        AAAAA V AV AAA AA       VVVVVVAQ          
   109  117 B L  E     +O  133   0C   6  452   51   L    L        I VVI        ILIII I II III II       VVVVVVI.          
   110  118 B E  E    S+     0   0C  92 1908   74   E    D        D DDD        DDDDD D DD DSD DD       DDDDDDDL          
   111  119 B K  E     -O  132   0C  92 2029   65   R    K        E KKE        EEEEE R ER EEE EE       LLLLLLEE          
   112  120 B I  E     -O  131   0C  20 2160   45   I    V        I III        IIIII I II III II       IIIIIIIR          
   113  121 B Y  E     -O  130   0C  66 2224   50   I    I        I YYI        IIIII I II III II       IIIIIIII          
   114  122 B I  E     -O  129   0C  52 2228   82   I    I        V IIV        VLVVV V VV VVI VV       VVVVVVVI          
   115  123 B H    >   -     0   0   25 2247   20   H    H        H HHH        HHHHH H HH HHH HH       HHHHHHHV          
   116  124 B P  T 3  S+     0   0  106 2258   50   P    P        P PPP        PPPPP P PP PPP PP       PPPPPPPH          
   117  125 B R  T 3  S+     0   0  162 2261   76   K    K        K GGK        KKKKK K KK KKK KK       KKKKKKKK          
   118  126 B Y    <   -     0   0   15 2261   15   Y    Y        Y YYY        YYYYY Y YY YYY YY       YYYYYYYY          
   119  127 B N  B > > +R  125   0F  41 2262   68   N    N        N DDN        NNNNN N NN NNN NN       NNNNNNNN          
   120  128 B W  T 3 5 +     0   0   62 1485   76   W    W        W WWW        WWWWW W WW WWW WW       WWWWWWWW          
   121  129 B R  T 3 5S+     0   0  192 1311   77   R    K        K RRK        KKKKK K KK KKK RK       KKKKKKKK          
   122  130 B E  T < 5S-     0   0  101 1657   80   E    E        E TTE        EEEEE E EE EEE EE       EEEEEEEE          
   123  131 B N  T   5S-     0   0    4 2142   69   N    N        N NNN        NNNNN N NN NNN NN       NNNNNNNN          
   124  132 B L    > < +     0   0   25 1817   69   L    M        L LLL        LLLLL L LL LLL LL       LLLLLLLL          
   125  133 B D  B 3   +R  119   0F   7 2115   65   D    D        N NNN        NDNNN N NN NNN NN       NNNNNNND          
   126  134 B R  T 3  S-     0   0   43 2196   57   R    R        R RRR        RRRRR R RR RRR RR       RRRRRRRR          
   127  135 B D    <   +     0   0    0 2261    0   D    D        D DDD        DDDDD D DD DDD DD       DDDDDDDD          
   128  136 B I        +     0   0    0 2264   11   I    I        I III        IIIII I II III VI       IIIIIIII          
   129  137 B A  E     -MO  68 114C   0 2263   48   A    A        A AAA        AAAAA A AA AAA AA       AAAAAAAA          
   130  138 B L  E     -MO  67 113C   0 2264    6   L    L        L LLL        LLLLL L LL LLL LL       LLLLLLLL          
   131  139 B M  E     -MO  66 112C   0 2264   30   I    L        L LLL        LLLLL L LL LLL LL       LLLLLLLI          
   132  140 B K  E     -MO  65 111C  19 2264   49   Q    H        H HHH        HHHHH H HH HKH HH       HHHHHHHL          
   133  141 B L  E     - O   0 109C   0 2264    8   L    L        M LLM        MLMMM L ML LLM LM       LLLLLLMK          
   134  142 B K  S    S+     0   0  111 2264   73   K    K        K KKK        KRRKK R RR RRK RR       RRRRRRRR          
   135  143 B K  S    S-     0   0  171 2264   76   R    R        K RRK        KKRKK L RL QRK RR       RRRRRRRP          
   136  144 B P        -     0   0   73 2264   40   P    P        P PPP        PPPPP P PP PPP PP       PPPPPPPV          
   137  145 B V        -     0   0   11 2220   48   I    V        V IIV        VLIVV V VV IIV VI       IIIIIIV.          
   138  146 B A        -     0   0   75 2253   81   G    I        V SSV        VTTAV P IP QTT TT       PPPPPPIQ          
   139  147 B F        +     0   0   87 2257   43   F    F        F FFF        FFFFF F FF FFF FF       FFFFFFFF          
   140  148 B S        -     0   0   40 2259   60   T    S        T SST        TTTTT S TS TST ST       SSSSSSTS          
   141  149 B D  S    S+     0   0   81 2262   69   N    D        S DDS        SEDNN D DD DNN DD       NNNNNNDN          
   142  150 B Y  S    S+     0   0   81 2252   87   Y    Y        E RRE        ENEEE V KV EEE QE       VVVVVVRY          
   143  151 B I        +     0   0    0 2256   24   I    I        I III        IIIII I II III II       IIIIIIIV          
   144  152 B H        -     0   0    4 2256   79   H    H        H RRH        HVHHH H HH HHH HH       HHHHHHHH          
   145  153 B P        -     0   0    9 2256   44   P    P        P PPP        PPPPP P PP PPP PP       PPPPPPPP          
   146  154 B V        -     0   0    1 2260   37   V    V        V VVV        VIVVV I II IVI IV       IIIIIIIV          
   147  155 B a  B     -c  242   0B   3 2260   46   C    C        C CCC        CCCCC C CC CCC CC       CCCCCCCC          
   148  156 B L        -     0   0   32 2260    9   L    L        L LLL        LLLLL L LL MLL LL       LLLLLLLL          
   149  157 B P        -     0   0    0 2259   30   P    P        P PPP        PPPPP P PP PPP PP       PPPPPPPP          
   150  158 B D     >  -     0   0   51 2255   78   T    T        T NNT        tTTTT N sN sNs St       NNNNNNST          
   151  159 B R  H  > S+     0   0  148 1806   76   K    .        K ..K        iKKKK . t. v.s .v       ......KK          
   152  160 B E  H  > S+     0   0  122 1873   75   E    K        S KKS        AKQSS . V. A.V .A       ......TE          
   153  161 B T  H  > S+     0   0   10 2003   82   I    E        I DDI        KVVII K AK NKA KK       KKKKKKVI          
   154  162 B A  H  X S+     0   0    7 2020   84   V    L        A VVA        NAAAA N KN TKN ET       KKKKKKAV          
   155  163 B A  H  < S+     0   0   70 2078   68   Q    V        K IIK        LKKKK V FV LVL VL       VVVVVVKM          
   156  164 B S  H  < S+     0   0   36 2215   78   T    q        N qqN        MTTNN a La MaL aM       aaaaaaFK          
   157  165 B L  H  < S+     0   0    1  515   98   L    l        L llL        .LLLL m .m .m. t.       mmmmmmLL          
   158  166 B L     <  +     0   0   34  711   82   M    M        M WWM        .MMMM L ML .LM L.       LLLLLLML          
   159  167 B Q  S >  S-     0   0   87  836   93   L    L        F FFF        FFFFF M SM FMS MF       MMMMMMSA          
   160  168 B A  T 3  S+     0   0   51 2039   74   N    A        A SSA        AAAAA t Et StE sA       ttttttEA          
   161  169 B G  T 3  S+     0   0   42 1713   37   R    G        G GGG        GGGGG g Gg GgG gG       ggggggGG          
   162  170 B Y    <   -     0   0   46 1826   85   H    F        Y FFY        YFYFY F FF YFF FY       FFFFFFFY          
   163  171 B K  E     -D  188   0B  33 2112   87   K    K        K LLK        KKKKK K KK KKK KK       KKKKKKNK          
   164  172 B G  E     -D  187   0B   0 2154   45   G    G        G GGG        GGGGG G GG GGG GG       GGGGGGGG          
   165  173 B R  E     -DE 186 232B   3 2164   80   R    R        R RRR        RRRRR R RR RRR RR       RRRRRRQR          
   166  174 B V  E     -DE 185 231B   0 2189   33   V    V        V VVV        VVVVV V VV VVV VV       VVVVVVVV          
   167  175 B T  E     +D  184   0B   0 2202   48   S    T        T TTT        TTTTT T TT TTT TT       TTTTTTTT          
   168  176 B G  E     -D  183   0B   1 2202    0   G    G        G GGG        GGGGG G GG GGG GG       GGGGGGGG          
   169  177 B W  S    S+     0   0    1 2202    1   W    W        W WWW        WWWWW W WW WWW WW       WWWWWWWW          
   170  178 B G  S    S-     0   0    0 2198    1   G    G        G GGG        GGGGG G GG GGG GG       GGGGGGGG          
   171  179 B N        -     0   0   33 2021   77   N    N        N LLN        NNNNN N NN NNN NN       NNNNNNSN          
   172  180 B L  S    S+     0   0   55 1822   62   L    L        L LLL        LLLLL L LL LLL LL       LLLLLLLL          
   173  181 B K  S    S-     0   0  147 1551   78   H    K        R KKR        RYYRR K KK KKK Q        KKKKKKKQ          
   174  182 B E              0   0   49 1397   62   E    E        E NNE        EEEEE E EE EEE E        EEEEEEEE          
   175  183 B T              0   0  181 1202   57   T    T        S TTS        STTSS S SS TTS T        SSSSSS T          
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                                                    T                  S
   178  186 C Q        -     0   0   64  328   73                                                Q   QQ              QQ T
   179  187 C P        -     0   0    8  503   39                             P                  P   PP              PSPS
   180  188 C S  S    S+     0   0   81  526   81                             Q                  G   SS              KTRR
   181  189 C V  B    S-Q   95   0E  21  534   82                             V                  V   VV              FRFF
   182  190 C L        -     0   0    5  625    5                             L                  L   LL              LLLM
   183  191 C Q  E     -BD  34 168B   9  629   50                             Q                  Q   QQ              HKQK
   184  192 C V  E     +BD  33 167B   6  628   86                             Q                  V   VV              QMEE
   185  193 C V  E     - D   0 166B  15  634   49                             I                  V   VV              VLIV
   186  194 C N  E     + D   0 165B   7  634   77                             H                  N   NN              RERE
   187  195 C L  E     - D   0 164B   0  638   34                             L                  L   VL              LVLL
   188  196 C P  E     - D   0 163B  12  639   46                             P                  P   PP              PPPP
   189  197 C I  E     -F  210   0B   9  640   33                             I                  I   II              LYII
   190  198 C V  E     -F  209   0B  10  641   39                             V                  V   VV              VVVV
   191  199 C E    >>  -     0   0   75  641   66                             Q                  E   EE              DDDD
   192  200 C R  H 3> S+     0   0   86  640   78                             Q                  R   RR              YRHR
   193  201 C P  H 3> S+     0   0   77  641   74                             E                  P   PP              NNKQ
   194  202 C V  H <4 S+     0   0   41  641   84                             T                  V   VV              LSTT
   195  203 C c  H >< S+     0   0    5  645    1                             C                  C   CC              CCCC
   196  204 C K  H >< S+     0   0   91  645   74                             R                  K   KK              KKQE
   197  205 C D  T 3< S+     0   0  141  645   80                             D                  A   AA              ELKD
   198  206 C S  T <  S+     0   0   15  645   87                             S                  S   SS              SSAS
   199  207 C T    <   -     0   0   25  645   71                             T                  T   TT              TSTI
   200  208 C R  S    S+     0   0  249  645   89                             k                  r   rr              KSpd
   201  209 C I  S    S-     0   0   56  565   53                             .                  .   ..              QFpg
   202  210 C R        -     0   0  123  556   82                             r                  r   rr              HI.E
   203  211 C I        -     0   0   12  633   24                             V                  I   II              VIVF
   204  212 C T    >   -     0   0   12  638   73                             T                  T   TT              TTTT
   205  213 C D  T 3  S+     0   0   82  642   69                             D                  D   DD              EQRD
   206  214 C N  T 3  S+     0   0   11  645   72                             N                  N   NN              NNNN
   207  215 C M  E <   - G   0 263B   9  637   30                             M                  M   MM              MMMM
   208  216 C F  E     - G   0 262B  19  643   34                             F                  F   FF              FFFF
   209  217 C c  E     -FG 190 261B   0  643    1                             C                  C   CC              CCCC
   210  218 C A  E     +FG 189 260B   0  643   10                             A                  A   AA              AAAA
   211  219 C G        -     0   0    4  643   18                             G                  g   gG              GGGG
   212  220 C Y        -     0   0   31  452   71                             F                  g   p.              YYYY
   213  221 C K     >  -     0   0   67  484   87                             S                  R   VK              EHSD
   214  222 C P  T >4 S+     0   0   63  534   70                             P                  Y   AS              QAQS
   215  223 C D  T 34 S+     0   0  132  572   39                             E                  K   QP              AKEG
   216  224 C E  T 34 S-     0   0   83  609   46                             D                  p   gG              VQIK
   217  225 C G    <<  +     0   0   49  117   85                             S                  g   vC              .E..
   218  226 C K        -     0   0  124  137   84                             I                  K   GG              ....
   219  227 C R        +     0   0   81  180   80                             S                  R   GS              ..I.
   220  228 C G        +     0   0    3  583   68                             G                  G   MA              G.GK
   221  229 C D  B     -A   30   0A  12  624   16                             D                  D   EG              DDDD
   222  230 C A        +     0   0    9  640   48                             S                  A   TG              SAAS
   223  231 C d    >>  -     0   0   13  644    1                             C                  C   CS              CCCC
   224  232 C E  T 34 S+     0   0   95  644   57                             E                  E   YS              QQKE
   225  233 C G  T 34 S+     0   0   20  645    8                             G                  G   KG              GGGG
   226  234 C D  T X4  +     0   0    0  645    0                             D                  d   pa              DDDD
   227  235 C S  T 3< S+     0   0   16  645    6                             S                  t   cr              SSSS
   228  236 C G  T 3  S+     0   0    0  645    1                             G                  D   EG              GGGG
   229  237 C G    <   -     0   0    0  645    4                             G                  T   GD              GGGG
   230  238 C P  E     - H   0 246B   0  645    7                             P                  A   DA              PPPP
   231  239 C F  E     -EH 166 245B   0  644   24                             F                  L   SC              FHFF
   232  240 C V  E     -EH 165 243B   2  643   42                             V                  D   GE              EVVA
   233  241 C M  E     - H   0 242B   0  643   64                             M                  L   GG              MTVF
   234  242 C K  E     - H   0 241B  11  644   80                             K                  T   PD              YRQR
   235  243 C S     >  -     0   0    1  642   84                             N                  v   fs              VFRH
   236  244 C P  T  4 S+     0   0   47  109   82                             P                  l   pm              ....
   237  245 C F  T  4 S+     0   0  145  304   83                             E                  p   Fk              ..KD
   238  246 C N  T  4 S-     0   0   63  501   60                             D                  s   Np              DKND
   239  247 C N     <  +     0   0   85  373   58                             D                  n   Kn              GD.G
   240  248 C R        -     0   0   59  432   80                             R                  R   RR              VTRR
   241  249 C W  E     - H   0 234B   1  442   42                             W                  W   WW              AYWW
   242  250 C Y  E     -cH 147 233B  19  521   85                             Y                  Y   YY              YFYY
   243  251 C Q  E     + H   0 232B   0  638   57                             Q                  Q   QQ              LVIQ
   244  252 C M  E     +     0   0B   0  642   82                             I                  M   MM              ATIL
   245  253 C G  E     -IH 264 231B   0  645    0                             G                  G   GG              GGGG
   246  254 C I  E     -IH 263 230B   0  645   23                             I                  I   II              IIII
   247  255 C V  E     +I  262   0B   5  643   28                             V                  V   VV              VVVV
   248  256 C S  E     -     0   0B   6  644    5                             S                  S   SS              SSSS
   249  257 C W  E     +I  261   0B  35  642   16                             W                  W   WW              WWWW
   250  258 C G        -     0   0   36  645    5                             G                  G   GG              GGGG
   251  259 C E  S    S-     0   0   61  627   89                             E                  E   EE              EEVV
   252  260 C G  S    S-     0   0   21  637   41                             G                  G   GG              GGGG
   253  261 C d  S    S-     0   0   12  642    1                             C                  C   CC              CCCC
   254  262 C D  S    S+     0   0   28  643   37                             D                  D   DD              AAGA
   255  263 C R    >   -     0   0  128  645   82                             R                  R   RR              RRRK
   256  264 C D  T 3  S+     0   0   93  645   73                             S                  D   DN              PKKV
   257  265 C G  T 3  S+     0   0   29  629   69                             G                  G   GG              GGNG
   258  266 C K    <   -     0   0   90  639   88                             K                  K   KK              TKHE
   259  267 C Y        -     0   0   14  641   48                             Y                  Y   YY              YYYY
   260  268 C G  E     -G  210   0B   3  618   10                             G                  G   GG              GGGG
   261  269 C F  E     -GI 209 249B   3  639   18                             F                  F   FF              FIYF
   262  270 C Y  E     -GI 208 247B   2  644    4                             Y                  Y   YY              YYYY
   263  271 C T  E     -GI 207 246B   2  644   35                             T                  T   TT              TTVT
   264  272 C H  E  >  - I   0 245B  31  644   59                             H                  H   HH              KKKS
   265  273 C V  T >4 S+     0   0    0  643   15                             L                  V   VV              VVVV
   266  274 C F  G >4 S+     0   0   39  642   74                             F                  F   FF              E SS
   267  275 C R  G 34 S+     0   0  132  642   86                             R                  R   RR              N NR
   268  276 C L  G  S+     0   0   57  641   79                             R                  K   KK              R HL
   270  278 C K  H  > S+     0   0  164  641   65                             K                  K   KK              D DH
   271  279 C W  H  > S+     0   0   37  641    0                             W                  W   WW              F WW
   272  280 C I  H  X S+     0   0    1  641   10                             M                  I   II              I IL
   273  281 C Q  H >X S+     0   0   79  605   76                             L                  Q   QQ              A KR
   274  282 C K  H >X S+     0   0  135  595   73                             K                  K   KK              K ES
   275  283 C V  H 3< S+     0   0   15  570   82                             T                  V   VV                KK
   276  284 C I  H << S+     0   0   49  556   45                             I                  I   II                I 
   277  285 C D  H <<        0   0  114  506   74                                                D   DD                  
   278  286 C Q     <        0   0  142  322   66                                                R   RR                  
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  I                                                                 L   
    30   38 B V  B     +A  221   0A  13 2209   20  V                                                                 V   
    31   39 B E  S    S+     0   0  131 2214   31  E                                                                 D   
    32   40 B G        -     0   0   30 2221    1  G                                                                 G   
    33   41 B S  E     -B  184   0B  74 2221   88  S                                                                 K   
    34   42 B D  E     -B  183   0B  99 2227   62  D                                                                 L   
    35   43 B A        -     0   0    5 2227   45  A                                                                 T   
    36   44 B E    >   -     0   0   41 2228   84  E                                                                 R   
    37   45 B I  T 3  S+     0   0   90 2237   79  I                                                                 R   
    38   46 B G  T 3  S+     0   0   11 2241   60  G                                                                 G   
    39   47 B M  S <  S+     0   0    7 2243   67  M                                                                 D   
    40   48 B S  S >  S+     0   0   11 2247   63  S                                                                 S   
    41   49 B P  T 3  S+     0   0    5 2251    4  P                                                                 P   
    42   50 B W  T 3  S+     0   0    2 2253   18  W                                                                 W   
    43   51 B Q  E <   -J   59   0C   2 2256   32  Q                                                                 Q   
    44   52 B V  E     -JK  58  91C   0 2257   34  V                                                                 V   
    45   53 B M  E     -JK  57  90C   0 2256   51  M                                                                 V   
    46   54 B L  E     -JK  56  89C   0 2257   14  L                                                                 L   
    47   55 B F  E     -JK  54  88C   0 2256   82  F                                                                 L   
    48   56 B R  E   > -JK  53  87C  76 1547   74  R                                                                 .   
    49   57 B K  T > 5S+     0   0   41  951   80  K                                                                 D   
    50   58 B S  T 3 5S+     0   0   72 1192   73  S                                                                 S   
    51   59 B P  T 3 5S-     0   0   69 2030   82  P                                                                 Q   
    52   60 B Q  T < 5 +     0   0   62 2193   78  Q                                                                 K   
    53   61 B E  E   < -J   48   0C  77 2221   95  E                                                                 K   
    54   62 B L  E     +J   47   0C  17 2246   57  L                                                                 L   
    55   63 B L  E     -     0   0C  17 2261   70  L                                                                 A   
    56   64 B b  E     -J   46   0C   1 2264    1  C                                                                 C   
    57   65 B G  E     +J   45   0C   2 2264    3  G                                                                 G   
    58   66 B A  E     -J   44   0C   0 2264   13  A                                                                 A   
    59   67 B S  E     -JL  43  67C   0 2264   40  S                                                                 V   
    60   68 B L  E     + L   0  66C   0 2264   10  L                                                                 L   
    61   69 B I        -     0   0   23 2264   15  I                                                                 I   
    62   70 B S  S    S-     0   0   32 2264   62  S                                                                 H   
    63   71 B D  S    S+     0   0   61 2210   68  D                                                                 P   
    64   72 B R  S    S+     0   0   80 2263   73  R                                                                 S   
    65   73 B W  E     - M   0 132C  12 2264   12  W                                                                 W   
    66   74 B V  E     -LM  60 131C   0 2262   11  V                                                                 V   
    67   75 B L  E     +LM  59 130C   0 2263   23  L                                                                 L   
    68   76 B T  E     - M   0 129C   0 2263   28  T                                                                 T   
    69   77 B A    >   -     0   0    0 2262    2  A                                                                 A   
    70   78 B A  G >> S+     0   0    0 2263    6  A                                                                 A   
    71   79 B H  G 34 S+     0   0   10 2264    3  H                                                                 H   
    72   80 B b  G <4 S+     0   0    0 2264    1  C                                                                 C   
    73   81 B L  T <4 S+     0   0    1 2264   68  L                                                                 L   
    74   82 B L  E  <  +P   81   0D  46 2264   89  L                                                                 E   
    75   83 B Y  E > > -P   80   0D  49 2249   82  Y                                                                 D   
    76   84 B P  G > 5S+     0   0   52 2249   88  P                                                                 P   
    77   85 B P  G 3 5S+     0   0   75  844   90  .                                                                 R   
    78   86 B W  G < 5S-     0   0  166  852   93  .                                                                 K   
    79   87 B D  T < 5 +     0   0  152  869   93  .                                                                 L   
    80   88 B K  E   < +P   75   0D  51  904   83  .                                                                 L   
    81   89 B N  E     +P   74   0D 110  936   80  .                                                                 V   
    82   90 B F        -     0   0   28 1017   94  .                                                                 R   
    83   91 B T    >>  -     0   0   70 1164   86  .                                                                 L   
    84   92 B E  G >4 S+     0   0   35 1455   85  .                                                                 G   
    85   93 B N  G 34 S+     0   0  127 1677   87  .                                                                 E   
    86   94 B D  G <4 S+     0   0   49 1292   82  .                                                                 Y   
    87   95 B L  E <<  +K   48   0C   0 1493   89  .                                                                 D   
    88   96 B L  E     -KN  47 108C   3 2025   51  .                                                                 L   
    89   97 B V  E     -KN  46 107C   0 1516   29  .                                                                 .   
    90   98 B R  E     -KN  45 106C   0 1577   87  .                                                                 .   
    91   99 B I  E     +KN  44 105C   0 1674   49  .                                                                 .   
    92  100 B G  S    S+     0   0    7 1756   23  .                                                                 .   
    93  101 B K        +     0   0   13 1789   76  .                                                                 .   
    94  102 B H        +     0   0   36 1883   76  .                                                                 .   
    95  103 B S  B     -Q  181   0E  21 1965   75  .                                                                 .   
    96  104 B R  S    S+     0   0   16 2018   82  .                                                                 .   
    97  105 B T  S    S+     0   0   31 2112   87  .                                                                 R   
    98  106 B R  S    S-     0   0   85 2151   87  .                                                                 R   
    99  107 B Y        -     0   0   21 2204   90  .                                                                 W   
   100  108 B E    >>  -     0   0   22 2250   66  .                                                                 E   
   101  109 B R  T 34 S+     0   0  143 2252   78  .                                                                 R   
   102  110 B N  T 34 S+     0   0  133 2255   82  .                                                                 W   
   103  111 B I  T <4 S+     0   0   58 2257   77  .                                                                 E   
   104  112 B E     <  -     0   0    0 2258   77  .                                                                 L   
   105  113 B K  E     -N   91   0C  69 2257   91  .                                                                 D   
   106  114 B I  E     -N   90   0C  11 2259   71  .                                                                 L   
   107  115 B S  E     -N   89   0C  12 2260   84  .                                                                 D   
   108  116 B M  E     -N   88   0C  58 2260   71  .                                                                 I   
   109  117 B L  E     +O  133   0C   6  452   51  .                                                                 .   
   110  118 B E  E    S+     0   0C  92 1908   74  .                                                                 E   
   111  119 B K  E     -O  132   0C  92 2029   65  .                                                                 E   
   112  120 B I  E     -O  131   0C  20 2160   45  .                                                                 V   
   113  121 B Y  E     -O  130   0C  66 2224   50  .                                                                 L   
   114  122 B I  E     -O  129   0C  52 2228   82  .                                                                 V   
   115  123 B H    >   -     0   0   25 2247   20  .                                                                 H   
   116  124 B P  T 3  S+     0   0  106 2258   50  .                                                                 P   
   117  125 B R  T 3  S+     0   0  162 2261   76  P                                                                 N   
   118  126 B Y    <   -     0   0   15 2261   15  W                                                                 Y   
   119  127 B N  B > > +R  125   0F  41 2262   68  D                                                                 S   
   120  128 B W  T 3 5 +     0   0   62 1485   76  .                                                                 .   
   121  129 B R  T 3 5S+     0   0  192 1311   77  .                                                                 K   
   122  130 B E  T < 5S-     0   0  101 1657   80  K                                                                 S   
   123  131 B N  T   5S-     0   0    4 2142   69  N                                                                 T   
   124  132 B L    > < +     0   0   25 1817   69  F                                                                 T   
   125  133 B D  B 3   +R  119   0F   7 2115   65  T                                                                 D   
   126  134 B R  T 3  S-     0   0   43 2196   57  E                                                                 N   
   127  135 B D    <   +     0   0    0 2261    0  N                                                                 D   
   128  136 B I        +     0   0    0 2264   11  D                                                                 I   
   129  137 B A  E     -MO  68 114C   0 2263   48  L                                                                 A   
   130  138 B L  E     -MO  67 113C   0 2264    6  L                                                                 L   
   131  139 B M  E     -MO  66 112C   0 2264   30  V                                                                 V   
   132  140 B K  E     -MO  65 111C  19 2264   49  R                                                                 R   
   133  141 B L  E     - O   0 109C   0 2264    8  I                                                                 L   
   134  142 B K  S    S+     0   0  111 2264   73  G                                                                 A   
   135  143 B K  S    S-     0   0  171 2264   76  K                                                                 Q   
   136  144 B P        -     0   0   73 2264   40  h                                                                 P   
   137  145 B V        -     0   0   11 2220   48  t                                                                 A   
   138  146 B A        -     0   0   75 2253   81  R                                                                 T   
   139  147 B F        +     0   0   87 2257   43  Y                                                                 L   
   140  148 B S        -     0   0   40 2259   60  E                                                                 S   
   141  149 B D  S    S+     0   0   81 2262   69  R                                                                 Q   
   142  150 B Y  S    S+     0   0   81 2252   87  N                                                                 T   
   143  151 B I        +     0   0    0 2256   24  I                                                                 I   
   144  152 B H        -     0   0    4 2256   79  E                                                                 V   
   145  153 B P        -     0   0    9 2256   44  K                                                                 P   
   146  154 B V        -     0   0    1 2260   37  I                                                                 V   
   147  155 B a  B     -c  242   0B   3 2260   46  S                                                                 C   
   148  156 B L        -     0   0   32 2260    9  M                                                                 L   
   149  157 B P        -     0   0    0 2259   30  L                                                                 P   
   150  158 B D     >  -     0   0   51 2255   78  E                                                                 D   
   151  159 B R  H  > S+     0   0  148 1806   76  K                                                                 S   
   152  160 B E  H  > S+     0   0  122 1873   75  I                                                                 G   
   153  161 B T  H  > S+     0   0   10 2003   82  Y                                                                 L   
   154  162 B A  H  X S+     0   0    7 2020   84  I                                                                 A   
   155  163 B A  H  < S+     0   0   70 2078   68  H                                                                 E   
   156  164 B S  H  < S+     0   0   36 2215   78  p                                                                 r   
   157  165 B L  H  < S+     0   0    1  515   98  l                                                                 l   
   158  166 B L     <  +     0   0   34  711   82  L                                                                 T   
   159  167 B Q  S >  S-     0   0   87  836   93  Q                                                                 Q   
   160  168 B A  T 3  S+     0   0   51 2039   74  A                                                                 A   
   161  169 B G  T 3  S+     0   0   42 1713   37  G                                                                 G   
   162  170 B Y    <   -     0   0   46 1826   85  Y                                                                 Q   
   163  171 B K  E     -D  188   0B  33 2112   87  K                                                                 E   
   164  172 B G  E     -D  187   0B   0 2154   45  G                                                                 T   
   165  173 B R  E     -DE 186 232B   3 2164   80  R                                                                 I   
   166  174 B V  E     -DE 185 231B   0 2189   33  V                                                                 V   
   167  175 B T  E     +D  184   0B   0 2202   48  T                                                                 T   
   168  176 B G  E     -D  183   0B   1 2202    0  G                                                                 G   
   169  177 B W  S    S+     0   0    1 2202    1  W                                                                 W   
   170  178 B G  S    S-     0   0    0 2198    1  G                                                                 G   
   171  179 B N        -     0   0   33 2021   77  N                                                                     
   172  180 B L  S    S+     0   0   55 1822   62  L                                                                     
   173  181 B K  S    S-     0   0  147 1551   78  K                                                                     
   174  182 B E              0   0   49 1397   62  E                                                                     
   175  183 B T              0   0  181 1202   57  T                                                                     
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66     PPEPPPP     D PTD   S    QPQ       PQ QP           S      A   A   P
   178  186 C Q        -     0   0   64  328   73    QAAKAAAAT    H HSP   S    QVQ Q NN  SQ QS          NSP  PP AS  T  NS
   179  187 C P        -     0   0    8  503   39    APPPPPPPSP P S SESP  P PPSASAPP PPPPPAPAP          PPA  AP PSPPP PPP
   180  188 C S  S    S+     0   0   81  526   81    SQQEEEQQDS SNK TKSD  Y DDSMRGDSDFFSQDGDGQ          FDV  VTNNNTDS DFG
   181  189 C V  B    S-Q   95   0E  21  534   82    ITTQTTTNLT TVV TLVV  K VVIVTVLKVNNTTTVRVNI         NLI VIYRQQARQ LNT
   182  190 C L        -     0   0    5  625    5   LLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLL LLL
   183  191 C Q  E     -BD  34 168B   9  629   50   RQQQRQQQQQRRRQQKMKMQQQHQQQRQQQQQQQQRQQQQQMQQQQQQQQQQQQQQQQHHMQQQQ QQQ
   184  192 C V  E     +BD  33 167B   6  628   86   RYEEAEEEEYTRTKEEQVQCKQQECCTEKECKECCTEEECEEKYYYYYYYYYCCVEEVEEQQKCK CCE
   185  193 C V  E     - D   0 166B  15  634   49   VLVVVIIVVVVVVVIVVVVLAVVALLVAVALVAVVVVVALAVALLLLLLLLLVLLVVLVAVVVLV LVV
   186  194 C N  E     + D   0 165B   7  634   77   TRQQEQQQQKTTTDKNNSSNIKNRKKKRERNNHEETENRNRETRRRRRRRRRETTEETSTSRVST NDQ
   187  195 C L  E     - D   0 164B   0  638   34   LVVVLIIVVLLLLVVVLLLLVVKVAALVMVLVVVVLVVVIVVIVVVVVVVVVVIVVVVIVVVVLV LVV
   188  196 C P  E     - D   0 163B  12  639   46   PPPPPPPPPPPPPRPPPPPSPPPRPPPPKPSDPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPSP SPP
   189  197 C I  E     -F  210   0B   9  640   33   VLIILIIIIVVVVLIIVVIIIIIIIIIIVIILIIIIVIIIIVLLLLLLLLLLIIFIVFYILVIIV IIV
   190  198 C V  E     -F  209   0B  10  641   39   VVVVVVVVVVVVVVKIVVVVIMKILLVIIIVFILLVVVIVIVIVVVVVVVVVLLVVLVVVVVVVV VLV
   191  199 C E    >>  -     0   0   75  641   66   SDGGSGGGGSSSSSMRSSSSSTPNSSSSPSSRSSSSGGSPSGPDDDDDDDDDSSDESDPDSNSSD SSG
   192  200 C R  H 3> S+     0   0   86  640   78   FRNNRNNNNQTFTEPQLLRHNNRQDDTNWNHWDDDTNNNDNNNRRRRRRRRRDQRHNRRIRSNNR HHN
   193  201 C P  H 3> S+     0   0   77  641   74   EARRSRRRRDQEQEVGRRKGMQSSSSAEDDAEAKKHRNDDDSEAAAAAAAAAKSLSELEQGSPAA AKR
   194  202 C V  H <4 S+     0   0   41  641   84   DTQQERRQQEVDVAVKRRTTQQIISSVVRVTWVEETQEVVVQETTTKTTTTTEQTEVTLTRYITT TEQ
   195  203 C c  H >< S+     0   0    5  645    1   CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCC
   196  204 C K  H >< S+     0   0   91  645   74   RLKKQKKKKQNRNVKRRRRSRKENKKNNANRNNDDNNKNRNKQLLLLLLLLLDSLRSLTRNQNRK RDY
   197  205 C D  T 3< S+     0   0  141  645   80   ARCCDCCCCASASRARLDDDKKQKSSGSAGEHANNSCCGAGSTRRRRRRRRRNRKDTKEKRDRAE EGC
   198  206 C S  T <  S+     0   0   15  645   87   SSSSISSSSSSSSSSAASIVSSRLAATPRAVAPSSSLDPVASRSSSSSSSSSSASAQSSASSPVA VSL
   199  207 C T    <   -     0   0   25  645   71   TTYYYYYYYYATAYTHHHYYSAYYYYDDFDYLDYYANLDFDYYTTTTTTTTTYYTYTTAHYYEFY YYN
   200  208 C R  S    S+     0   0  249  645   89   etGGwGGGGtsesGEapprPyygDPPsfPfPPyPPsgqfPfGqkkkkkkkkkPPsanskPPnsPs PPv
   201  209 C I  S    S-     0   0   56  565   53   .taadaaaangagYLdaarGaagDGGgg.gG.dGGgskgGgddtttttttttGG.ht.sdGpgGe GGg
   202  210 C R        -     0   0  123  556   82   v.ssTssss.SVSLE.deSRrrALQQNqQqRLqKKSTEqKqaR.........KKsmms.iQ.GR. RMT
   203  211 C I        -     0   0   12  633   24   IIIIIIIIIIIIIVIVIIIIIIIIIIIIVIIIIIIIIIIIIIIIIIIIIIIIIIIVII.VIIVII IIV
   204  212 C T    >   -     0   0   12  638   73   TYTTSTTTTTTTTTTTSSTTTTTTTTTKTKTTTTTTTTKTKTNYYYYYYYYYTTQTTQ.THSATT TTT
   205  213 C D  T 3  S+     0   0   82  642   69   DNDDKDDDDDEDEPAKKQDSDDPSSSEPHPSKTEEEDDPDPDDNNNNNNNNNENQDDQ.AEESDD SDD
   206  214 C N  T 3  S+     0   0   11  645   72   NNNNSNNNNNNNNRNNNNRNNNRRNNNKNKNNTRRNNNKNKNKNNNNNNNNNRNNDNNdNSAHNN NRN
   207  215 C M  E <   - G   0 263B   9  637   30   MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMmMMMMMM MMM
   208  216 C F  E     - G   0 262B  19  643   34   FFVVIMMVVFIFILFFFFIVLMLLFFIFLFVLFVVIIIFVFIIFFFFFFFFFVFFLMFIFVLLVF VVI
   209  217 C c  E     -FG 190 261B   0  643    1   CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCC
   210  218 C A  E     +FG 189 260B   0  643   10   AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAA
   211  219 C G        -     0   0    4  643   18   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   212  220 C Y        -     0   0   31  452   71   YYLLYLLLLYYYYYYSRR..YFLNYYYYFYGAYYYYVLY.YLYFFFFFFFFFYYFEYFYFLYF.L .YV
   213  221 C K     >  -     0   0   67  484   87   LRLLVLLLLFGLGRSERR..TPPLLLSPEPVEELLSQKP.PLRHHHHHHHHHLLSKLSAEDSG.P .LL
   214  222 C P  T >4 S+     0   0   63  534   70   DEAAEAAEEETDTSKTTE..EDNNEETEEEPDKEEDAEE.EAEEEKEEEEEEEEAEGARNEAN.Q .EA
   215  223 C D  T 34 S+     0   0  132  572   39   AGGGGGGGGGGAGGGGGGH.GGGGGGGGGGGGGGGGGGG.GGGGGGGGGGGGGGGGVGSSGGG.G .GG
   216  224 C E  T 34 S-     0   0   83  609   46   SGGGGGGGGGGSGGQGGGLGGGGGGGGGGGQKGGGGGGGGGGGGGGGGGGGGGGGGGGMSGGGGG GGG
   217  225 C G    <<  +     0   0   49  117   85   .............KT...QV...................V.............K.........K. V..
   218  226 C K        -     0   0  124  137   84   ..................GK...................A.......................A. P..
   219  227 C R        +     0   0   81  180   80   ..............H...GG...................R................E.QR...G. G..
   220  228 C G        +     0   0    3  583   68   VKKKKKKKKQKVK.RRRKQQRHVIKKKIRI..IKKKKKIKIKKRRRRRRRRRK.RNKRGGIKKEQ QKK
   221  229 C D  B     -A   30   0A  12  624   16   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDD
   222  230 C A        +     0   0    9  640   48   ASSSASSSSTAAAAASAAAAAAAASSAASAAAAAAASSAAASASSSSSSSSSASTASTAASAAAA AAS
   223  231 C d    >>  -     0   0   13  644    1   CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCC
   224  232 C E  T 34 S+     0   0   95  644   57   REQQQQQQQLKRKQKDEENQQQTQQQKQQQQQQQQKQQQQQQKQQQQQQQQQQQGSQGTQQQQQQ QQQ
   225  233 C G  T 34 S+     0   0   20  645    8   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   226  234 C D  T X4  +     0   0    0  645    0   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDD
   227  235 C S  T 3< S+     0   0   16  645    6   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSS
   228  236 C G  T 3  S+     0   0    0  645    1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   229  237 C G    <   -     0   0    0  645    4   GGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   230  238 C P  E     - H   0 246B   0  645    7   PPPPPPPPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPPPPPPPPPPPPPPPPPPPP PPP
   231  239 C F  E     -EH 166 245B   0  644   24   FHLLLLLLLFLFLLLFFFLLLLLLVVLFLFLLFLLLMLFLFMLHHHHHHHHHLVHMLHYFMLLLI LMM
   232  240 C V  E     -EH 165 243B   2  643   42   VVVVVVVVVVVVVVVVAATVNQYAVVVVVVVVVVVVVVVVVVSVVVVVVVVVVVAVVASSVVFVV VVV
   233  241 C M  E     - H   0 242B   0  643   64   VTIIMIIIIMCVCCAVAAACVVTCCCCCCCCCACCCSTCCCSCTTTTTTTTTCCTTATMVCVCCQ CCN
   234  242 C K  E     - H   0 241B  11  644   80   NEKKNKKKKEENEQEYDFDGGGYTNNEESEGQENNEKKEGEKKEEEEEEEEENNEFVEKDEGKGG GNK
   235  243 C S     >  -     0   0    1  642   84   YVQQSQQQQdGYGEGDNDGGDDRGGGGdsdGkdNNGQNdGdQHVVVVVVVVVNGISRIFnNNTGD GGK
   236  244 C P  T  4 S+     0   0   47  109   82   .........v.................iai.es....Yi.i..................p..P.. ...
   237  245 C F  T  4 S+     0   0  145  304   83   ..NNINNNSS...P.....VSA.K...SGS.NK....TSVSG.............PP..a..NVV V..
   238  246 C N  T  4 S-     0   0   63  501   60   RENNQNNNNR.R.SDNDN..NNEGKK.gEr.TTEE.GDr.rNEEEEEEEEEEE.EeDENpNKg.. .EG
   239  247 C N     <  +     0   0   85  373   58   GG.........G.GGGGG....NN...s.p.SS...T.p.p.NGGGGGGGGG..GsKGGhG.n.. ..S
   240  248 C R        -     0   0   59  432   80   TTRR.RRLRR.T.RKKRR..FARR...RKR.TR...KIR.RRITTTTTTTTT..TQRTRRR.Q.. ..V
   241  249 C W  E     - H   0 234B   1  442   42   WSWW.WWWWW.W.WYWWW..RRWW...WWW.WY...WWW.WWWSSSSSSSSS..WWYWWHF.W.. ..W
   242  250 C Y  E     -cH 147 233B  19  521   85   FFII.IIIIVRFRFYNVHV.EETY..RRSRVYR..RIIR.RIYFFFFFFFFF.AFQEFIVY.S.. ..V
   243  251 C Q  E     + H   0 232B   0  638   57   LLQQ.QQQQVVLVLALLLLLLILLLLVLQLLQLLLVQQLLLQVLLLLLLLLLLLLLLLLLLLLLL LLQ
   244  252 C M  E     +     0   0B   0  642   82   TTAAIAAAAFYTYAIILLYQVVTAQQYCLCQLHHHYSSCQCSVTTTTTTTTTHQTLITVLDAVQL QQS
   245  253 C G  E     -IH 264 231B   0  645    0   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   246  254 C I  E     -IH 263 230B   0  645   23   VIVVIVVVVLLVLVIIIVILIIIIIIIIIILIVIILIVILIVIIIIIIIIIIIVVTVVIVVILLV LII
   247  255 C V  E     +I  262   0B   5  643   28   VIVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVTIIIIIIIIIVVTVVTVIVVVVV VVV
   248  256 C S  E     -     0   0B   6  644    5   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSS
   249  257 C W  E     +I  261   0B  35  642   16   WWFFWFFFFWWWWWFWWWWWWWWWWWWWWWWWWWWWFFWWWFWWWWWWWWWWWWWWWWWWWWWWW WWF
   250  258 C G        -     0   0   36  645    5   GGGGGGGGGgGGGGgGGGGgGGGGGGGGGGgGGGGGGGGgGGGGGGGGGGGGGGGGGGGGGGGgG gGG
   251  259 C E  S    S-     0   0   61  627   89   EEEEENNENpEEEKkDDDYvEEHEYYNTETvVTQQNFDTvTNEEEEEEEEEEQEEDNEVDHEDvV vQE
   252  260 C G  S    S-     0   0   21  637   41   GEGGGGGGGgGGGGSGGGRgGGGGGGGGGGgGGGGGGGGgGGGEEEEEEEEEGGEGGEGGGGGgG gGG
   253  261 C d  S    S-     0   0   12  642    1   CCCCCCCCCcCCCCCCCCCcCCCCCCCCCCcCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCcC cCC
   254  262 C D  S    S+     0   0   28  643   37   AAAAAAAVAGAAAGLAAAGGAAGAAAAAAAGGAAAAAAAGAAAATAAAAAAAAAAGAADGAAAGA GAA
   255  263 C R    >   -     0   0  128  645   82   AILLDEEEQSDADRSLQLLQRKERQQDLRLQKMQQDRELQLKRMMMMMMMMMQLKVRKRKGRKQR QQR
   256  264 C D  T 3  S+     0   0   93  645   73   EKPPVPPPPQPEPPKRPRPDPPVRKKAAPADKAPPPPPAEAPPKKKKKKKKKPKPKPPEFRPPEP DPP
   257  265 C G  T 3  S+     0   0   29  629   69   GGNNGDDNDGSGSDGDGGFGNNGNNNQRGQGNKNNRNLQGQNEGGGGGGGGGNGGEYGNGGNNGN GNN
   258  266 C K    <   -     0   0   90  639   88   KKFFFFFYFVFKFYKKKKYIYYKRKKYKKKIMKYYFRKKIKFQKKKKKKKKKYKKQYKQKKYKIK IYL
   259  267 C Y        -     0   0   14  641   48   FYPPVPPPPYPFPYYYYYPPPPPPPPPPPPPPPPPPPPPPPPPYYYYYYYYYPPYYPYYYFPYPY PPP
   260  268 C G  E     -G  210   0B   3  618   10   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   261  269 C F  E     -GI 209 249B   3  639   18   VIVVVVVVVVVVVVFVVVVVVVVVVVVVIVVVVVVVVVVVVVVIIIIIIIIIVVIVVIYVVVVVV VVV
   262  270 C Y  E     -GI 208 247B   2  644    4   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYY
   263  271 C T  E     -GI 207 246B   2  644   35   TTTTTTTTTTTTTTVTTTTTTTSTTTTTTTTTTTTTTATTTTTTTTTTTTTTTTTSTTTTAATTT TTT
   264  272 C H  E  >  - I   0 245B  31  644   59   RKRRNRRRRRARARMRRRNYRRDKKKAKFKYKKKKARRKKKRKKKKKKKKKKKKKSRKHRKNRNR YKR
   265  273 C V  T >4 S+     0   0    0  643   15   LVVVVVVVVVVLVIVVVLVVVVVVVVVVVVVLVVVVVVVIVVVVVVVVVVVVVVVVVVILVVVVL VVV
   266  274 C F  G >4 S+     0   0   39  642   74   GSSSASSSSVSGSTHHHHACTNITCCSTFSCSSCCSSSSCSSAYSSSSSSSSCCSITSSFRATCG CCS
   267  275 C R  G 34 S+     0   0  132  642   86   NRQQKRRQQRRNRRKRYRDKRREANNQDNDKRRSSKSQDRDQERRRRRRRRRSNKRRKKNYYDKN KSR
   268  276 C L  G  S+     0   0   57  641   79   LVQQRQQQQVRLRTMRRRLVLLKYVVRRLRVLLLLRQQRVREAVVVVVVVVVLVVLLVYIKKVVV VLQ
   270  278 C K  H  > S+     0   0  164  641   65   NNTTETTTTERNRDPDDDWDNQDDSSQENEDTPPPQSNEDESDNNNNNNNNNPSKEDKDDEDDDS DPS
   271  279 C W  H  > S+     0   0   37  641    0   WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWF WWW
   272  280 C I  H  X S+     0   0    1  641   10   IIIIIIIIIIIIIIILIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIILIIIIIIIII III
   273  281 C Q  H >X S+     0   0   79  605   76   TKNNRNNNN DTD KQVT RKKNRQQDFKFQSSQQDNKFQFN KKKKKKKKKQQKKRKMLESGQE QND
   274  282 C K  H >X S+     0   0  135  595   73   SETTKTTTT DSD METE MSSTQQQAKTQMKTDDNSEQMQS EEEEEEEEEDREKEESNSKQTQ MDS
   275  283 C V  H 3< S+     0   0   15  570   82   TKQQVQQQQ TTT VYNQ INNV TTTAVAIKAVVTHTAVAI KKKKKKKKKVT VN IEYQTVY IIQ
   276  284 C I  H << S+     0   0   49  556   45   VTIITIIII IVI TIIT MTAL IIIITIMTMLLIIVIMII TTTTTTTTTLI TS TIILIML MLI
   277  285 C D  H <<        0   0  114  506   74   SKSSNTTTT  S  GGEE RRKN AA KAKRK SS PTKKKN KKKKKKKKKSS AK TDNDAR  RSS
   278  286 C Q     <        0   0  142  322   66   K SS   S   K   EKE NDD  SS SQ NE RR S  S            R   D N    S  NSS
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10                                                                    I   
    30   38 B V  B     +A  221   0A  13 2209   20                                                                    V   
    31   39 B E  S    S+     0   0  131 2214   31                                                                    G   
    32   40 B G        -     0   0   30 2221    1                                                                    G   
    33   41 B S  E     -B  184   0B  74 2221   88                                                                    N   
    34   42 B D  E     -B  183   0B  99 2227   62                                                                    D   
    35   43 B A        -     0   0    5 2227   45                                                                    A   
    36   44 B E    >   -     0   0   41 2228   84                                                                    R   
    37   45 B I  T 3  S+     0   0   90 2237   79                                                                    P   
    38   46 B G  T 3  S+     0   0   11 2241   60                                                                    G   
    39   47 B M  S <  S+     0   0    7 2243   67                                                                    S   
    40   48 B S  S >  S+     0   0   11 2247   63                                                                    W   
    41   49 B P  T 3  S+     0   0    5 2251    4                                                                    P   
    42   50 B W  T 3  S+     0   0    2 2253   18                                                                    W   
    43   51 B Q  E <   -J   59   0C   2 2256   32                                                                    Q   
    44   52 B V  E     -JK  58  91C   0 2257   34                                                                    V   
    45   53 B M  E     -JK  57  90C   0 2256   51                                                                    S   
    46   54 B L  E     -JK  56  89C   0 2257   14                                                                    V   
    47   55 B F  E     -JK  54  88C   0 2256   82                                                                    r   
    48   56 B R  E   > -JK  53  87C  76 1547   74                                                                    w   
    49   57 B K  T > 5S+     0   0   41  951   80                                                                    V   
    50   58 B S  T 3 5S+     0   0   72 1192   73                                                                    S   
    51   59 B P  T 3 5S-     0   0   69 2030   82                                                                    G   
    52   60 B Q  T < 5 +     0   0   62 2193   78                                                                    K   
    53   61 B E  E   < -J   48   0C  77 2221   95                                                                    Y   
    54   62 B L  E     +J   47   0C  17 2246   57                                                                    H   
    55   63 B L  E     -     0   0C  17 2261   70                                                                    F   
    56   64 B b  E     -J   46   0C   1 2264    1                                                                    C   
    57   65 B G  E     +J   45   0C   2 2264    3                                                                    G   
    58   66 B A  E     -J   44   0C   0 2264   13                                                                    G   
    59   67 B S  E     -JL  43  67C   0 2264   40                                                                    T   
    60   68 B L  E     + L   0  66C   0 2264   10                                                                    L   
    61   69 B I        -     0   0   23 2264   15                                                                    V   
    62   70 B S  S    S-     0   0   32 2264   62                                                                    D   
    63   71 B D  S    S+     0   0   61 2210   68                                                                    R   
    64   72 B R  S    S+     0   0   80 2263   73                                                                    Q   
    65   73 B W  E     - M   0 132C  12 2264   12                                                                    W   
    66   74 B V  E     -LM  60 131C   0 2262   11                                                                    V   
    67   75 B L  E     +LM  59 130C   0 2263   23                                                                    V   
    68   76 B T  E     - M   0 129C   0 2263   28                                                                    T   
    69   77 B A    >   -     0   0    0 2262    2                                                                    A   
    70   78 B A  G >> S+     0   0    0 2263    6                                                                    A   
    71   79 B H  G 34 S+     0   0   10 2264    3                                                                    H   
    72   80 B b  G <4 S+     0   0    0 2264    1                                                                    C   
    73   81 B L  T <4 S+     0   0    1 2264   68                                                                    V   
    74   82 B L  E  <  +P   81   0D  46 2264   89                                                                    D   
    75   83 B Y  E > > -P   80   0D  49 2249   82                                                                    N   
    76   84 B P  G > 5S+     0   0   52 2249   88                                                                    G   
    77   85 B P  G 3 5S+     0   0   75  844   90                                                                    .   
    78   86 B W  G < 5S-     0   0  166  852   93                                                                    .   
    79   87 B D  T < 5 +     0   0  152  869   93                                                                    .   
    80   88 B K  E   < +P   75   0D  51  904   83                                                                    .   
    81   89 B N  E     +P   74   0D 110  936   80                                                                    .   
    82   90 B F        -     0   0   28 1017   94                                                                    .   
    83   91 B T    >>  -     0   0   70 1164   86                                                                    .   
    84   92 B E  G >4 S+     0   0   35 1455   85                                                                    R   
    85   93 B N  G 34 S+     0   0  127 1677   87                                                                    K   
    86   94 B D  G <4 S+     0   0   49 1292   82                                                                    P   
    87   95 B L  E <<  +K   48   0C   0 1493   89                                                                    Y   
    88   96 B L  E     -KN  47 108C   3 2025   51                                                                    L   
    89   97 B V  E     -KN  46 107C   0 1516   29                                                                    .   
    90   98 B R  E     -KN  45 106C   0 1577   87                                                                    T   
    91   99 B I  E     +KN  44 105C   0 1674   49                                                                    F   
    92  100 B G  S    S+     0   0    7 1756   23                                                                    G   
    93  101 B K        +     0   0   13 1789   76                                                                    E   
    94  102 B H        +     0   0   36 1883   76                                                                    F   
    95  103 B S  B     -Q  181   0E  21 1965   75                                                                    D   
    96  104 B R  S    S+     0   0   16 2018   82                                                                    R   
    97  105 B T  S    S+     0   0   31 2112   87                                                                    F   
    98  106 B R  S    S-     0   0   85 2151   87                                                                    R   
    99  107 B Y        -     0   0   21 2204   90                                                                    Y   
   100  108 B E    >>  -     0   0   22 2250   66                                                                    E   
   101  109 B R  T 34 S+     0   0  143 2252   78                                                                    S   
   102  110 B N  T 34 S+     0   0  133 2255   82                                                                    T   
   103  111 B I  T <4 S+     0   0   58 2257   77                                                                    E   
   104  112 B E     <  -     0   0    0 2258   77                                                                    Q   
   105  113 B K  E     -N   91   0C  69 2257   91                                                                    T   
   106  114 B I  E     -N   90   0C  11 2259   71                                                                    V   
   107  115 B S  E     -N   89   0C  12 2260   84                                                                    F   
   108  116 B M  E     -N   88   0C  58 2260   71                                                                    A   
   109  117 B L  E     +O  133   0C   6  452   51                                                                    .   
   110  118 B E  E    S+     0   0C  92 1908   74                                                                    E   
   111  119 B K  E     -O  132   0C  92 2029   65                                                                    E   
   112  120 B I  E     -O  131   0C  20 2160   45                                                                    I   
   113  121 B Y  E     -O  130   0C  66 2224   50                                                                    F   
   114  122 B I  E     -O  129   0C  52 2228   82                                                                    I   
   115  123 B H    >   -     0   0   25 2247   20                                                                    H   
   116  124 B P  T 3  S+     0   0  106 2258   50                                                                    P   
   117  125 B R  T 3  S+     0   0  162 2261   76                                                                    G   
   118  126 B Y    <   -     0   0   15 2261   15                                                                    Y   
   119  127 B N  B > > +R  125   0F  41 2262   68                                                                    N   
   120  128 B W  T 3 5 +     0   0   62 1485   76                                                                    .   
   121  129 B R  T 3 5S+     0   0  192 1311   77                                                                    .   
   122  130 B E  T < 5S-     0   0  101 1657   80                                                                    D   
   123  131 B N  T   5S-     0   0    4 2142   69                                                                    s   
   124  132 B L    > < +     0   0   25 1817   69                                                                    l   
   125  133 B D  B 3   +R  119   0F   7 2115   65                                                                    T   
   126  134 B R  T 3  S-     0   0   43 2196   57                                                                    N   
   127  135 B D    <   +     0   0    0 2261    0                                                                    D   
   128  136 B I        +     0   0    0 2264   11                                                                    I   
   129  137 B A  E     -MO  68 114C   0 2263   48                                                                    A   
   130  138 B L  E     -MO  67 113C   0 2264    6                                                                    V   
   131  139 B M  E     -MO  66 112C   0 2264   30                                                                    I   
   132  140 B K  E     -MO  65 111C  19 2264   49                                                                    K   
   133  141 B L  E     - O   0 109C   0 2264    8                                                                    L   
   134  142 B K  S    S+     0   0  111 2264   73                                                                    T   
   135  143 B K  S    S-     0   0  171 2264   76                                                                    S   
   136  144 B P        -     0   0   73 2264   40                                                                    P   
   137  145 B V        -     0   0   11 2220   48                                                                    V   
   138  146 B A        -     0   0   75 2253   81                                                                    T   
   139  147 B F        +     0   0   87 2257   43                                                                    Y   
   140  148 B S        -     0   0   40 2259   60                                                                    T   
   141  149 B D  S    S+     0   0   81 2262   69                                                                    A   
   142  150 B Y  S    S+     0   0   81 2252   87                                                                    Y   
   143  151 B I        +     0   0    0 2256   24                                                                    V   
   144  152 B H        -     0   0    4 2256   79                                                                    Y   
   145  153 B P        -     0   0    9 2256   44                                                                    P   
   146  154 B V        -     0   0    1 2260   37                                                                    V   
   147  155 B a  B     -c  242   0B   3 2260   46                                                                    C   
   148  156 B L        -     0   0   32 2260    9                                                                    L   
   149  157 B P        -     0   0    0 2259   30                                                                    P   
   150  158 B D     >  -     0   0   51 2255   78                                                                    D   
   151  159 B R  H  > S+     0   0  148 1806   76                                                                    A   
   152  160 B E  H  > S+     0   0  122 1873   75                                                                    S   
   153  161 B T  H  > S+     0   0   10 2003   82                                                                    T   
   154  162 B A  H  X S+     0   0    7 2020   84                                                                    E   
   155  163 B A  H  < S+     0   0   70 2078   68                                                                    A   
   156  164 B S  H  < S+     0   0   36 2215   78                                                                    E   
   157  165 B L  H  < S+     0   0    1  515   98                                                                    .   
   158  166 B L     <  +     0   0   34  711   82                                                                    .   
   159  167 B Q  S >  S-     0   0   87  836   93                                                                    .   
   160  168 B A  T 3  S+     0   0   51 2039   74                                                                    V   
   161  169 B G  T 3  S+     0   0   42 1713   37                                                                    G   
   162  170 B Y    <   -     0   0   46 1826   85                                                                    T   
   163  171 B K  E     -D  188   0B  33 2112   87                                                                    V   
   164  172 B G  E     -D  187   0B   0 2154   45                                                                    C   
   165  173 B R  E     -DE 186 232B   3 2164   80                                                                    T   
   166  174 B V  E     -DE 185 231B   0 2189   33                                                                    V   
   167  175 B T  E     +D  184   0B   0 2202   48                                                                    T   
   168  176 B G  E     -D  183   0B   1 2202    0                                                                    G   
   169  177 B W  S    S+     0   0    1 2202    1                                                                    W   
   170  178 B G  S    S-     0   0    0 2198    1                                                                    G   
   171  179 B N        -     0   0   33 2021   77                                                                    A   
   172  180 B L  S    S+     0   0   55 1822   62                                                                    Q   
   173  181 B K  S    S-     0   0  147 1551   78                                                                    Q   
   174  182 B E              0   0   49 1397   62                                                                    E   
   175  183 B T              0   0  181 1202   57                                                                        
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                    A   S P AD N          D         P    GDGPD  GA Q T  
   178  186 C Q        -     0   0   64  328   73     N              TS  T H QR P          T         P    NSIPT  SQNA Q  
   179  187 C P        -     0   0    8  503   39  P  P PPPP         PAPPSPSPSPPAPPPPPPPPPPPPPP     PP P  PPPPP PASPS APP
   180  188 C S  S    S+     0   0   81  526   81  D DF SADV         SSDDKNNDHYDDNNDDDDDKDDDPNV     DY D DSDTFD ESTFQ DGS
   181  189 C V  B    S-Q   95   0E  21  534   82  L VH LAQK        LQIVMVKILVIRVLLLLLLRVARLLLLI    RP V VVVTPL YVVNV IKN
   182  190 C L        -     0   0    5  625    5  LLLLLLLLLLLLLLLLVLLLLLLLLLILLLLLLLLLLLLLILLLLLLLLLLLLMLLLLLLLVLLLL LVL
   183  191 C Q  E     -BD  34 168B   9  629   50  QQQQRQQQRQQQQQQLQKQQKYMRMQQQQQQQQQQQQQQQHQQQQRNNNQKQKQQQHRKQQRQQQL QQR
   184  192 C V  E     +BD  33 167B   6  628   86  CEECKCCCTKYYYYYYYLKYCEQKECEDCQCCCCCCCCCCDQCKEEFFFCQEQEYRQTQQEACICQ EEC
   185  193 C V  E     - D   0 166B  15  634   49  LAAVVLLLVALLLLLLLIVLLAAAVLVLLVLLLLLLLVLLVVLAVAIIILVVALVVVVVAVTLAVA AVL
   186  194 C N  E     + D   0 165B   7  634   77  NHHEQDNSTKRRRRRRRSTSKNKVNNKKDTNNNENNNNDSYVNPEQKKKNKKMYKINAKSEINTDN RQD
   187  195 C L  E     - D   0 164B   0  638   34  AVVVVAVLVVVVVVVVVTVVAVVKLLLILLAALALLLLVLVLAVVVIIILVVVLLVVLVVVVLLVV VVA
   188  196 C P  E     - D   0 163B  12  639   46  PPPPPPPSPPPPPPPPPSPPPPPPPSPASQPPSPSSSPPPPPPKPNPPPSPPPDPPPPPPPPPPPP PPP
   189  197 C I  E     -F  210   0B   9  640   33  IIIILVIIILLLLLLLLFVLIILIVIIVIIIIIVIIIVIIILIIVIVVVTIVVVVKIIIIVIVIIV LII
   190  198 C V  E     -F  209   0B  10  641   39  LIILVLLVVMVVVVVVVIVVLYVVWVVIVILLVLVVVVLVIVLIIIVVVVVVLVVIVVMVIVLLVV IYL
   191  199 C E    >>  -     0   0   75  641   66  SSSSSSSSSTDDDDDDDNDDSNSSKSPSSTSSSTSSSPSSSTTDSSPPPSESNNLNSSESADSPSS ESS
   192  200 C R  H 3> S+     0   0   86  640   78  DDDDNDDNANRRRRQRRGRRDWRTQHHNNNDDHQHHTTENRVTTNDHHHNNHTWHEQENRNQQNKQ NLD
   193  201 C P  H 3> S+     0   0   77  641   74  SAAKVTSAAEAAAAAAATAASTDSSAADEASSAAAANSSAENANDDNNNESETKEADSHSHKREEE CTT
   194  202 C V  H <4 S+     0   0   41  641   84  VVVEQAATRETTTTTTTVTTSKQADTTVTKSSTETTASTAIQQTVVEEETVDLHEAAWIRVETTDT AQT
   195  203 C c  H >< S+     0   0    5  645    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC ACC
   196  204 C K  H >< S+     0   0   91  645   74  RNNESHRRNQLLLLLLLNKLKDSNRHNNRKRRHKRRQNHRTKSNSRSSSRDNNKKAKNDDSRKHDS ERR
   197  205 C D  T 3< S+     0   0  141  645   80  SAANRNAAGARRRRRRREERSRHRSGKKAASSDAEEADAAGAGSSQEEEAAVSNTESSAKSFRKIG SKN
   198  206 C S  T <  S+     0   0   15  645   87  APPSLSSVSGSSSSSSSVASASQPSVPPVSSSVAVVVVAVAYAPEEVVVVEDTVSAATKAERASNP SMS
   199  207 C T    <   -     0   0   25  645   71  YDDYYYYFDYTTTTTTTTYTYLQQFYSFFFYYYYYYFTYFNWYETRMMMFYYNVYYYDYYTYYYYG YKY
   200  208 C R  S    S+     0   0  249  645   89  PyyPmPPPsRkkKkkkkEskPAssVPssPTppPPPPPsPPIgPanysssPhEheesgshPngKGPs RyP
   201  209 C I  S    S-     0   0   56  565   53  GndG.GGGgett.ttttGetGgggQGndGD..GGGGGgGGg.Ggtn...GgGgpga.ggGt..QGg eaG
   202  210 C R        -     0   0  123  556   82  KQqKrKRRNr.......Q..QiraHRysR.qqRKRRRLRRnrQLmLmmmRqMRks.rNrKmhKRQt hrE
   203  211 C I        -     0   0   12  633   24  IIIIIVIIIIIIFIIIIVIIIFIIVIVVVLIIIIIIIIIIFIIIIIVVVVIIVIVIIIIIIVIFIV LII
   204  212 C T    >   -     0   0   12  638   73  TTTTTTTTTTYYTYYYYTTYTTTTPTTTTLTTTTTTTTTTTTTLTTSSSTVTLSTTDTVDTTIHST TTT
   205  213 C D  T 3  S+     0   0   82  642   69  STTEADTDASNNINNNNSDSSDEQDSDDETSSSDSSDDSDDDNDDDEEEERDDKEPSERSDRTEDD DES
   206  214 C N  T 3  S+     0   0   11  645   72  NTTRRNNNNKNNyNNNNRNNNNNYTNKNNTNNNNNNNSNNTSNTNNNNNNnKSNNRTLdSNNkgTA NNN
   207  215 C M  E <   - G   0 263B   9  637   30  MMMMMMMMMMMMmIMMMMMMMMMMAMMMMMMMMMMMMMMMMMMMMMMMMMmMMMMMMMmMMMmmMM MMM
   208  216 C F  E     - G   0 262B  19  643   34  IFFVIFFVIVFFFFFFFLFFFILIMVLLLVFFVFVVVFFVFIFMMFLLLLIFFFFLIILLMFFFLL LIF
   209  217 C c  E     -FG 190 261B   0  643    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCC
   210  218 C A  E     +FG 189 260B   0  643   10  LAAAALAAAAAAAAAAASAAAAAAAAAAAAAAAAAAAIAAAAAAA.AAAAAAAAAAAAAAAAAAAA AAA
   211  219 C G        -     0   0    4  643   18  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGIGGGGGGGGGGGGGGG.GGGGRGGGGGGGGGGEGAGG GGG
   212  220 C Y        -     0   0   31  452   71  FYYYYFY.YYFFFFFFFFLYYYMFFGKY..FF.F...YY.Y.FYY......LY.YTLY.LY.FDYF Y.F
   213  221 C K     >  -     0   0   67  484   87  LEELVLL.PRHHHHHHHLPHLERQPVMW..LL.L...MT.E.LMLAIII..RT.YPKT.DLDILPE V.I
   214  222 C P  T >4 S+     0   0   63  534   70  EKKENEE.SEEEEEEEEAQEEKQQEPAE.AEE.A...DE.R.EKGGLLL..GS.EEQD.KGHKSEN NRE
   215  223 C D  T 34 S+     0   0  132  572   39  GGGGVGG.GGGGGGGGGGGGGGGGGGGGGPGG.G...GG.AGGGVWGGGG.VQ.GGGG.GVQGQGG GGG
   216  224 C E  T 34 S-     0   0   83  609   46  GGGGGGGGGGGGGGGGGGGGGGGGGQGGEGGGGGGGGGGGLQGNGPDDDE.GHGGGGG.GGGGGGG GNG
   217  225 C G    <<  +     0   0   49  117   85  .I.....K.........V..............V.VVV..V.....D....A..T....N....... ...
   218  226 C K        -     0   0  124  137   84  .D.....A....................A...P.PPA..A.....W...AK..I....T....... ...
   219  227 C R        +     0   0   81  180   80  .A..G..G....................G...G.GGG..GFG..KSRRRGKG.G....R.GL.... ...
   220  228 C G        +     0   0    3  583   68  K.IKKKKEKKRRRRRRR.QRKVVIQ.VGKKKKQKQQKKKRGSKIKQQQQKKKIHKKKKRIRRKRKT VQK
   221  229 C D  B     -A   30   0A  12  624   16  D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDSDDDDDDDDDDDDDDDDDDDDDDDD DDD
   222  230 C A        +     0   0    9  640   48  S.AAASSAAASSSSSSSAASSASASATSAASSASAAAGSAASSASAAAAAAAAATASASASASSSA SSS
   223  231 C d    >>  -     0   0   13  644    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCC
   224  232 C E  T 34 S+     0   0   95  644   57  QQQQQQQQKKQQQQQQQQQQQKQQQQQQQNQQQQQQQDQQYQQQQEEEEQQQHSLQQSQQQQQKQQ QQQ
   225  233 C G  T 34 S+     0   0   20  645    8  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG GGG
   226  234 C D  T X4  +     0   0    0  645    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDD
   227  235 C S  T 3< S+     0   0   16  645    6  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSS
   228  236 C G  T 3  S+     0   0    0  645    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   229  237 C G    <   -     0   0    0  645    4  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   230  238 C P  E     - H   0 246B   0  645    7  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPAPPPPPPPPPPP PPP
   231  239 C F  E     -EH 166 245B   0  644   24  IFFLLVMLLLHHHHHHHLIHVLFLLLLVLLVVLLLLLALLLLVLLLMMMLLLLFFLMLLLLFVALL LLV
   232  240 C V  E     -EH 165 243B   2  643   42  V.VVVVVVVSVVVVVVVVVIVVVMLVVMVVAAVVVVVIVVSVVVVVVVVVVTVVVVVVVVIVVMVV VLV
   233  241 C M  E     - H   0 242B   0  643   64  C.ACQCCCCCTTTTTTTCQTCACCICCCCVCCCCCCCCCCVYCYACAAACCISCIHVCCSAQCQCA CVC
   234  242 C K  E     - H   0 241B  11  644   80  NVENHNNGRKEEEEEEEFGESYTPQGEAGQSSGNGGGDNGQLNPEESSSGKRLKRKKEKKADGRNI QVN
   235  243 C S     >  -     0   0    1  642   84  GAdNDGGGGHVVVVVVVEDVGpNtLGKGGSGGGGGGGGGGLKGNR.FFFGVNYKDKtGVTRDGLGD EEG
   236  244 C P  T  4 S+     0   0   47  109   82  .El..................s.n................................a......... ...
   237  245 C F  T  4 S+     0   0  145  304   83  .DS....V.........EV..NPGP.ADVAVVV.VVV..VSG.SPV...V..SEL.g..GP....A .A.
   238  246 C N  T  4 S-     0   0   63  501   60  TCkE.E...NEEEEEEES.EKTekN.DD.S...E......dNQRDNHHH.N.DndKn.NED.QHEN eD.
   239  247 C N     <  +     0   0   85  373   58  .Ls......EGGGGGGGG.G.DrnQ.GG.G..........h..SKRGGG.G.Gdr.y.G.K..G.G g..
   240  248 C R        -     0   0   59  432   80  .RR......VTTTTTTTK.T.QQQR.RR.I..........PS.IRRTTT.T.KER.E.TRR..R.D RK.
   241  249 C W  E     - H   0 234B   1  442   42  .YY......WSSSSSSSW.S.YWWW.WW.W..........WW.WYFWWW.W.WWW.W.WFY..I.L WL.
   242  250 C Y  E     -cH 147 233B  19  521   85  .RR.K.K.RHFFFFFFFF.F.YTTVVYD.T.......VK.VV.YEYFFF.MKYVV.TRLYER.V.S QEQ
   243  251 C Q  E     + H   0 232B   0  638   57  LLLLLLLLVLLLLLLLLQLLLQLVTLLLLQLLLLLLLLLLLLLLLLLLLLQLLQALLVQILLLLLQ LIL
   244  252 C M  E     +     0   0B   0  642   82  QHHHIQTQYVTTTTTTTALTQIVVIQVVQVQQQQQQQATQVIQVIFVVVQAAQYQAVYAHIVKSQI VAR
   245  253 C G  E     -IH 264 231B   0  645    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG
   246  254 C I  E     -IH 263 230B   0  645   23  IVVIIIVLMIIIIIIIIIVIIVVIILIILIIILILLLVVLVIIIVVLLLLVVIILIVIVAVIVIII III
   247  255 C V  E     +I  262   0B   5  643   28  VVVVVVVVVTIIIIIIIVVIVVTVVVTTVVVVVVVVVVVVVVVVVIVVVVVVIVVVVVVTVVVVVV TVV
   248  256 C S  E     -     0   0B   6  644    5  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSS
   249  257 C W  E     +I  261   0B  35  642   16  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWFWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWFWWW WWW
   250  258 C G        -     0   0   36  645    5  GGGGGGGgGGGDGGGGGGGGGGGGGgGGgGGGgGgggGGgGgGGGGGGGgGGGGgGGGGGGGGGGG GGG
   251  259 C E  S    S-     0   0   61  627   89  YTTQFLIvNEEEEEEEEEVESNKEVvRYvRYYvYvvvYIvVnIVNDEEEvEAIVpLSTEYNSNEYE FVY
   252  260 C G  S    S-     0   0   21  637   41  GGGGGGGgGGEEEEEEEGGEGGGGGgGGgGGGgGggeGGeGNGDGGGGGgGGGGeGGGGGGGGGGG GGG
   253  261 C d  S    S-     0   0   12  642    1  CCCCCCCcCCCCCCCCCCCCCCCCCcCCcCCCcCcccCCcCCCCCCCCCcCCCCcCCCCCCCCCCC CCC
   254  262 C D  S    S+     0   0   28  643   37  AAAAAAAGGGAAAAAAAAAAAGAAGGGAGAAAGAGGGAAGDDAGAAGGGGGAAAGAAAAAAAAGAA AGA
   255  263 C R    >   -     0   0  128  645   82  LMMLRLQQDQMMMMMMMRRVQERFQQERQQQQQLQQQYQQRVQKRRLLLQQRDVSRDDQRRSKRQQ DRL
   256  264 C D  T 3  S+     0   0   93  645   73  EAAPPKKEARKKKKKKKRPKKPAPRDPPKPRRDADDKPKKPSRIPELLLKPPLPKPPAPSPYPKPA DPK
   257  265 C G  T 3  S+     0   0   29  629   69  GKKNSGNGQEGGGGGGGNNGNNLNGGNYGNNNGDGGGNGGGSNNYFHHHGNEKNQEGQNGYGKDNQ GGN
   258  266 C K    <   -     0   0   90  639   88  KKKYYKYIFRKKKKKKKKKKKSKKRIYKISKKINIIIFYIQPYKYRNNNIKYHVVYYYRKYDYRYK YYK
   259  267 C Y        -     0   0   14  641   48  PPPPPPPPPPCYYYYYYPYYPPYYPPPPPPPPPPPPPPPPYAPPPPYYYPPPPPYPYPPFPPPPPY PPP
   260  268 C G  E     -G  210   0B   3  618   10  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG.GGGGGGGGGGGGGGGGGGGGGGGG GGG
   261  269 C F  E     -GI 209 249B   3  639   18  VVVVVVVVVVIIIIIIIIVIVVIVIVVIVVVVVVVVVVVVYMVVVVVVVVIVIIVVVVIVVVVVVV VVV
   262  270 C Y  E     -GI 208 247B   2  644    4  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYY
   263  271 C T  E     -GI 207 246B   2  644   35  TTTTTTTTTSTTTTTTTTTTTTATTTTTTTTTTTTTTAATTTTTTTTTTTTATTTTSTTATTTTTA ATT
   264  272 C H  E  >  - I   0 245B  31  644   59  KKKKRKTNANKKKKKKKRRKKRNRRYKRKRKKYKYYFKPNNRKRRRKKKKRNDVKKDSRHRNEQKH RRK
   265  273 C V  T >4 S+     0   0    0  643   15  VVVVVVVVVVVVVVVVVVLVVVVVVIVVVVVVIVVVVVVVVVVVVVVVVVVVVLVVVVVVVVVVVV VVV
   266  274 C F  G >4 S+     0   0   39  642   74  YSSCTCCCSVSSSSSSSTGSCTRTDCSSCSYYCVCCCSCCGSCTTTSSSCTWYPSSSATKTGCSCN ASC
   267  275 C R  G 34 S+     0   0  132  642   86  NRRSVNNKRERRRRRRRKNKNRRSRKARKANNKNKKKWNKKKNSQNRRRKYTKHNAYKYNQRRKAN NRN
   268  276 C L  G  S+     0   0   57  641   79  LLLLRLLVRVVVVVVVVRVVVELLLVMLTRVVVVVVVVKVYSNRLLLLLTLKNLVRNRLILRTILR ILS
   270  278 C K  H  > S+     0   0  164  641   65  SPPPSDSDRDNNNNNNNKSNSDHSDDDDDSNNDDDDDDADNTSNDRDDDDDPSDDEDKDGDKKDPG DKA
   271  279 C W  H  > S+     0   0   37  641    0  WWWWWWWWWWWWWWWWWWFWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWF WWW
   272  280 C I  H  X S+     0   0    1  641   10  IIIIIIIIIIIIIIIIIIIIIIIVIIIIIIIIIIIIILIIIIIIIIIIIIIIIILVIIIVIIIIIL III
   273  281 C Q  H >X S+     0   0   79  605   76  Q SQTQEQD KKKKKKKKEKKRNN RRRRDRRRQRRRQERQNQ KEHHHRHLQKQDKD TKDKEN  KHR
   274  282 C K  H >X S+     0   0  135  595   73  Q TDEEETQ EEEEEEEEQEQS K MLHVKQQMSMMMAEMEQS EEGGGIQEAEEEDE SELSRE  EAD
   275  283 C V  H 3< S+     0   0   15  570   82  T AI TVVT KKKKKKKQYKT  I IKRV TTITIIIIVINVT NKHHHVYKVVKNTT GNVT I  KNA
   276  284 C I  H << S+     0   0   49  556   45  I ML ITMI TTTTTTTILTI  I MMMI IIMIMMIMLIVVI SIIIIIVMVITIMV MSVI L  IMM
   277  285 C D  H <<        0   0  114  506   74  A RS AAR  KKKKKKKG RA  A RDDR AARARRREARNAA N RRRRPA A TA  AKGA T  ERN
   278  286 C Q     <        0   0  142  322   66    SR  NS            S    NQQN   NSNNNQNN S  D DDDNE  N NR  KDNK S  NER
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10        I      I I                           I     I                II I
    30   38 B V  B     +A  221   0A  13 2209   20        V      V L                           V     V                VV V
    31   39 B E  S    S+     0   0  131 2214   31        G      G G                           G     G                GG G
    32   40 B G        -     0   0   30 2221    1        G      G G                           G     G                GG G
    33   41 B S  E     -B  184   0B  74 2221   88        H      Q S                           N     E                SS Q
    34   42 B D  E     -B  183   0B  99 2227   62        N      D K                           D     N                DD V
    35   43 B A        -     0   0    5 2227   45        A      A A                           A     A                AA A
    36   44 B E    >   -     0   0   41 2228   84        T      S K                           R     T                SS P
    37   45 B I  T 3  S+     0   0   90 2237   79        E      A V                           P     A                PP V
    38   46 B G  T 3  S+     0   0   11 2241   60        G      G G                           G     G                GG G
    39   47 B M  S <  S+     0   0    7 2243   67        K      M A                           S     S                SS S
    40   48 B S  S >  S+     0   0   11 2247   63        W      W W                           W     W                WW W
    41   49 B P  T 3  S+     0   0    5 2251    4        P      P P                           P     P                PP P
    42   50 B W  T 3  S+     0   0    2 2253   18        W      W W                           W     W                WW W
    43   51 B Q  E <   -J   59   0C   2 2256   32        Q      Q Q                           Q     Q                QQ Q
    44   52 B V  E     -JK  58  91C   0 2257   34        V      A V                           V     V                VV V
    45   53 B M  E     -JK  57  90C   0 2256   51        S      V S                           S     S                SS S
    46   54 B L  E     -JK  56  89C   0 2257   14        L      L L                           V     M                LL L
    47   55 B F  E     -JK  54  88C   0 2256   82        N      L R                           r     H                nn Q
    48   56 B R  E   > -JK  53  87C  76 1547   74        L      . .                           w     I                ff R
    49   57 B K  T > 5S+     0   0   41  951   80        .      . .                           V     .                .. .
    50   58 B S  T 3 5S+     0   0   72 1192   73        .      Q K                           S     .                .. .
    51   59 B P  T 3 5S-     0   0   69 2030   82        D      N N                           G     K                .. S
    52   60 B Q  T < 5 +     0   0   62 2193   78        G      G R                           K     A                GG G
    53   61 B E  E   < -J   48   0C  77 2221   95        I      E E                           Y     M                VV S
    54   62 B L  E     +J   47   0C  17 2246   57        P      F H                           H     H                SS H
    55   63 B L  E     -     0   0C  17 2261   70        I      S I                           F     V                HH F
    56   64 B b  E     -J   46   0C   1 2264    1        C      C C                           C     C                CC C
    57   65 B G  E     +J   45   0C   2 2264    3        G      G G                           G     G                GG G
    58   66 B A  E     -J   44   0C   0 2264   13        G      G G                           G     G                GG G
    59   67 B S  E     -JL  43  67C   0 2264   40        S      S S                           T     T                SS S
    60   68 B L  E     + L   0  66C   0 2264   10        L      L L                           L     L                LL L
    61   69 B I        -     0   0   23 2264   15        I      I I                           M     I                II I
    62   70 B S  S    S-     0   0   32 2264   62        D      T S                           D     S                TT N
    63   71 B D  S    S+     0   0   61 2210   68        E      D N                           R     D                KK S
    64   72 B R  S    S+     0   0   80 2263   73        R      Q Q                           Q     Q                DD Q
    65   73 B W  E     - M   0 132C  12 2264   12        W      W W                           W     W                WW W
    66   74 B V  E     -LM  60 131C   0 2262   11        V      V V                           V     V                VV V
    67   75 B L  E     +LM  59 130C   0 2263   23        L      L V                           V     L                LL L
    68   76 B T  E     - M   0 129C   0 2263   28        T      T T                           T     T                TT T
    69   77 B A    >   -     0   0    0 2262    2        A      A A                           A     A                AA A
    70   78 B A  G >> S+     0   0    0 2263    6        A      A A                           A     A                AA A
    71   79 B H  G 34 S+     0   0   10 2264    3        H      H H                           H     H                HH H
    72   80 B b  G <4 S+     0   0    0 2264    1        C      C C                           C     C                CC C
    73   81 B L  T <4 S+     0   0    1 2264   68        V      L F                           V     A                II C
    74   82 B L  E  <  +P   81   0D  46 2264   89        G      S D                           D     L                DE Q
    75   83 B Y  E > > -P   80   0D  49 2249   82        C      I G                           S     R                VW T
    76   84 B P  G > 5S+     0   0   52 2249   88        S      L P                           G     S                SI I
    77   85 B P  G 3 5S+     0   0   75  844   90        C      D .                           R     S                SP .
    78   86 B W  G < 5S-     0   0  166  852   93        S      L .                           K     G                DT .
    79   87 B D  T < 5 +     0   0  152  869   93        D      N .                           P     F                YT .
    80   88 B K  E   < +P   75   0D  51  904   83        L      S .                           Y     L                RT .
    81   89 B N  E     +P   74   0D 110  936   80        N      T .                           L     I                GS .
    82   90 B F        -     0   0   28 1017   94        P      I .                           T     L                IL .
    83   91 B T    >>  -     0   0   70 1164   86        S      V L                           F     I                TT .
    84   92 B E  G >4 S+     0   0   35 1455   85        K      Q N                           G     D                VF T
    85   93 B N  G 34 S+     0   0  127 1677   87        Y      L P                           E     S                YW A
    86   94 B D  G <4 S+     0   0   49 1292   82        .      G A                           .     W                .S T
    87   95 B L  E <<  +K   48   0C   0 1493   89        .      A E                           .     T                .L G
    88   96 B L  E     -KN  47 108C   3 2025   51        .      Q y                           F     L                LC l
    89   97 B V  E     -KN  46 107C   0 1516   29        .      . v                           .     .                .. v
    90   98 B R  E     -KN  45 106C   0 1577   87        K      . N                           .     Y                .. N
    91   99 B I  E     +KN  44 105C   0 1674   49        I      . L                           .     L                .. L
    92  100 B G  S    S+     0   0    7 1756   23        Q      . G                           .     G                G. G
    93  101 B K        +     0   0   13 1789   76        A      . E                           .     R                R. R
    94  102 B H        +     0   0   36 1883   76        G      . Y                           .     Q                HL Q
    95  103 B S  B     -Q  181   0E  21 1965   75        K      . E                           D     S                SC S
    96  104 B R  S    S+     0   0   16 2018   82        L      . L                           R     Q                QQ L
    97  105 B T  S    S+     0   0   31 2112   87        K      . P                           F     S                SS Q
    98  106 B R  S    S-     0   0   85 2151   87        L      N K                           R     G                GG G
    99  107 B Y        -     0   0   21 2204   90        N      R P                           Y     S                SS S
   100  108 B E    >>  -     0   0   22 2250   66        P      S S                           E     N                NN N
   101  109 B R  T 34 S+     0   0  143 2252   78        D      S P                           S     V                PP P
   102  110 B N  T 34 S+     0   0  133 2255   82        L      D S                           T     N                KK N
   103  111 B I  T <4 S+     0   0   58 2257   77        P      P M                           E     E                EE A
   104  112 B E     <  -     0   0    0 2258   77        G      N V                           Q     V                EE V
   105  113 B K  E     -N   91   0C  69 2257   91        K      A S                           T     K                SS S
   106  114 B I  E     -N   90   0C  11 2259   71        I      V A                           V     R                RR R
   107  115 B S  E     -N   89   0C  12 2260   84        P      S S                           F     K                TT T
   108  116 B M  E     -N   88   0C  58 2260   71        V      r I                           A     V                II V
   109  117 B L  E     +O  133   0C   6  452   51        .      l .                           .     .                .. .
   110  118 B E  E    S+     0   0C  92 1908   74        K      E S                           E     S                KK T
   111  119 B K  E     -O  132   0C  92 2029   65        Q      D E                           E     Q                QQ Q
   112  120 B I  E     -O  131   0C  20 2160   45        I      I I                           I     I                AA I
   113  121 B Y  E     -O  130   0C  66 2224   50        I      V I                           F     I                VV I
   114  122 B I  E     -O  129   0C  52 2228   82        I      C V                           I     V                CC K
   115  123 B H    >   -     0   0   25 2247   20        H      H H                           H     H                HH H
   116  124 B P  T 3  S+     0   0  106 2258   50        P      P P                           P     P                PP P
   117  125 B R  T 3  S+     0   0  162 2261   76        Y      E Y                           G     D                RR N
   118  126 B Y    <   -     0   0   15 2261   15        Y      Y Y                           Y     Y                YY Y
   119  127 B N  B > > +R  125   0F  41 2262   68        H      D a                           N     N                DD N
   120  128 B W  T 3 5 +     0   0   62 1485   76        L      . l                           .     .                FF .
   121  129 B R  T 3 5S+     0   0  192 1311   77        .      T .                           .     .                .. S
   122  130 B E  T < 5S-     0   0  101 1657   80        N      Q .                           D     N                LL E
   123  131 B N  T   5S-     0   0    4 2142   69        d      T G                           s     t                TT T
   124  132 B L    > < +     0   0   25 1817   69        l      L L                           l     f                II F
   125  133 B D  B 3   +R  119   0F   7 2115   65        G      D S                           T     N                DD D
   126  134 B R  T 3  S-     0   0   43 2196   57        G      N A                           N     N                NN N
   127  135 B D    <   +     0   0    0 2261    0        D      D D                           D     D                DD D
   128  136 B I        +     0   0    0 2264   11        I      I I                           I     I                II I
   129  137 B A  E     -MO  68 114C   0 2263   48        A      C A                           A     A                CC C
   130  138 B L  E     -MO  67 113C   0 2264    6        L      L L                           V     L                LL L
   131  139 B M  E     -MO  66 112C   0 2264   30        L      I M                           I     M                LL L
   132  140 B K  E     -MO  65 111C  19 2264   49        K      K K                           K     K                QQ Q
   133  141 B L  E     - O   0 109C   0 2264    8        L      L L                           L     L                LL L
   134  142 B K  S    S+     0   0  111 2264   73        A      S K                           T     S                SS S
   135  143 B K  S    S-     0   0  171 2264   76        Y      A E                           S     S                AA S
   136  144 B P        -     0   0   73 2264   40        P      P P                           P     P                PP S
   137  145 B V        -     0   0   11 2220   48        V      V V                           V     V                VV V
   138  146 B A        -     0   0   75 2253   81        R      E Q                           T     K                NN T
   139  147 B F        +     0   0   87 2257   43        I      F F                           Y     F                FF F
   140  148 B S        -     0   0   40 2259   60        S      N S                           T     T                TT N
   141  149 B D  S    S+     0   0   81 2262   69        D      S Q                           A     D                DD N
   142  150 B Y  S    S+     0   0   81 2252   87        R      Y T                           Y     Y                NN Y
   143  151 B I        +     0   0    0 2256   24        I      I I                           V     I                II I
   144  152 B H        -     0   0    4 2256   79        K      Q L                           Y     K                YY S
   145  153 B P        -     0   0    9 2256   44        T      P P                           P     P                PP P
   146  154 B V        -     0   0    1 2260   37        I      V I                           V     I                VV V
   147  155 B a  B     -c  242   0B   3 2260   46        K      C C                           C     C                CC C
   148  156 B L        -     0   0   32 2260    9        L      L L                           L     L                LL L
   149  157 B P        -     0   0    0 2259   30        P      A P                           P     A                AA A
   150  158 B D     >  -     0   0   51 2255   78        K      S N                           D     N                AA S
   151  159 B R  H  > S+     0   0  148 1806   76        Q      Q S                           A     N                AA S
   152  160 B E  H  > S+     0   0  122 1873   75        G      D S                           S     S                DD D
   153  161 B T  H  > S+     0   0   10 2003   82        M      S D                           T     S                RR S
   154  162 B A  H  X S+     0   0    7 2020   84        Q      A P                           E     Q                AA T
   155  163 B A  H  < S+     0   0   70 2078   68        I      F D                           A     F                FF F
   156  164 B S  H  < S+     0   0   36 2215   78        Q      H S                           E     H                HH Y
   157  165 B L  H  < S+     0   0    1  515   98        .      . .                           .     .                .. .
   158  166 B L     <  +     0   0   34  711   82        .      . F                           .     .                .. .
   159  167 B Q  S >  S-     0   0   87  836   93        .      . S                           .     .                .. .
   160  168 B A  T 3  S+     0   0   51 2039   74        E      D S                           V     N                NN S
   161  169 B G  T 3  S+     0   0   42 1713   37        K      G G                           G     S                GG G
   162  170 B Y    <   -     0   0   46 1826   85        T      T M                           T     T                TT V
   163  171 B K  E     -D  188   0B  33 2112   87        K      S T                           V     P                SS N
   164  172 B G  E     -D  187   0B   0 2154   45        C      S C                           C     C                SS S
   165  173 B R  E     -DE 186 232B   3 2164   80        W      W S                           T     W                WW W
   166  174 B V  E     -DE 185 231B   0 2189   33        V      V A                           V     A                VV V
   167  175 B T  E     +D  184   0B   0 2202   48        T      T T                           T     T                TT T
   168  176 B G  E     -D  183   0B   1 2202    0        G      G G                           G     G                GG G
   169  177 B W  S    S+     0   0    1 2202    1        W      F W                           W     W                WW W
   170  178 B G  S    S-     0   0    0 2198    1        G      G G                           G     G                GG G
   171  179 B N        -     0   0   33 2021   77        N      D                             A     K                A  N
   172  180 B L  S    S+     0   0   55 1822   62        I                                    Q     L                N  I
   173  181 B K  S    S-     0   0  147 1551   78        K                                    Q                      S  G
   174  182 B E              0   0   49 1397   62        E                                    E                      N  E
   175  183 B T              0   0  181 1202   57        N                                    G                      G  G
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66  Q Q    GN  P      AA     G EEA   S PPG G PP PENS  SSPE  P P P P P   N 
   178  186 C Q        -     0   0   64  328   73  APR    PN  P  T   DN     S SSQ   QTQPP P PP QRETD QTPA  P P P P K   T 
   179  187 C P        -     0   0    8  503   39  PSPPP  AP  PP P P QX PP PP PPSS PPSPPSPSPPP PPPSS PPPSP PPPPPPPPSP  P 
   180  188 C S  S    S+     0   0   81  526   81  FENDE  SD  YD A NNDD KK ADDSSTS GERAYHPHSYY DDDSS TQYQDDYSYDKNYDSE  S 
   181  189 C V  B    S-Q   95   0E  21  534   82  TVATLL AL  PQ R LIRR TT RVQVVVH TAVVPMTMVPP RLLVL VPPRQQPLPTNASKHL  K 
   182  190 C L        -     0   0    5  625    5  LLLLLL LLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLMLL LLLLL LLLLLLLLLILLLLLL  L 
   183  191 C Q  E     -BD  34 168B   9  629   50  RLQQQQ QQMMQQ Q QQQQNQQNQMMQQQMNQNRQKRQRQKK QQQQM QQKKQKKQRQQQQQKQ  Q 
   184  192 C V  E     +BD  33 167B   6  628   86  TDKQCK ECEEEC Q CECCFCCFQCACCIKEKQHEESYSKEE EECER QEEFCYECECECEQEC  Q 
   185  193 C V  E     - D   0 166B  15  634   49  VAVVLA ALVVVL V LALLIAAIVVVLLAVVVATVVVVVVVV LLLVV VVVVLVVLVAVVVAVL  T 
   186  194 C N  E     + D   0 165B   7  634   77  TNDQNP QNAAEN A SHNNKNNKVQADDTSTLVATESNSSEE KKDVS TDEWNREDEYDNEAKD  A 
   187  195 C L  E     - D   0 164B   0  638   34  VLLLAV IAVVVA L AVIIIIIILAVAALLVLVFIVVVVVVV MMAVL VVVLVLVAVIVIVLVA  L 
   188  196 C P  E     - D   0 163B  12  639   46  PPPPPK PPDDPP P PPPPPQQPPPPPPPPPSPTPPPNPPPP AAPPP QPPPSPPPPHPSSPPP  P 
   189  197 C I  E     -F  210   0B   9  640   33  IIILII LIIIIV L IIIIVLLVLVIVVIIIILVIIVIVIII LLLII VIILIVIVILIIVLLL  L 
   190  198 C V  E     -F  209   0B  10  641   39  VWIVLI ILIIVL V LILLVRRVVLVLLLVVIRQWVIVIIVV IILIV IVVIVAVLVVVTVLIL  L 
   191  199 C E    >>  -     0   0   75  641   66  SRESSD DSDDES T TSSSPSSPTSESSPASETPTEESETEE PPPTS TNEDSAESEPASDSDS  T 
   192  200 C R  H 3> S+     0   0   86  640   78  TRNTDT ADTTNA V TDYYHDDHVDQDDNRRNRDNNKQKNNN TTQNR NVNNSRNENRDRTNAQ  N 
   193  201 C P  H 3> S+     0   0   77  641   74  ANKEQN KSKKQA N AASSNEENNTRSSESSKSRRQKAKKQQ AAAAE DHQEADQFHEEQEAKA  T 
   194  202 C V  H <4 S+     0   0   41  641   84  REVEET ATEELE Q QADDEEEEQSVVVTEMREIELLVLELL VVDQI KTLAATLDLEIQTETQ  Q 
   195  203 C c  H >< S+     0   0    5  645    1  CCCCCC CCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCC CCCCCCCCCCCCCCCC  C 
   196  204 C K  H >< S+     0   0   91  645   74  NEQRQN DRNNDS R TNNNSRRSRRSHHHQIQERKDSGSEDD NNERR KADSRQDRDEWQRKDE  K 
   197  205 C D  T 3< S+     0   0  141  645   80  SQDKEA DSSSAD Q GANNEQQEQNSKKKNDDRDAADSDSAA GHAAV SAAHAAANARWQRKAA  K 
   198  206 C S  T <  S+     0   0   15  645   87  SVWRAE LSSSEA Y APSSVVVVYSYAASAWISSKEVSVMEE IRSTK SVEEVWEAKAQADSQS  Y 
   199  207 C T    <   -     0   0   25  645   71  MFYTYE YYSSYY W YDYYMYYMWYYYYYYLYYTYYYTYYYY IIYSY YYYSFLYYYYYYYWYY  W 
   200  208 C R  S    S+     0   0  249  645   89  shrlPa hpvvhP G PyPPsPPsGPSppGkeKPsghryrrhh ssPyw gqhvPrhAhPlSpghP  g 
   201  209 C I  S    S-     0   0   56  565   53  gdppGg d.gggG S GdGG.GG.AGG..QnnnGhggsgsegg dgG.v gqggGdgGgGnGg.sG  . 
   202  210 C R        -     0   0  123  556   82  NPtrDM sqaarQ D QqMMmKKmRDQqqRT.rK.Gr.k.Drr rAKmv GKrrR.rQrQvASrlQ  k 
   203  211 C I        -     0   0   12  633   24  IIILIV IIVVII I IIIIVIIVIIVIIFIVIIFIIIIIIII LLIIV IVIIIVIIIIIIIIVI  I 
   204  212 C T    >   -     0   0   12  638   73  TDVTTK ITTTVT T TTTTSTTSTTTTTHTTQSNVVTKTPVV TTTVT VVVTTFVTVTTTLTLT  K 
   205  213 C D  T 3  S+     0   0   82  642   69  AYDNSD ESDDRN D NTDDEDDEDNDNNENESAAERDRDNRR DEDDG DPRNDSRRQQDDQDDE  D 
   206  214 C N  T 3  S+     0   0   11  645   72  NrTNNT dNHHdN S NTSSNNNNANGNNgRGDDnHdSSSIdd GNNTK HsdGNqdNdNDGpVDN  M 
   207  215 C M  E <   - G   0 263B   9  637   30  MqSMMM mMMMmM M MMMMMMMMMMMMMmMMMMtFmMMMFmm MMMMM MmmMMmmMmMMMmMMM  M 
   208  216 C F  E     - G   0 262B  19  643   34  IFMFIL IFLLLM I FFFFLLLLIILFFFIILIFLLFIFILL IIVMI LLLQVFLMLLLVLIIV  I 
   209  217 C c  E     -FG 190 261B   0  643    1  CCCCCC CCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCC CCCCCCCCCCCCCCCC  C 
   210  218 C A  E     +FG 189 260B   0  643   10  AAAAVA ALAAAV A AAAAAAAAALALLAAAAAAAAAAAAAA AAAAA AAAAAAALAAAAAAAA  A 
   211  219 C G        -     0   0    4  643   18  GGGGGG GGGGGG G GGGGGGGGGGGGGAGGGGGGGSASGGG GGGGG AGGGGGGGGGGGRGGG  G 
   212  220 C Y        -     0   0   31  452   71  Y.FFFY YFDD.F . FYYY.TT..YMFFDYYYN....A.L.. HYFYY .Y.S...F.D.T..YF  . 
   213  221 C K     >  -     0   0   67  484   87  RPEDLL KLLL.M . LELLIKKI.LELLLTQTP...VSVA.. WWLVD .Q.M...L.E.P..EL  . 
   214  222 C P  T >4 S+     0   0   63  534   70  TKQREE WEKK.E . EKEELEEL.EEEESQEEEEQ.LGLK.. EEEKK YE.A...ENK.E.AQE  A 
   215  223 C D  T 34 S+     0   0  132  572   39  GDGGGG GGGGSG . GGGGGGGG.GGGGEGGGGGASGKGGSS GGGTG PGSG..SGEY.GGSGG  A 
   216  224 C E  T 34 S-     0   0   83  609   46  GGGGGN KGGGEG G GGGGDGGDGGGGGGGGGGKGEKDKGEE GGGGG GGEVGdEGEG.GPGQG  G 
   217  225 C G    <<  +     0   0   49  117   85  ...... ...... . ..............K............ .G... ....Ia....S.....  . 
   218  226 C K        -     0   0  124  137   84  ...... ...... A ........S.........G........ ..... ....PQ....W.....  . 
   219  227 C R        +     0   0   81  180   80  .E.... ....K. G ....R..RG.........G.K....KK ...G. ..K.GRK...G.....  . 
   220  228 C G        +     0   0    3  583   68  KEKRKI KKRRHK A KTKKQKKQAKKKKR.RKVNRHR.RKHH A.KRK KKHAEQHKRKLKGVKK  A 
   221  229 C D  B     -A   30   0A  12  624   16  DDDDDD DDDDDD S DDDDDDDDSDDDDDDDDDDDDD.DDDD DGDDD DDDDDDDDDDDDDSDD  S 
   222  230 C A        +     0   0    9  640   48  AASASA ASSSSS S SASSDSSASSSSSSSAATTSSAAASSS ATSAA SASTAASASSSSASAS  S 
   223  231 C d    >>  -     0   0   13  644    1  CCCCCC CCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCC CCCCCCCCCCCCCCCC  C 
   224  232 C E  T 34 S+     0   0   95  644   57  KDQLQQ RQQQQQ Q QQQQEEEEQQQQQKQQQQRSQTQTEQQ SQQQQ SQQRQQQQQQQQQMQQ  M 
   225  233 C G  T 34 S+     0   0   20  645    8  GGGGGG GGGGGG G GGGGGGGGGGGYYGGGGGGGGFGFGGG GGGGG GGGGGGGGGGGGDGGG  G 
   226  234 C D  T X4  +     0   0    0  645    0  DDDDDD DDDDDD D DDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDD DDDDDDDDDDDDDDDD  D 
   227  235 C S  T 3< S+     0   0   16  645    6  SSSSSS SSSSSS S SSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSS SSSSSSSSSSSSSSSS  S 
   228  236 C G  T 3  S+     0   0    0  645    1  GGGGGG GGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGG GGGGGGGGGGGGGGGG  G 
   229  237 C G    <   -     0   0    0  645    4  GGGGGG GGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGG GGGGGGGGGGGGGGGG  G 
   230  238 C P  E     - H   0 246B   0  645    7  PPPPPP PPPPPP P PPPPPPPPPPPPPPPPPPSPPPPPPPP PPPPP PPPPPVPPPPPPPPPP  P 
   231  239 C F  E     -EH 166 245B   0  644   24  LLLLVL LVLLLV L VFVVMLLMLVLVVA.LLLFLLLLLLLL LLVLL LLLLLFLVLLLLLLLV  L 
   232  240 C V  E     -EH 165 243B   2  643   42  VMMMVV VVVVVV V VVVVVVVVVVIVVM.LVVVMVVVVVVV VVVIV LVVSVAVVVVVVVVVV  V 
   233  241 C M  E     - H   0 242B   0  643   64  CYICCH CCCCCC C CACCACCACCCCCQ.CCCRICYSYLCC CCCVA VCCCCVCCCCCCCCCC  C 
   234  242 C K  E     - H   0 241B  11  644   80  WKKENP ENQQKN Q NENNSNNSQNNNNR.PRQENKNGNKKK AANRN QQKRGQKNKGIHQQKN  E 
   235  243 C S     >  -     0   0    1  642   84  GMKEGN NGNNVG K GdGGFRRFKGDGGL.YKHVNVKGKDVV GGGdG SRVDGDVGVDWGVKDG  H 
   236  244 C P  T  4 S+     0   0   47  109   82  ...... ...... . .l.............P..S........ ...i. SC.P............  . 
   237  245 C F  T  4 S+     0   0  145  304   83  ...P.S NAMM.. G .S...T........MN.GR.....P.. AD.FT PD.VV...N.....N.  N 
   238  246 C N  T  4 S-     0   0   63  501   60  .eDDER N.NNNE N .kEEH..HGEKEEHVedNe.NQ.QnNN DDER. GSNT.dNED.RKNDNE  D 
   239  247 C N     <  +     0   0   85  373   58  .gGG.N ....G. . .s..G..GN....GAds.yGG...gGG NG... SCGG.dG...G.GG..  . 
   240  248 C R        -     0   0   59  432   80  .RRR.I T.RRT. T .R..T..TT....RGRPQRRT...QTT RR... PSTN.RT.T.T.AAT.  A 
   241  249 C W  E     - H   0 234B   1  442   42  .WHW.W W.WWW. W .Y..W..WW....VGWWWWWW...WWW WW... WWWW.WW.W.W.WWW.  W 
   242  250 C Y  E     -cH 147 233B  19  521   85  RALT.Y F.YYL. V QR..F.TFV....VTFIFVTL.V.SLL YY... IYLH.VL.LHV.VTF.  Y 
   243  251 C Q  E     + H   0 232B   0  638   57  VVLLLL QLLLQL L LLLLLLLLLLLVVLLVQLSQQVLVLQQ VLLLL QLQLLAQLQLQLQLQL  L 
   244  252 C M  E     +     0   0B   0  642   82  YVVQQV VQVVAQ I QLQQVYYVIQVQQSYGATAVACVCIAA IAQAY AAAWQSAQARVQAVVQ  V 
   245  253 C G  E     -IH 264 231B   0  645    0  GGGGGG GGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGG GGGGGGGGGGGGGGGG  G 
   246  254 C I  E     -IH 263 230B   0  645   23  VIVVII AIIIVI I IVIILIILIIVIIIIIIVIIVIIIIVV IIIVI IIVILIVIVLVLIIVI  I 
   247  255 C V  E     +I  262   0B   5  643   28  VVVTVV VVIIVV V VVVVVVVVVVVVVVVVVTVVVVVVIVV TGVVV VTVVVVVVVVVVVVVV  V 
   248  256 C S  E     -     0   0B   6  644    5  SSSsSS SSSSSS S SSSSSSSSSSSSSSSSsSSSSSSSSSS SSSSS SASSSSSSSSSSSSSS  S 
   249  257 C W  E     +I  261   0B  35  642   16  WWAyWW WWWWWW W WWWWWWWWWWWWWWWWwWWWWFWFWWW WWWFW WFWWWWWWWWWWWWWW  W 
   250  258 C G        -     0   0   36  645    5  GgGGGG GGGGGG g GGGGGggGgGGGGGGGGGGGGGGGGGG GGGGG GGGGgGGGGgGGGGGG  G 
   251  259 C E  S    S-     0   0   61  627   89  NdV.IE LYSSEL k VTYYEffEkREDDEYV.HEIEIYIIEE DRDYL IREEtIEYEiEMESEY  S 
   252  260 C G  S    S-     0   0   21  637   41  GgG.GE GGGGGG N GGGGGPPGNGGGGGKR.GGGGGGGGGG GGGGE GGGSeGGGGPGeGdGG  g 
   253  261 C d  S    S-     0   0   12  642    1  CcCCCC CCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCC CCCCcCCCCCCcCcCC  c 
   254  262 C D  S    S+     0   0   28  643   37  GAAAAG GAGGAA N AAAAGGGGNAAAAGAAGAGGAAAAAAA AAAAA AGAGGGAAAGGAGSAA  S 
   255  263 C R    >   -     0   0  128  645   82  DVRRLE LQNNLQ V QMEELQQLILRLLRQHLFIKLSLSLLL DRLKK QRLDQKLQLSLLRTRQ  P 
   256  264 C D  T 3  S+     0   0   93  645   73  AAPAKV RKVVPE R RARRLPPLQPPEEKPPRAKGPRSRPPP REPPP AAPSKgPKPKPPPSPK  S 
   257  265 C G  T 3  S+     0   0   29  629   69  KGRNGN NNNNNG A NKNNHDDHANHGGDKKDGGQNKKKNNN YFNDD KNNNG.NGNENGNSHN  . 
   258  266 C K    <   -     0   0   90  639   88  FQLRYK RKKKRY P YKHHNRRNPYFKKRYLSKRYRYYYQRR KKTAY YSRKI.RRRKFYRPRK  S 
   259  267 C Y        -     0   0   14  641   48  PPPPPP PPPPPP A PPPPYPPYAPFPPPPPPYYPPPPPPPP PPPPP PYPPP.PPPPPPPGPP  P 
   260  268 C G  E     -G  210   0B   3  618   10  GGGGGG GGGGGG . GGGGGGGS.GGGGGGGGGGGGGGGGGG GGGGG GGGGGgGGGGGGG.GG  G 
   261  269 C F  E     -GI 209 249B   3  639   18  VVLVVV VVVVIV V VVVVVVVVMVVVVVVVIVFVIVVVVII VIVVV VVIVVFIVIVVVVVVV  V 
   262  270 C Y  E     -GI 208 247B   2  644    4  YYYYYY YYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYYYY FYYYY YYYYYYYYYYYYYYYY  Y 
   263  271 C T  E     -GI 207 246B   2  644   35  TTTTTI TTTTTT T TTTTTTTTTTATTTTAIATTTTSTTTT TVTTT ATTTTTTTTTATTATT  T 
   264  272 C H  E  >  - I   0 245B  31  644   59  ARRKKR RKRRRK R KKKKKRRKRKNKKQNNQGKRRDDDRRR KRKRN RKRRNNRKHNRNRRRK  R 
   265  273 C V  T >4 S+     0   0    0  643   15  VVVVVV VVVVVV V VVVVVVVVVVVVVVVVVVVVVVVVIVV VTVVI V VVIVVVVVVLVVVV  V 
   266  274 C F  G >4 S+     0   0   39  642   74  SSNACT QCHHTC S CSCCSSSSSCSCCSAPSQETTQAQTTT SSCSA T TECLTCTCTCPTQC  T 
   267  275 C R  G 34 S+     0   0  132  642   86  KAKRNS ANSSYN K NRIIRRRRKNRNNKNKSQSHYFVFHYY SRNRA S YRKKYNYRSKAKNN  E 
   268  276 C L  G  S+     0   0   57  641   79  RSLVVR KVLLLV S NLNNLVVLSNVLLIRIRKLMLKRKALL IIVLR M LLVVLVLRLYVITV  R 
   270  278 C K  H  > S+     0   0  164  641   65  RDDTDH DSPPDS A SPDDDLLDTASNNDSPAQSPDPNPEDD SADER N DPDADSDNPDNPDD  S 
   271  279 C W  H  > S+     0   0   37  641    0  WWWWWW WWWWWW W WWWWWWWWWWWWWWWWWWWWWFWFWWW WWWWW W WWWWWWWWWWWWWW  F 
   272  280 C I  H  X S+     0   0    1  641   10  IIIIII IIIIII I IIIIIIIIIIIIIIIIIVIIIIVIIII MMIII I IIIIIIIIIIIVII  I 
   273  281 C Q  H >X S+     0   0   79  605   76  DYSDQ  QRYYHQ N QSQQHRRHNARHQEKMKFNTHE ERHH D Q K   HNRQHRHQHQRQQK  D 
   274  282 C K  H >X S+     0   0  135  595   73  QHEQE  TQSSRS Q STQQGEEGQQKQQR AKHSKRK KQRR D E R   RCTERNQKHQRKTT  Q 
   275  283 C V  H 3< S+     0   0   15  570   82  TKLVT  TTNNYT V TATTHTTHVTTTT  QHVTNYT TIYY I T I   YVVVYIYTHTHITT  T 
   276  284 C I  H << S+     0   0   49  556   45  IIIVI  IIMMVI I IMMMIIIIMIMIV  ITMVLVI IIVV M I     VIMVVIVIIIILII  I 
   277  285 C D  H <<        0   0  114  506   74   SRNA  AAQQPA A ARAARRRRAAAAA  NKTQKPN N PP S A     PSSGPRPQH TAAA  A 
   278  286 C Q     <        0   0  142  322   66   S     S  QES    NSSDKKD   E   N N  E    EE   S     ESNEE K S   N     
## ALIGNMENTS  421 -  490
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10   II          L               II     I  V II      I    IIII    IIIV III
    30   38 B V  B     +A  221   0A  13 2209   20   VV          V               VV     V  V VV      V    VVVV    VVVV VVV
    31   39 B E  S    S+     0   0  131 2214   31   GG          N               GS     G  G GG      G    GGGG    GGGA GGG
    32   40 B G        -     0   0   30 2221    1   GG          G               GG     G  G GG      G    GGGG    GGGG GGG
    33   41 B S  E     -B  184   0B  74 2221   88   SS          K               VS     T  Q VV      Q    QQEQ    SSSE EQQ
    34   42 B D  E     -B  183   0B  99 2227   62   DD          E               ND     E  D NN      E    DDED    DDDD AVV
    35   43 B A        -     0   0    5 2227   45   AA          T               AA     V  A AA      A    AAAA    AAAA AAA
    36   44 B E    >   -     0   0   41 2228   84   QQ          K               PE     E  V PF      P    PPPP    SSSR TPP
    37   45 B I  T 3  S+     0   0   90 2237   79   DD          W               EL     P  A ED      A    AAPA    PPPP PVV
    38   46 B G  T 3  S+     0   0   11 2241   60   GG          G               GG     G  G GG      G    GGGG    GGGH GGG
    39   47 B M  S <  S+     0   0    7 2243   67   AA          E               SQ     A  R SS      S    FFSF    SSSS SSS
    40   48 B S  S >  S+     0   0   11 2247   63   WW          S               WF     F  W WW      W    WWWW    WWWW WWW
    41   49 B P  T 3  S+     0   0    5 2251    4   PP          P               PP     P  P PP      P    PPPP    PPPP PPP
    42   50 B W  T 3  S+     0   0    2 2253   18   WW          W               WW     W  W WW      W    WWWW    WWWW WWW
    43   51 B Q  E <   -J   59   0C   2 2256   32   II          Q               QQ     Q  Q QQ      Q    QQQQ    QQQQ QQQ
    44   52 B V  E     -JK  58  91C   0 2257   34   VV          V               VV     A  V VV      A    VVVV    VVVV AVV
    45   53 B M  E     -JK  57  90C   0 2256   51   SS          I               SI     M  S SS      S    SSSS    SSSS SSS
    46   54 B L  E     -JK  56  89C   0 2257   14   LL          L               LL     L  L LL      L    LLLL    LLLL LLL
    47   55 B F  E     -JK  54  88C   0 2256   82   qq          L               qK     W  H qh      T    QQHQ    nnnq .QQ
    48   56 B R  E   > -JK  53  87C  76 1547   74   yy          .               .R     d  F ..      R    ..R.    fff. .R.
    49   57 B K  T > 5S+     0   0   41  951   80   GG          D               pD     p  . pp      .    ....    ...s S..
    50   58 B S  T 3 5S+     0   0   72 1192   73   RR          S               RA     T  . RI      .    ....    ...G N.T
    51   59 B P  T 3 5S-     0   0   69 2030   82   FF          K               YW     R  G YY      S    SK.T    ...R NSS
    52   60 B Q  T < 5 +     0   0   62 2193   78   LL          K               GD     N  Q GG      G    PSPS    GGGW GGG
    53   61 B E  E   < -J   48   0C  77 2221   95   AA          K               GD     R  T GG      S    SSSA    VVVR FSF
    54   62 B L  E     +J   47   0C  17 2246   57   HH          L               HL     Y  Q HH      H    HHQH    SSSH FHH
    55   63 B L  E     -     0   0C  17 2261   70   II          A               FR     F  V FF      F    FFYF    HHHV FFF
    56   64 B b  E     -J   46   0C   1 2264    1   CC          C               CC     C  C CC      C    CCCC    CCCC CCC
    57   65 B G  E     +J   45   0C   2 2264    3   AA          G               GG     S  G GG      G    GGGG    GGGG GGG
    58   66 B A  E     -J   44   0C   0 2264   13   GG          A               GG     G  G GG      G    GGGG    GGGG GGG
    59   67 B S  E     -JL  43  67C   0 2264   40   SS          V               SS     S  S SS      S    SSSS    SSST SSS
    60   68 B L  E     + L   0  66C   0 2264   10   LL          L               LI     L  L LL      L    LLLL    LLLL LLL
    61   69 B I        -     0   0   23 2264   15   VV          I               II     I  I II      I    IIII    IIII III
    62   70 B S  S    S-     0   0   32 2264   62   KK          H               SS     N  S SN      N    NNNN    TTTS SNN
    63   71 B D  S    S+     0   0   61 2210   68   DD          T               SA     K  D SS      S    NNDN    KKKS NSS
    64   72 B R  S    S+     0   0   80 2263   73   RR          S               ES     R  R EE      Q    QQQQ    DDDE QQQ
    65   73 B W  E     - M   0 132C  12 2264   12   WW          W               WW     W  W WW      W    WWWW    WWWW WWW
    66   74 B V  E     -LM  60 131C   0 2262   11   VV          V               VV     V  I VV      V    VVVV    VVVV VVV
    67   75 B L  E     +LM  59 130C   0 2263   23   LL          L               LL     I  L LL      L    LLLL    LLLL LLL
    68   76 B T  E     - M   0 129C   0 2263   28   TT          T               TT     T  T TT      T    TTTT    TTTT TTT
    69   77 B A    >   -     0   0    0 2262    2   AA          A               AA     A  A AA      A    AAAA    AAAA AAA
    70   78 B A  G >> S+     0   0    0 2263    6   AA          A               AA     A  A AA      A    AAAA    AAAA AAA
    71   79 B H  G 34 S+     0   0   10 2264    3   HH          H               HH     H  H HH      H    HHHH    HHHH HHH
    72   80 B b  G <4 S+     0   0    0 2264    1   CC          C               CC     C  C CC      C    CCCC    CCCC CCC
    73   81 B L  T <4 S+     0   0    1 2264   68   TT          M               LT     I  L LL      F    FFAF    IIII IFF
    74   82 B L  E  <  +P   81   0D  46 2264   89   RR          E               PY     R  K PP      Q    PPPK    EDED TQQ
    75   83 B Y  E > > -P   80   0D  49 2249   82   DD          D               GG     E  G GR      P    SSGS    GDSH .NT
    76   84 B P  G > 5S+     0   0   52 2249   88   AA          S               VF     L  S VI      P    GTAG    iYSH .SS
    77   85 B P  G 3 5S+     0   0   75  844   90   ..          K               .D     G  . ..      .    SNN.    ...H ...
    78   86 B W  G < 5S-     0   0  166  852   93   ..          K               .S     V  . ..      .    APP.    ...S ...
    79   87 B D  T < 5 +     0   0  152  869   93   ..          L               .I     T  . ..      .    SSA.    ...D ...
    80   88 B K  E   < +P   75   0D  51  904   83   ..          I               .F     E  . ..      .    DGG.    ...E ...
    81   89 B N  E     +P   74   0D 110  936   80   ..          V               .I     Q  . ..      .    VVL.    ...H ...
    82   90 B F        -     0   0   28 1017   94   ..          R               .M     D  W ..      .    TTT.    ...G ...
    83   91 B T    >>  -     0   0   70 1164   86   ..          L               .F     F  I ..      .    VVA.    ...H ...
    84   92 B E  G >4 S+     0   0   35 1455   85   ..          G               SG     I  P ST      N    VRY.    ..DR .AT
    85   93 B N  G 34 S+     0   0  127 1677   87   RR          E               ES     V  F ET      T    LLLs    ..YV .VV
    86   94 B D  G <4 S+     0   0   49 1292   82   DD          .               SV     R  . SS      N    GGGs    .RR. PNN
    87   95 B L  E <<  +K   48   0C   0 1493   89   PP          .               SQ     L  . SS      G    LLRG    .GG. TGG
    88   96 B L  E     -KN  47 108C   3 2025   51   ll          .               lL     G  l ll      l    QQHv    .iiL All
    89   97 B V  E     -KN  46 107C   0 1516   29   aa          .               v.     .  v vv      v    ...v    vvv. Vvv
    90   98 B R  E     -KN  45 106C   0 1577   87   VV          .               Y.     .  R YF      H    ...V    YYY. TNN
    91   99 B I  E     +KN  44 105C   0 1674   49   MM          .               L.     K  L LL      L    ...L    LLLL LLL
    92  100 B G  S    S+     0   0    7 1756   23   GG          .               G.     H  G GG      G    ...G    GGGG GGG
    93  101 B K        +     0   0   13 1789   76   TT          .               R.     T  S RK      R    ...L    RRRK HLL
    94  102 B H        +     0   0   36 1883   76   NN          Y               R.     S  I RT      Q    ...Q    HHHH NQQ
    95  103 B S  B     -Q  181   0E  21 1965   75   TT          D               T.     V  K TT      N    ...S    SSSI TSS
    96  104 B R  S    S+     0   0   16 2018   82   VV          L               Q.     R  N QQ      L    ...L    QQQL ALL
    97  105 B T  S    S+     0   0   31 2112   87   NN          R               Q.     G  D QQ      Q    SSSQ    SSSG SQE
    98  106 B R  S    S-     0   0   85 2151   87   MM          R               G.     V  Q GG      G    LLQG    GGGA GGG
    99  107 B Y        -     0   0   21 2204   90   SS          W               V.     L  S VV      S    EQQS    SSSN PSS
   100  108 B E    >>  -     0   0   22 2250   66   QQ          E               N.     E  S NN      N    GGEN    NNNE NNN
   101  109 B R  T 34 S+     0   0  143 2252   78   AA          R               TF     A  Q TT      P    SSSP    PPPE PPP
   102  110 B N  T 34 S+     0   0  133 2255   82   YY          W               HN     N  S HY      N    NNNN    KKKA NNN
   103  111 B I  T <4 S+     0   0   58 2257   77   TT          E               EE     E  V EE      E    PPPR    EEES KAA
   104  112 B E     <  -     0   0    0 2258   77   KK          M               TN     R  N TI      V    NNNV    EEEQ VVE
   105  113 B K  E     -N   91   0C  69 2257   91   RR          D               SA     S  H SN      Q    NAES    SSSS TSS
   106  114 B I  E     -N   90   0C  11 2259   71   II          V               RL     Y  R RR      R    VVVR    RRRR VRR
   107  115 B S  E     -N   89   0C  12 2260   84   KK          D               NN     I  V NT      T    SSNT    TTTS DTT
   108  116 B M  E     -N   88   0C  58 2260   71   VV          I               Vm     V  F VV      V    qrrV    IIIT .VV
   109  117 B L  E     +O  133   0C   6  452   51   ..          .               .s     .  . ..      .    viv.    .... L..
   110  118 B E  E    S+     0   0C  92 1908   74   KK          K               AT     E  . AS      S    TVAT    KKKA ATT
   111  119 B K  E     -O  132   0C  92 2029   65   AA          E               KN     R  K KV      S    TKET    QQQL DQQ
   112  120 B I  E     -O  131   0C  20 2160   45   II          I               II     I  I II      I    VIVL    AAAI III
   113  121 B Y  E     -O  130   0C  66 2224   50   SS          L               II     I  I IT      I    IIII    VVVI III
   114  122 B I  E     -O  129   0C  52 2228   82   II          I               VV     V  T VV      N    VIIV    CCCA CKN
   115  123 B H    >   -     0   0   25 2247   20   HH          H               HH     H  H HH      H    HHHH    HHHH HHH
   116  124 B P  T 3  S+     0   0  106 2258   50   PP          P               SP     P  P SP      P    PPPP    PPPE PPP
   117  125 B R  T 3  S+     0   0  162 2261   76   DD          N               SG     D  Q SS      G    NGDN    RRRD DNN
   118  126 B Y    <   -     0   0   15 2261   15   FF          Y               YY     F  I YY      Y    YYYY    YYYY YYY
   119  127 B N  B > > +R  125   0F  41 2262   68   II          S               NN     N  Q Nn      n    NSKN    DDDn .Nn
   120  128 B W  T 3 5 +     0   0   62 1485   76   MM          .               ..     .  H .l      .    ....    FFFl NFv
   121  129 B R  T 3 5S+     0   0  192 1311   77   ..          K               S.     G  T S.      p    SSGS    ...s NVT
   122  130 B E  T < 5S-     0   0  101 1657   80   EE          S               ND     D  S NT      P    TSEV    LLLR STN
   123  131 B N  T   5S-     0   0    4 2142   69   TT          T               TK     T  A TN      N    STTT    TTTN TNN
   124  132 B L    > < +     0   0   25 1817   69   YY          T               NL     Y  . N.      .    SLNA    III. Y..
   125  133 B D  B 3   +R  119   0F   7 2115   65   EE          D               DN     E  . DD      D    DEED    DDD. ED.
   126  134 B R  T 3  S-     0   0   43 2196   57   NN          N               NN     S  . NN      N    NNNN    NNN. NNN
   127  135 B D    <   +     0   0    0 2261    0   DD          D               DD     D  D DD      D    DDDD    DDDD DDD
   128  136 B I        +     0   0    0 2264   11   II          I               II     V  I II      I    IIII    IIII MII
   129  137 B A  E     -MO  68 114C   0 2263   48   AA          A               AS     A  A AA      T    ATAA    CCCA CCC
   130  138 B L  E     -MO  67 113C   0 2264    6   LL          L               LL     L  L LL      L    LLLL    LLLL LLL
   131  139 B M  E     -MO  66 112C   0 2264   30   FF          L               LI     L  L LL      L    LLLL    LLLI LLL
   132  140 B K  E     -MO  65 111C  19 2264   49   YY          R               RE     Q  K RH      R    QMKQ    QQQK KQQ
   133  141 B L  E     - O   0 109C   0 2264    8   LL          L               LL     L  L LL      L    LLLL    LLLL LLL
   134  142 B K  S    S+     0   0  111 2264   73   KK          A               SP     A  V SS      S    SASS    SSSS SSS
   135  143 B K  S    S-     0   0  171 2264   76   KK          Q               SV     L  S SS      S    SSSS    AAAS ASS
   136  144 B P        -     0   0   73 2264   40   PP          P               AP     p  R AA      P    PPPQ    PPPP PPP
   137  145 B V        -     0   0   11 2220   48   VV          A               VL     v  V VV      V    VVVV    VVVV VVV
   138  146 B A        -     0   0   75 2253   81   MM          V               TA     T  T TT      T    TNTT    NNNN NTT
   139  147 B F        +     0   0   87 2257   43   FF          L               FF     F  F FF      F    FFFF    FFFA FFF
   140  148 B S        -     0   0   40 2259   60   NN          S               NS     T  T NS      T    NNTN    TTTS TTT
   141  149 B D  S    S+     0   0   81 2262   69   DD          Q               DD     E  S DN      D    NDAN    DDDD DSS
   142  150 B Y  S    S+     0   0   81 2252   87   YY          T               YI     Y  F YY      F    YHYY    NNNT YYY
   143  151 B I        +     0   0    0 2256   24   II          I               II     I  I II      I    IIII    IIIV III
   144  152 B H        -     0   0    4 2256   79   QQ          V               RK     L  L RR      L    SAAT    YYYT QSS
   145  153 B P        -     0   0    9 2256   44   PP          P               PP     P  P PP      P    PPPP    PPPA PPP
   146  154 B V        -     0   0    1 2260   37   II          I               VI     I  I VV      V    VVVV    VVVA VVV
   147  155 B a  B     -c  242   0B   3 2260   46   CC          C               CQ     C  C CC      C    CCCC    CCCC CCC
   148  156 B L        -     0   0   32 2260    9   LL          L               LL     L  L LL      L    LLLL    LLLL LLL
   149  157 B P        -     0   0    0 2259   30   PP          P               AV     P  P AA      A    SAAP    AAAP AAA
   150  158 B D     >  -     0   0   51 2255   78   FF          D               AS     E  S AA      A    AAAs    AAAD .AA
   151  159 B R  H  > S+     0   0  148 1806   76   ..          S               QE     I  . QQ      P    TASn    AAAQ .SS
   152  160 B E  H  > S+     0   0  122 1873   75   ..          G               NS     P  . NN      G    NSGS    DDDG .DD
   153  161 B T  H  > S+     0   0   10 2003   82   DD          L               SE     E  . SS      S    SSST    RRRL SSS
   154  162 B A  H  X S+     0   0    7 2020   84   VV          A               VE     A  . VV      S    TSSF    AAAI ATT
   155  163 B A  H  < S+     0   0   70 2078   68   FF          E               YS     R  I YF      F    FFFY    FFFL GFF
   156  164 B S  H  < S+     0   0   36 2215   78   QQ          R               SI     R  t SP      F    YYYS    HHHP SYY
   157  165 B L  H  < S+     0   0    1  515   98   NN          E               ..     L  q ..      .    ...G    .... T..
   158  166 B L     <  +     0   0   34  711   82   LL          L               .D     I  L ..      .    ...V    .... F..
   159  167 B Q  S >  S-     0   0   87  836   93   DD          T               .F     R  K ..      .    ...N    .... N..
   160  168 B A  T 3  S+     0   0   51 2039   74   EE          q               AV     P  I AN      S    SSST    NNNH NSS
   161  169 B G  T 3  S+     0   0   42 1713   37   NN          g               GG     G  P GG      G    GGG.    GGGG GGG
   162  170 B Y    <   -     0   0   46 1826   85   TT          Q               TR     N  A TT      I    VTV.    TTTA TVV
   163  171 B K  E     -D  188   0B  33 2112   87   KK          E               SV     I  S SS      N    NDE.    SSSP SNN
   164  172 B G  E     -D  187   0B   0 2154   45   CC          T               SA     G  C SS      S    TSC.    SSSC SSS
   165  173 B R  E     -DE 186 232B   3 2164   80   FF          V               WT     T  W WW      W    WWWW    WWWY WWW
   166  174 B V  E     -DE 185 231B   0 2189   33   II          V               IV     V  V II      V    VVVV    VVVV VVV
   167  175 B T  E     +D  184   0B   0 2202   48   SS          T               TA     T  T TT      T    TTTT    TTTT TTT
   168  176 B G  E     -D  183   0B   1 2202    0   GG          G               GG     G  G GG      G    GGGG    GGGG GGG
   169  177 B W  S    S+     0   0    1 2202    1   WW          W               WF     W  W WW      W    WWWW    WWWW FWW
   170  178 B G  S    S-     0   0    0 2198    1   GG          G               GG     G  G GG      G    GGGG    GGGG GGG
   171  179 B N        -     0   0   33 2021   77   RR                          D         T DN      T    NNNN    AAAR TTN
   172  180 B L  S    S+     0   0   55 1822   62   TT                          V         V VI      T     III    NNNL LII
   173  181 B K  S    S-     0   0  147 1551   78   KK                          Q         K QQ              G    SSSS TGG
   174  182 B E              0   0   49 1397   62   EE                          A         E A               T    NNN  KSS
   175  183 B T              0   0  181 1202   57   EE                          G         S G               G    GGG  TGG
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66  A  PP TP SQ S  PQQ    PPPPPPP  N PGS S  S    PP P N        QP     P   
   178  186 C Q        -     0   0   64  328   73  N  PP STGRT T  NPP  S PPPPPPP  T QSA P  A    PP P N        GS     V   
   179  187 C P        -     0   0    8  503   39  Q  PPPPPSAPPA  ASS  PPPPPPPPP  SPADA SP S   PPPPP P P     PPPP    S   
   180  188 C S  S    S+     0   0   81  526   81  D  YYNNNDPAST DDDD  NAFFFFFFF  PSDDD SG T   KFFDK D K     QVYD    N   
   181  189 C V  B    S-Q   95   0E  21  534   82  R  HPTIAVTIVE VVMM  QLPPPPPPP  TIVVT VK T   TPPLN L V     TTTE    K   
   182  190 C L        -     0   0    5  625    5  L  LLLLLLLLLL LLLLLLLVLLLLLLL  LVLLL LV L   LLLLL L L     ILLL    L   
   183  191 C Q  E     -BD  34 168B   9  629   50  Q  QKRQQRRQQQ QQQQQQYQKKKKKKK  QNQRQ QH R   QKKQQ Q Q     QRQQ    R   
   184  192 C V  E     +BD  33 167B   6  628   86  C  EQQKEAEQEQ VVEEEEQHQQQQQQQ  VQVQN CE Q   KQQCE C C     ETEC    I   
   185  193 C V  E     - D   0 166B  15  634   49  L  VVVGAVIVVV VVVVVVVVVVVVVVV  AVVAA LV V   VVVLV L L     VVVL    V   
   186  194 C N  E     + D   0 165B   7  634   77  N  EKELTTHADT EENNEENDKKKKKKK  VKETR DQ I   RKKNE D N     AHQD    N   
   187  195 C L  E     - D   0 164B   0  638   34  I  VVIMVVVLVV LLIIMMVVVVVVVVV  VVVVV AV V   VVVVV A I     VVVA    L   
   188  196 C P  E     - D   0 163B  12  639   46  P  PPEKKPPPEP PPTTAAPPPPPPPPP  PPPPP PP P   PPPSP P S     PPAP    P   
   189  197 C I  E     -F  210   0B   9  640   33  I  IIIILIILVI LLIILLIIIIIIIII  IILVL VI I   IIIII L V     VVIV    I   
   190  198 C V  E     -F  209   0B  10  641   39  L  RVIIIVLLIL VVIIIIVLMMMMMMM  VMIMV LY V   IVMVV L L     IVIL    L   
   191  199 C E    >>  -     0   0   75  641   66  S  AESDDSSTTS NNDDSSSTEEEEEEE  SSNSD SS S   GEESA P S     GSNS    S   
   192  200 C R  H 3> S+     0   0   86  640   78  Y  DNNNSNPNNN LLRRWWQLNNNDNNN  RILRR DL D   RNNSD Q Q     STNQ    K   
   193  201 C P  H 3> S+     0   0   77  641   74  S  ESDKDAFADS RRKKDDEDHHHHHHH  ETRKS ST A   AQHAE A K     RASA    E   
   194  202 C V  H <4 S+     0   0   41  641   84  D  FVVTTLIQRQ RRKKTTAQIIIIIII  TERTV VQ S   SVITI D R     QKMK    E   
   195  203 C c  H >< S+     0   0    5  645    1  C  CCCCCCCCCC CCCCCCCCCCCCCCC  CCCCC CC C  CCCCCC CCCC    CCCC    C   
   196  204 C K  H >< S+     0   0   91  645   74  N  RDNNNNNKQK RRSSKKERDDDDDDD  NRRSN HR N  EDDDQR EEEE    NNNE    D   
   197  205 C D  T 3< S+     0   0  141  645   80  N  RAQSRSDEKA QQEKKKASAAAAAAA  SNQSD KK S  LQMAAR ALDL    CSHA    Q   
   198  206 C S  T <  S+     0   0   15  645   87  S  QEVGKTPYWM LLYYWWAMKKKKKKK  LQLRA AM A  MMKKVQ SMAM    LSLS    A   
   199  207 C T    <   -     0   0   25  645   71  Y  YYHKELQWFG NSYYLLYKYYYYYYY  RKSRQ YK Y  YYYYFY YYYY    YDFY    G   
   200  208 C R  S    S+     0   0  249  645   89  P  ryvvvyhgry grKKPPGyhhhhhhh  syryh py a  hhhhPg Phph    gslP    y   
   201  209 C I  S    S-     0   0   56  565   53  G  ngggdgg.gp ..nnSSsaggggggg  gs.gg .a g  apggG. Ga.a    .dsG    k   
   202  210 C R        -     0   0  123  556   82  M  fqavdLRrtr rrqe..srrrrrrrr  QrrQR qr G  rshrRl Krqr    nndK    m   
   203  211 C I        -     0   0   12  633   24  I  IIVIIILIII IIIILLIIIIIIIII  IIIVI II I  LIIIII ILIL    IIII    I   
   204  212 C T    >   -     0   0   12  638   73  T  KVSKTTHRHY EETTTTDTVVVVVVV  TTETT TT T  IIVVTK TIDI    TTFT    T   
   205  213 C D  T 3  S+     0   0   82  642   69  D  DRSPPVFDDD DDDDPPESRRRRRRR  TTDHT SE A  QMRRDD NQDQ    SAGS    E   
   206  214 C N  T 3  S+     0   0   11  645   72  S  DdGGRNpVVN TTDDNNTNddddddd  RTTNR NN R  dwddND NdTd    NNDN    N   
   207  215 C M  E <   - G   0 263B   9  637   30  M  MvMMMMmMFM YNMMMMMMmmmmmmm  MMNMM MM M  mmmmMM MmMm    MMMM    M   
   208  216 C F  E     - G   0 262B  19  643   34  F  LIILLLLVLL LLLLLLILLLLLLLL  LLLIL FI I  IILLVL IIFI    IIVF    F   
   209  217 C c  E     -FG 190 261B   0  643    1  C  CCCCCCCCCC CCCCCCCCCCCCCCC  CCCCC CC C  CCCCCC CCCC    CCCC    C   
   210  218 C A  E     +FG 189 260B   0  643   10  A  AAAAAAAAAA AAAAAAAAAAAAAAA  AAAAA LA A  AAAAAA VAAA    AAAV    A   
   211  219 C G        -     0   0    4  643   18  G  GGGGGGGGGG GGGGGGGGGGGGGGG  GGGGG GG G  GGGGSG GGGG    GGGG    G   
   212  220 C Y        -     0   0   31  452   71  Y  ..YYYFY.YV FFDDYYL........  Y.FYY F. Y  SY.... FS.S    RHNF    Y   
   213  221 C K     >  -     0   0   67  484   87  L  ..LLLDS.KP VAKKEEK........  T.AED L. T  VK.... LVDV    LQAL    L   
   214  222 C P  T >4 S+     0   0   63  534   70  E  S.SEEQRAEE RKRREEEK.......  E.LQA ER S  QA...S EQEQ    DAQE    K   
   215  223 C D  T 34 S+     0   0  132  572   39  G  K.GGGGGDGG GGGGGGGG.......  G.GGG GG G  GG...E GGAG    GGGG    G   
   216  224 C E  T 34 S-     0   0   83  609   46  G  G.KHGGGGGG GGGRRRGK.......  G.GGG GN G  KR..GG GKGK    GGGG    E   
   217  225 C G    <<  +     0   0   49  117   85  .  .A........ ........NNNNNNN  .R.V. .. .  ..NNK. ....    ...K    .   
   218  226 C K        -     0   0  124  137   84  K  .K........ ........TTTTTSS  .P... .. .  ..STE. ....    ....    .   
   219  227 C R        +     0   0   81  180   80  D  .K........ ........RRRRRRR  .S... .. .  ..RRG. ....    ....    .   
   220  228 C G        +     0   0    3  583   68  S  QKLVVKIARK KKKKRRKQRRRRRRR  VMK.V KQ R  KRRRAQ KKRK    KKK.    F   
   221  229 C D  B     -A   30   0A  12  624   16  C  DDDDDDDSDD DNDDDDDDDDDDDDD  DDDDN DD D  DGDDDG DDDD    DDDD    D   
   222  230 C A        +     0   0    9  640   48  Q  SSAAAAASSA TAAATTSSSSSSSSS  TSSAV SS A  SSSSAT SSSS    SAAS    A   
   223  231 C d    >>  -     0   0   13  644    1  V  CCCCCCCCCC CCCCCCCCCCCCCCC  CCCCC CC C  CCCCCC CCCC    CCCC    C   
   224  232 C E  T 34 S+     0   0   95  644   57  Q  QQEQQQQMQQ TKQQQQQQQQQQQQQ  QQRQS QQ Q  QQQQQH QQQQ    QKFQ    F   
   225  233 C G  T 34 S+     0   0   20  645    8  G  GGGGGGGGGG GGGGGGGGGGGGGGG  GGGGG YG G  GGGGGG GGGG    GGGG    G   
   226  234 C D  T X4  +     0   0    0  645    0  D  DDDDDDDDDD DDDDDDDDDDDDDDD  DDDDD DD D  DDDDDD DDDD    DDDD    D   
   227  235 C S  T 3< S+     0   0   16  645    6  S  SSSSSSSSSS SSSSSSSSSSSSSSS  SSSSS SS S  SSSSSS SSSS    SSSS    S   
   228  236 C G  T 3  S+     0   0    0  645    1  G  GGGGGGGGGG GGGGGGGGGGGGGGG  GGGGG GG G  GGGGGG GGGG    GGGG    G   
   229  237 C G    <   -     0   0    0  645    4  G  GGGGGGGGGG GGGGGGGGGGGGGGG  GGGGG GG G  GGGGGG GGGG    GGGG    G   
   230  238 C P  E     - H   0 246B   0  645    7  P  PPPPPPPPPP PPPPPPPPPPPPPPP  PPPPP PP P  PPPPPP PPPP    PPPP    P   
   231  239 C F  E     -EH 166 245B   0  644   24  V  LLLLLLLLLL LLLLLLMLLLLLLLL  LLLLL VL L  LLLLLL VLVL    MLLV    L   
   232  240 C V  E     -EH 165 243B   2  643   42  V  VVVVVIVVTQ FFIIVVVLVVVVVVV  ALFVA VL V  VVVVVV VVVV    LMAV    H   
   233  241 C M  E     - H   0 242B   0  643   64  C  CCIGTCCCLI QQCCCCVVCCCCCCC  TLQCC CV A  CCCCCC CCCC    TCCC    V   
   234  242 C K  E     - H   0 241B  11  644   80  K  NKAKPDEQAY IIKKEEKRKKKKKKK  QSIQQ NQ N  PPKKGK NPNP    KRNN    K   
   235  243 C S     >  -     0   0    1  642   84  G  WVHDDNMKID LLRRNNNNVVVVVVV  vNLYD GE G  IWVVGW GIGI    LGKG    N   
   236  244 C P  T  4 S+     0   0   47  109   82  .  .......... ..V............  nG.S. .. .  ...... ....    ....    .   
   237  245 C F  T  4 S+     0   0  145  304   83  .  RN.SS..... ..F.TT.........  SVNET .A .  ..N.V. ..S.    ....    t   
   238  246 C N  T  4 S-     0   0   63  501   60  E  .DdKRKGDDe NNR.ddQGNNNNNNN  DKDSD QD .  NNDN.R .N.N    G.N.    .   
   239  247 C N     <  +     0   0   85  373   58  .  G.nGL.GGGk DG..hhSDGGGGGGG  ...DN .. .  DG.G.G .D.D    S.G.    g   
   240  248 C R        -     0   0   59  432   80  .  TTITM.RARS KT..VVGKTTTTTTT  K.TQR .K .  TSTT.T .T.T    V.L.    Y   
   241  249 C W  E     - H   0 234B   1  442   42  .  WWWWW.WWRY AA..WWWHWWWWWWW  FYAWW .L .  WWWW.W .W.W    W.W.    M   
   242  250 C Y  E     -cH 147 233B  19  521   85  .  FMYFY.ENTT VV.VFFTELLLLLLL  EFVTY .E R  VLLL.V QV.V    IRYQ    E   
   243  251 C Q  E     + H   0 232B   0  638   57  L  QQLLLLLLLI QQ.FQQLIQQQQQQQ  LIQLL VI L  QLQQLQ LQLQ    QVQL    V   
   244  252 C M  E     +     0   0B   0  642   82  Q  VAIAVKQVIV II.RVVVVAAAAAAA  TVIDV QA V  AAAAQV QAQA    SYIQ    I   
   245  253 C G  E     -IH 264 231B   0  645    0  G  GGGGGGGGGG GGGGGGGGGGGGGGG  GGGGG GG G  GGGGGG GGGG    GGGG    G   
   246  254 C I  E     -IH 263 230B   0  645   23  I  VVIIILLILI IIIIIIVIVVVVVVV  VIVIA VI V  IIVVLV IILI    ILVV    I   
   247  255 C V  E     +I  262   0B   5  643   28  V  VVVVVVVVVV VVVVMMVVVVVVVVV  VVVTT VV V  VVVVVV VVVV    VVVV    I   
   248  256 C S  E     -     0   0B   6  644    5  S  SSSSSSSSSS SSSSSSSSSSSSSSS  SSSSS SS S  SSSSSS SSSS    SSSS    S   
   249  257 C W  E     +I  261   0B  35  642   16  W  WWWWWWWWWW NWFFWWWWWWWWWWW  WWWWW WW W  WWWWWW WWWW    FWWW    W   
   250  258 C G        -     0   0   36  645    5  G  GGGGGGGGGG GGGGGGGGGGGGGGG  GGGGg GG G  GGGGgG GGgG    GGGG    G   
   251  259 C E  S    S-     0   0   61  627   89  Y  KEMDDLNSIE DRDDRRYVEEEEEEE  AV.Ya VV V  FFEEvN YFyF    INVY    R   
   252  260 C G  S    S-     0   0   21  637   41  G  GGDEEGGsGG GSGGGGGGGGGGGGG  GGdGG GG G  GGGGeG GGPG    GGGG    G   
   253  261 C d  S    S-     0   0   12  642    1  C  CCCCCCCcCC CCCCCCCCCCCCCCC  CCcCC CC C  CCCCcC CCCC    CCCC    C   
   254  262 C D  S    S+     0   0   28  643   37  A  GGGAAAADGG AAGGAAAGAAAAAAA  AGAAA AG A  AAAAGG AAAA    AGGA    G   
   255  263 C R    >   -     0   0  128  645   82  E  LQILKRRPRQ LLKKEEARQQQQQQQ  RRRQV LR R  RQLQQL LRKR    RDRQ    R   
   256  264 C D  T 3  S+     0   0   93  645   73  R  SPERPPPQEP PPPPRREAPPPPPPP  QEPAP EP P  PPPPKP KPPP    PAPK    P   
   257  265 C G  T 3  S+     0   0   29  629   69  D  NNNNNRG.HN NNKKRRDGNNNNNNN  .GNYY GG N  FNNNGN DFNF    NKNN    K   
   258  266 C K    <   -     0   0   90  639   88  H  FKKKKYNTLY RRKKSSYYRRRRRRR  YYKKR KY F  RKRRIF NRRR    LFRR    Y   
   259  267 C Y        -     0   0   14  641   48  P  PPPPPFPPPP PPPPPPYPPPPPPPP  kPPPP PP P  PPPPPP PPPP    PPPP    P   
   260  268 C G  E     -G  210   0B   3  618   10  G  GGGGGGGGGG GGGGGGGGGGGGGGG  gGGGG GG G  GGGGGG GGGG    GGGG    G   
   261  269 C F  E     -GI 209 249B   3  639   18  V  VIVVVIVVVV VVVVVVVVIIIIIII  VVVVV IV V  VVIIVV VVVV    VVVV    V   
   262  270 C Y  E     -GI 208 247B   2  644    4  Y  YYYYYYYYYY YYYYYYYYYYYYYYY  YYYYF YY Y  YYYYYY YYYY    YYYY    Y   
   263  271 C T  E     -GI 207 246B   2  644   35  t  TTTTTTTATT TTTTTTSTTTTTTTT  TTTTA TT A  TTTTTA TTTT    STTT    T   
   264  272 C H  E  >  - I   0 245B  31  644   59  q  RRKRRDRRNR NNRRLLDRRRRRRRR  DRNRD KR K  QSRRNR KQNQ    RANK    K   
   265  273 C V  T >4 S+     0   0    0  643   15  V  VVVVVVIVIV VVLLIIVVVVVVVVV  VVVVV VV V  VVVVIV VVLV    VVIV    I   
   266  274 C F  G >4 S+     0   0   39  642   74  C  TTTTTSATQN VVssSSSATTTTTTT  SSVTK CS S  LPTTCT CLCL    SSSY    T   
   267  275 C R  G 34 S+     0   0  132  642   86  I  YYHYYREKKR PPkkNNYRYYYYYYY  YKPNH NR A  SAYYKS NSKS    RRHN    N   
   268  276 C L  G  S+     0   0   57  641   79  N  LLRRRIVRVL LLLLLLNLLLLLLLL  RILIR LL R  TSLLVL VTTT    QRFV    L   
   270  278 C K  H  > S+     0   0  164  641   65  D  SDDDDSPDPS PSSSDDPPDDDDDDD  DPSSD NN S  DADDDP DDKD    TREK    E   
   271  279 C W  H  > S+     0   0   37  641    0  W  WWWWWWWWWW WWWWWWWWWWWWWWW  WWWWW WW W  WWWWWW WWWW    WWWW    W   
   272  280 C I  H  X S+     0   0    1  641   10  I  IIIIIIIIII IIIIIIILIIIIIII  IIIII II I  IIIIII IIII    IIII    V   
   273  281 C Q  H >X S+     0   0   79  605   76  A   HK  NNDDK HRNNRRKRHHHHHHH  DKHKF NH Q  QQHHRR QQQQ    KDQK    E   
   274  282 C K  H >X S+     0   0  135  595   73  Q   QS  N SKS SSSSEEDAHHHHHRR  KSSES QT S  REQHMR DRER    SHKD    D   
   275  283 C V  H 3< S+     0   0   15  570   82  T   YK  I IVN IIRRVVTNYYYYYYY  MNIKV TN    TYYYVH TTTT    HTMT    H   
   276  284 C I  H << S+     0   0   49  556   45  M   IT  L LMS LVIITTMLVVVVVVV  VLLMI IM    LVVVMI ILIL    IIMI    L   
   277  285 C D  H <<        0   0  114  506   74  A   PN  A EQK AAKKEEADPPPPPPP  NDAAM AK    APPPRH  AQA    S AA    H   
   278  286 C Q     <        0   0  142  322   66  S   E       D     QQSDKKKKKKK  QN EH EE    ESKKKS  E E    S Q     E   
## ALIGNMENTS  491 -  560
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10   I  II   I                     II  II   IL   VII IIV   I I II  LI  II 
    30   38 B V  B     +A  221   0A  13 2209   20   V VVV   V                     IV  VV   VI   VVV VVV   V V IV  IV  TV 
    31   39 B E  S    S+     0   0  131 2214   31   G GGG   G                     GG  GG   GD   GGG GGG   N G GG  DG  GG 
    32   40 B G        -     0   0   30 2221    1   G GGG   G                     GG  GG   GG   GGG GGG   G G GG  GG  GG 
    33   41 B S  E     -B  184   0B  74 2221   88   S ERQ   V                     LV  TR   QK   DQE SSQ   E V LQ  KS  ST 
    34   42 B D  E     -B  183   0B  99 2227   62   D DPD   N                     NN  AE   EM   DNN NDD   D N NN  KN  NN 
    35   43 B A        -     0   0    5 2227   45   A SAA   A                     AA  AA   AT   VAA AAA   A A AA  GA  AS 
    36   44 B E    >   -     0   0   41 2228   84   Q MAS   P                     TF  KS   TR   RVT NIV   V S TG  LS  VM 
    37   45 B I  T 3  S+     0   0   90 2237   79   D EEP   E                     QD  QP   PR   EPA HHA   P P QA  KP  PK 
    38   46 B G  T 3  S+     0   0   11 2241   60   G GKG   G                     GG  GN   HG   NGG GGG   G G GG  GG  GG 
    39   47 B M  S <  S+     0   0    7 2243   67   A EKR   S                     SS  DS   SD   SSS AAH   S S SS  MQ  QE 
    40   48 B S  S >  S+     0   0   11 2247   63   W WWW   W                     WW  WW   LS   WWW WWW   W W WW  SW  WW 
    41   49 B P  T 3  S+     0   0    5 2251    4   P PPP   P                     PP  PP   PP   PPP PPP   P P PP  PP  PP 
    42   50 B W  T 3  S+     0   0    2 2253   18   W WWW   W                     WW  WW   WW   WWWWWWW   W W WW  WW  WW 
    43   51 B Q  E <   -J   59   0C   2 2256   32   I QQQ   Q                     QQ  QQ   QQ   QQQDQQQ   Q Q QQ  QQ  QQ 
    44   52 B V  E     -JK  58  91C   0 2257   34   V VVV   V                     AV  AV   VV   VAVIVVV   V V AV  AV  VI 
    45   53 B M  E     -JK  57  90C   0 2256   51   S SSS   S                     SS  QD   TV   SSSRSSS   S S SS  LS  SS 
    46   54 B L  E     -JK  56  89C   0 2257   14   L LLL   L                     IL  LL   LL   LLMPLLL   L L IL  LI  IL 
    47   55 B F  E     -JK  54  88C   0 2256   82   q LQQ   q                     Nh  RV   lL   QQhGRQH   Q h Nq  lT  TS 
    48   56 B R  E   > -JK  53  87C  76 1547   74   r WVr   .                     L.  .V   r.   yRfRwYL   . . L.  fY  YY 
    49   57 B K  T > 5S+     0   0   41  951   80   g ..f   p                     Kp  S.   kD   g...p..   D p Kp  ..  .. 
    50   58 B S  T 3 5S+     0   0   72 1192   73   R ..G   K                     AI  TN   VS   S...SW.   S K AT  ..  .. 
    51   59 B P  T 3 5S-     0   0   69 2030   82   F HNN   Y                     TY  SG   SK   NS..GGG   T Y TY  RN  EK 
    52   60 B Q  T < 5 +     0   0   62 2193   78   L NQP   G                     EG  GT   EK   FGRNIIK   G G EG  NG  GG 
    53   61 B E  E   < -J   48   0C  77 2221   95   A EKF   G                     EG  FR   HK   YRFRGIN   F G EG  RV  VQ 
    54   62 B L  E     +J   47   0C  17 2246   57   H HHH   H                     FH  PH   AL   HFHFHHH   H H FH  LH  HT 
    55   63 B L  E     -     0   0C  17 2261   70   I LIQ   F                     YF  FN   YA   TFIFFFV   F F YF  KV  VV 
    56   64 B b  E     -J   46   0C   1 2264    1   C CCC   C                     CC  CC   CC   CCCCCCC   C C CC  CC  CC 
    57   65 B G  E     +J   45   0C   2 2264    3   A GGG   G                     GG  GG   GG   GGGGGGG   G G GG  GG  GG 
    58   66 B A  E     -J   44   0C   0 2264   13   G GGG   G                     GG  GG   GA   GGGGGGG   G G GG  GG  GG 
    59   67 B S  E     -JL  43  67C   0 2264   40   S SSS   S                     SS  SS   SV   TSTSATS   S S SS  VS  SS 
    60   68 B L  E     + L   0  66C   0 2264   10   L LLL   L                     LL  LL   LL   LLLLLLL   L L LL  LL  LL 
    61   69 B I        -     0   0   23 2264   15   V III   I                     II  II   II   IIILLII   I I II  IV  VI 
    62   70 B S  S    S-     0   0   32 2264   62   K SGT   S                     NN  HD   SH   SNSTNNS   S S NN  HS  ST 
    63   71 B D  S    S+     0   0   61 2210   68   D NSK   S                     KS  PK   RP   NQDAKKD   E S KK  PK  ED 
    64   72 B R  S    S+     0   0   80 2263   73   R RRN   E                     GE  QQ   ES   QEQEQRR   D E GD  SQ  KS 
    65   73 B W  E     - M   0 132C  12 2264   12   W WWW   W                     WW  WW   WW   WWWWWWW   W W WW  WW  WW 
    66   74 B V  E     -LM  60 131C   0 2262   11   V VVV   V                     VV  VV   IV   VVVVVVI   V V VV  VV  VV 
    67   75 B L  E     +LM  59 130C   0 2263   23   L VLL   L                     LL  LV   AL   LLLVLLL   V L LL  LL  LL 
    68   76 B T  E     - M   0 129C   0 2263   28   T TTT   T                     TT  TT   TT   TTTTTTT   T T TS  TT  ST 
    69   77 B A    >   -     0   0    0 2262    2   A AAA   A                     TA  AS   AA   AAAAAAA   A A TA  AA  AA 
    70   78 B A  G >> S+     0   0    0 2263    6   A AAA   A                     AA  TG   AA   AAAAAAA   A A AA  AA  AA 
    71   79 B H  G 34 S+     0   0   10 2264    3   H HHH   H                     KH  HH   HH   HHHHHHH   H H KH  HH  HH 
    72   80 B b  G <4 S+     0   0    0 2264    1   C CCC   C                     VC  CC   CC   CCCCCCC   C C VC  CC  CC 
    73   81 B L  T <4 S+     0   0    1 2264   68   T FIV   L                     FL  VF   AM   IFIIVVL   G L FF  LF  FF 
    74   82 B L  E  <  +P   81   0D  46 2264   89   R QFS   P                     AP  SD   KD   SSVLDNR   V S AQ  EP  PD 
    75   83 B Y  E > > -P   80   0D  49 2249   82   D RGG   G                     LR  SQ   DE   SSTEDDE   R G LD  DR  SS 
    76   84 B P  G > 5S+     0   0   52 2249   88   A SHT   V                     MI  RR   KS   RTNGGGS   T V MS  KE  EQ 
    77   85 B P  G 3 5S+     0   0   75  844   90   R L..   .                     ..  .P   YK   T..EFT.   . . ..  A.  .. 
    78   86 B W  G < 5S-     0   0  166  852   93   D N..   .                     ..  .Y   PK   Y..VKK.   . . ..  N.  .. 
    79   87 B D  T < 5 +     0   0  152  869   93   P T..   .                     ..  .A   AL   R..TPP.   . . ..  Y.  .. 
    80   88 B K  E   < +P   75   0D  51  904   83   L S..   .                     ..  .Y   EL   V..KYH.   . . ..  R.  .. 
    81   89 B N  E     +P   74   0D 110  936   80   Q H..   .                     ..  .I   DV   F..DVV.   . . ..  VH  .. 
    82   90 B F        -     0   0   28 1017   94   W Y..   .                     ..  .P   MR   L.SDTTW   . . ..  RL  .. 
    83   91 B T    >>  -     0   0   70 1164   86   R M..   .                     ..  .L   RL   G.LFMLI   . . .L  LL  H. 
    84   92 B E  G >4 S+     0   0   35 1455   85   A V.R   S                     PT  RS   IG   KSRIGGP   . S PG  GD  SK 
    85   93 B N  G 34 S+     0   0  127 1677   87   V L.P   E                     aT  PY   WE   HTSIDEL   . E aT  ED  KV 
    86   94 B D  G <4 S+     0   0   49 1292   82   . ..S   S                     dS  TY   ..   .SWR...   S T d.  ..  ES 
    87   95 B L  E <<  +K   48   0C   0 1493   89   . ..E   S                     IS  DE   ..   .NTL...   H T I.  ..  SQ 
    88   96 B L  E     -KN  47 108C   3 2025   51   M Lvl   l                     Vl  lF   L.   .lLG..f   L l Vv  .y  yy 
    89   97 B V  E     -KN  46 107C   0 1516   29   . .vv   v                     Vv  i.   ..   .v....v   V v Vv  .v  vv 
    90   98 B R  E     -KN  45 106C   0 1577   87   . .KS   Y                     YF  RR   ..   .YY...Q   V Y YK  .K  RY 
    91   99 B I  E     +KN  44 105C   0 1674   49   . .ML   L                     LL  LL   ..   .LFK..L   A L LL  .L  LL 
    92  100 B G  S    S+     0   0    7 1756   23   G .GS   G                     GG  GG   G.   .GGL..G   G G GG  .G  GG 
    93  101 B K        +     0   0   13 1789   76   T .IR   R                     RK  AE   S.   .RRS..S   E R RL  .A  AV 
    94  102 B H        +     0   0   36 1883   76   N GTH   R                     QT  HH   HY   NKESSSI   F R QQ  YH  HY 
    95  103 B S  B     -Q  181   0E  21 1965   75   T AQQ   T                     TT  NR   DD   LNTESRH   D T TS  DQ  QQ 
    96  104 B R  S    S+     0   0   16 2018   82   V NLL   Q                     QQ  RE   LL   KQQRLLT   Q Q QQ  RL  LL 
    97  105 B T  S    S+     0   0   31 2112   87   N TQQ   Q                     NQ  RS   TR   TLSGTSD   S Q NS  RS  DS 
    98  106 B R  S    S-     0   0   85 2151   87   M LQG   G                     GG  AT   KR   NGGIGKQ   S G GG  KA  SN 
    99  107 B Y        -     0   0   21 2204   90   S ATG   V                     SV  NT   QW   NAPFDNP   S I SS  WY  YL 
   100  108 B E    >>  -     0   0   22 2250   66   Q NSN   N                     NN  LE   EE   ENNEDDR   E N NN  EN  SK 
   101  109 B R  T 34 S+     0   0  143 2252   78   A GTT   T                     PT  GG   SK   PPSEGSQ   E I PP  KP  EN 
   102  110 B N  T 34 S+     0   0  133 2255   82   Y QMN   H                     YY  MW   SW   GNNNTTS   N Y YY  TD  DP 
   103  111 B I  T <4 S+     0   0   58 2257   77   T PAT   E                     EE  EE   RE   SEEEEEV   I E EQ  EA  AN 
   104  112 B E     <  -     0   0    0 2258   77   K HVQ   T                     II  QE   VL   MVERRIT   Q T II  QV  KT 
   105  113 B K  E     -N   91   0C  69 2257   91   R KTV   S                     SN  DI   KD   ASNSTTH   V S ST  DV  VV 
   106  114 B I  E     -N   90   0C  11 2259   71   I LVN   R                     RR  II   RL   IRRTIIR   L R RK  FR  SS 
   107  115 B S  E     -N   89   0C  12 2260   84   K APV   N                     TT  KK   SD   STGTIKV   K N TT  QT  TS 
   108  116 B M  E     -N   88   0C  58 2260   71   V lVG   V                     VV  VG   VI   PVVVTTF   I V VV  IV  VG 
   109  117 B L  E     +O  133   0C   6  452   51   . i.V   .                     ..  ..   ..   .......   . . ..  ..  .V 
   110  118 B E  E    S+     0   0C  92 1908   74   K GQA   A                     TS  EE   IK   ATSQRK.   A A TV  EM  EK 
   111  119 B K  E     -O  132   0C  92 2029   65   A RDQ   K                     KV  KK   KE   KKQERKK   E K KQ  EK  YR 
   112  120 B I  E     -O  131   0C  20 2160   45   I III   I                     II  IL   KV   IIIVVVI   V L IV  LV  II 
   113  121 B Y  E     -O  130   0C  66 2224   50   S IVF   I                     IT  IF   IF   VIIIFFI   F F II  IF  II 
   114  122 B I  E     -O  129   0C  52 2228   82   I LIV   V                     KV  MI   QV   VRVIIII   K V KN  MT  TI 
   115  123 B H    >   -     0   0   25 2247   20   H HHH   H                     HH  HH   NH   HHHHHHH   N H HH  HH  HN 
   116  124 B P  T 3  S+     0   0  106 2258   50   P PKS   S                     PP  PP   PP   EPPPPPP   P S PP  PH  PK 
   117  125 B R  T 3  S+     0   0  162 2261   76   D KHG   S                     NS  GK   HN   NNDNSGQ   K S NN  NN  SA 
   118  126 B Y    <   -     0   0   15 2261   15   F YFY   Y                     YY  YY   YY   WYYHYYT   F Y YY  YY  YY 
   119  127 B N  B > > +R  125   0F  41 2262   68   I sNG   N                     Nn  Rk   NS   dSNDGgE   n N Nn  sV  LQ 
   120  128 B W  T 3 5 +     0   0   62 1485   76   . e..   .                     .l  Kg   ..   yF...w.   f . ..  r.  .Y 
   121  129 B R  T 3 5S+     0   0  192 1311   77   M AP.   S                     ..  Pd   AK   .M.P..N   . S .p  .E  QE 
   122  130 B E  T < 5S-     0   0  101 1657   80   E SIS   N                     .T  VY   PS   .TNN..T   . N .S  .E  EG 
   123  131 B N  T   5S-     0   0    4 2142   69   T SgK   T                     SN  GT   TT   RNtN.YS   T T SN  TG  GS 
   124  132 B L    > < +     0   0   25 1817   69   Y .iM   N                     L.  LG   TT   I.fYFN.   V N L.  SS  S. 
   125  133 B D  B 3   +R  119   0F   7 2115   65   E .EF   D                     DE  AD   DD   RDNDGI.   R D DD  DQ  QS 
   126  134 B R  T 3  S-     0   0   43 2196   57   N GNN   N                     SN  HY   YN   NNNIYYA   N N SN  NG  GG 
   127  135 B D    <   +     0   0    0 2261    0   D DDD   D                     ND  DD   DD   DDDDDDD   D D ND  DD  DD 
   128  136 B I        +     0   0    0 2264   11   I III   I                     LI  II   II   ILIIAAI   I I LI  II  II 
   129  137 B A  E     -MO  68 114C   0 2263   48   A AAA   A                     AA  AA   AA   ACAAAAA   T A AA  AA  AA 
   130  138 B L  E     -MO  67 113C   0 2264    6   L LLL   L                     LL  LL   LL   LLLLLLL   L L LL  LL  LL 
   131  139 B M  E     -MO  66 112C   0 2264   30   F VAL   L                     LL  IV   LL   ILMVLLL   L L LV  LL  LI 
   132  140 B K  E     -MO  65 111C  19 2264   49   Y ELR   R                     KH  KK   QH   KKKRQKK   K R KK  LQ  QE 
   133  141 B L  E     - O   0 109C   0 2264    8   L LLL   L                     LL  LL   LL   LLLLLLL   L L LL  LL  LL 
   134  142 B K  S    S+     0   0  111 2264   73   K EAS   S                     SS  LK   DA   ASSAKKV   A S SD  NK  SE 
   135  143 B K  S    S-     0   0  171 2264   76   K RFS   S                     SS  KR   KQ   TSTEKKS   T S SS  KS  SK 
   136  144 B P        -     0   0   73 2264   40   P PPP   A                     PA  PP   AP   PPSRRRR   P A PS  PP  PP 
   137  145 B V        -     0   0   11 2220   48   V IVV   V                     VV  AA   VA   VVVIVVV   A V VV  AV  VV 
   138  146 B A        -     0   0   75 2253   81   M QNQ   T                     TT  NV   ET   TSTARRT   R T TT  TT  TT 
   139  147 B F        +     0   0   87 2257   43   F YFF   F                     FF  LF   FL   FFFFFFF   F F FF  FF  FF 
   140  148 B S        -     0   0   40 2259   60   N TST   N                     SS  NY   NS   STTTSNT   S T SN  TS  ST 
   141  149 B D  S    S+     0   0   81 2262   69   D DAD   D                     DN  RK   EQ   DNDDQKP   E N DD  KR  RP 
   142  150 B Y  S    S+     0   0   81 2252   87   Y YSY   Y                     YY  HR   YT   TYYYYYF   T Y YY  YN  YY 
   143  151 B I        +     0   0    0 2256   24   I III   I                     II  VV   VI   IIIIIII   V I II  II  II 
   144  152 B H        -     0   0    4 2256   79   Q LQR   R                     KR  NH   RV   MRRLRRL   S R KE  LR  RL 
   145  153 B P        -     0   0    9 2256   44   P PPP   P                     PP  LS   PP   APPPPPP   P P PP  PP  PP 
   146  154 B V        -     0   0    1 2260   37   I IVV   V                     VV  VV   II   AVVVVVI   V V VV  IV  IV 
   147  155 B a  B     -c  242   0B   3 2260   46   C CCC   C                     CC  CC   CC   CCCCCCC   C C CC  CC  CC 
   148  156 B L        -     0   0   32 2260    9   L LLL   L                     LL  LL   LL   LLLLLVL   L L LL  LL  LL 
   149  157 B P        -     0   0    0 2259   30   P PPA   A                     AA  PP   PP   PAAPPPP   P A AA  PP  PP 
   150  158 B D     >  -     0   0   51 2255   78   F AEA   A                     AA  DE   ED   DASTSSS   Q A AA  TA  AP 
   151  159 B R  H  > S+     0   0  148 1806   76   D A.S   Q                     AQ  .K   AS   SPSVSQV   A Q AA  KA  AP 
   152  160 B E  H  > S+     0   0  122 1873   75   V S.G   N                     GN  .S   QG   GESESNT   T N GG  EN  NA 
   153  161 B T  H  > S+     0   0   10 2003   82   F VKS   S                     SS  .W   KL   ESSDSSK   D S SN  LA  AS 
   154  162 B A  H  X S+     0   0    7 2020   84   Q QAW   V                     VV  AS   RA   ITQATPK   E V VT  AT  SE 
   155  163 B A  H  < S+     0   0   70 2078   68   N FFF   Y                     FF  VP   AE   LFFRALL   F Y FY  EF  FL 
   156  164 B S  H  < S+     0   0   36 2215   78   L PMN   S                     VP  PP   Ir   SFHRPPK   P S VA  qP  PP 
   157  165 B L  H  < S+     0   0    1  515   98   . ...   .                     ..  A.   .l   ...L...   . . ..  l.  .. 
   158  166 B L     <  +     0   0   34  711   82   . .V.   .                     ..  P.   .N   ...L...   . . ..  V.  .. 
   159  167 B Q  S >  S-     0   0   87  836   93   D .Q.   .                     ..  T.   .Q   ...TPPI   . . ..  K.  .. 
   160  168 B A  T 3  S+     0   0   51 2039   74   E AAN   A                     DN  DD   EA   DTTAPPP   P A DA  KN  NA 
   161  169 B G  T 3  S+     0   0   42 1713   37   N GGG   G                     GG  GG   GG   GGSLGG.   G G GG  GG  GG 
   162  170 B Y    <   -     0   0   46 1826   85   T MTT   T                     TT  TA   SQ   ATTPTTA   L T TT  EL  LT 
   163  171 B K  E     -D  188   0B  33 2112   87   K KED   S                     AS  RG   QE   PTPVVVS   M S AL  SQ  HK 
   164  172 B G  E     -D  187   0B   0 2154   45   C CCS   S                     SS  CC   ST   CSCGCCC   C S SS  VC  CC 
   165  173 B R  E     -DE 186 232B   3 2164   80   F WWW   W                     WW  WY   LL   YWWSSSW   V W WW  VT  TW 
   166  174 B V  E     -DE 185 231B   0 2189   33   I VVV   I                     VI  IV   IV   VVAIIIV   T I VV  VV  VV 
   167  175 B T  E     +D  184   0B   0 2202   48   S TTT   T                     TT  TT   ST   TTTSTTT   T T TT  TT  TT 
   168  176 B G  E     -D  183   0B   1 2202    0   G GGG   G                     GG  GG   GG   GGGGGGG   G G GG  GG  GG 
   169  177 B W  S    S+     0   0    1 2202    1   W WWW   W                     WW  WW   WW   WWWWWWW   W W WW  WW  WW 
   170  178 B G  S    S-     0   0    0 2198    1   G GGG   G                     GG  GG   GG   GGGGGGG   G G GG  GG  GG 
   171  179 B N        -     0   0   33 2021   77   R NKN   D                     YN  RR   T    RTNRTAK   R D YK   N  HD 
   172  180 B L  S    S+     0   0   55 1822   62   T IVV   V                     LI  LT   L    LTLTTTV   T I LL   T  VI 
   173  181 B K  S    S-     0   0  147 1551   78   K RKA   Q                     NQ  AA         SGMSRK   K R NS   H  AK 
   174  182 B E              0   0   49 1397   62   E EEE   A                         SE         SKQEEE     A  S   H  PE 
   175  183 B T              0   0  181 1202   57   E GEE   G                         GN         SDDGG      G  A   S  SG 
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66            PP        PPP  T Q E   PQ  PAS  G          DA          S    
   178  186 C Q        -     0   0   64  328   73            PP   P    SPP  TSPSN   GS  PDH  P          DD          RT  G
   179  187 C P        -     0   0    8  503   39  P P     P PPPPPSPPPPTPP PPPSGPP  ST  PKP  HPS        GG      PP  PP  S
   180  188 C S  S    S+     0   0   81  526   81  T N     N FFSSDDENNNRFF RANDEDD  NS  FND  NDD        DD      DD  SK  D
   181  189 C V  B    S-Q   95   0E  21  534   82  V A     R PPQVVTLTTHTPP VRNMRRR  VI  PKK  LHI        KK      IT  VK  I
   182  190 C L        -     0   0    5  625    5  L L   LLL LLLLLLLILLLLL LLALLLL  LL  LLL  LLL        LL L L  LL  LL  L
   183  191 C Q  E     -BD  34 168B   9  629   50  Q R   MMQ KKQQQRQQRIEKK QQQQQYQ  QQ  KQQ  RLK       RQQ Q Q  QN  HQ  Q
   184  192 C V  E     +BD  33 167B   6  628   86  C Q   VVC QQYECGCCEEEQQ KQKECEC  EQ  QCK  TAA       QCC Q E  CC  EC  Q
   185  193 C V  E     - D   0 166B  15  634   49  V V   LLL VVVVGVLAAVVVV LVAVLAL  AA  VLV  VVV       ALL V A  VA  AV  A
   186  194 C N  E     + D   0 165B   7  634   77  N E   NND KKNDVSDDEEDKK AAMNDVN  SV  KNK  TNS       ENN D Q  NE  DD  T
   187  195 C L  E     - D   0 164B   0  638   34  V V   VVV VVVVVLAVVLVVV VLVIAVA  IM  VIL  VLV       LLL V V  IV  QL  V
   188  196 C P  E     - D   0 163B  12  639   46  D E   PPP PPNEYPPHEKPPP PPPTPPP  PP  PPQ  PRP       PPP T P  QK  FH  E
   189  197 C I  E     -F  210   0B   9  640   33  I I   RRI IIIVTLLLIIVIILILIIIII  LL  IIL  IIA       III I F  II  II  V
   190  198 C V  E     -F  209   0B  10  641   39  S I   LLV MMVIILLVIVVMMVIVVILHL  VV  MLV  IVL       WLL I I  VF  II  I
   191  199 C E    >>  -     0   0   75  641   66  S S   MMS EESPSPAPSDGEETDTSDSDS  DD  ESS  HDG       RSS E A  SP  ES  D
   192  200 C R  H 3> S+     0   0   86  640   78  D N   TTD NNQNNPQRNANNNHTVMRDWS  QD  NYD  KRD       NHH A L  DQ  NN  N
   193  201 C P  H 3> S+     0   0   77  641   74  Q D   QQE HHSEEAEQDKDHHKPNSKAAS  RA  RST  KEG       DAA K D  KK  DD  T
   194  202 C V  H <4 S+     0   0   41  641   84  Q I   DDD IIQREKQDVEEIITRQQKDKA  AT  IDD  NEM       DDD K R  AK  LV  V
   195  203 C c  H >< S+     0   0    5  645    1  C C   CCC CCCCCCCCCCCCCCCCCCCCC  CC  CCC  CCC       CCC C C  CC  CC  C
   196  204 C K  H >< S+     0   0   91  645   74  R N   LLD DDAQSNEENAGDDKNRKSRNS  ES  DND  RAY       DDD Q S  QE  NA  N
   197  205 C D  T 3< S+     0   0  141  645   80  K Q   QQR AASRRAARRSSAARLQQKNQS  ER  ANA  ASY       RNN S N  GD  KQ  Q
   198  206 C S  T <  S+     0   0   15  645   87  A V   QQA KKSWLSAAVSLKKALYSYSSA  QN  KSE  AKR       SSS M S  AA  LV  W
   199  207 C T    <   -     0   0   25  645   71  Y H   SSY YYTFYYYYSKHYYYYWYYYLY  YR  YYH  YEY       YYY Y N  YY  LH  L
   200  208 C R  S    S+     0   0  249  645   89  P v   rrP hhyrpAPPvyghhksGGkPAP  Rr  hPG  Qff       FPP h v  PP  rs  k
   201  209 C I  S    S-     0   0   56  565   53  G g   ggG gggggGGGgggggffSssGgG  ns  gGS  pgi       QGG g g  GG  s.  d
   202  210 C R        -     0   0  123  556   82  A A   nnM rrqt.AQQarErrLaRtEMlQ  pR  rME  kkn       PMM T a  GQ  fk  e
   203  211 C I        -     0   0   12  633   24  I V   III IIIIIIIIVIIIIIIIIIIFI  IF  IIF  III       III I I  II  VV  V
   204  212 C T    >   -     0   0   12  638   73  T S   TTT VVRHTTTTSETVVSKTNTTTT  TN  VTM  TKH       NTT N L  TT  IT  T
   205  213 C D  T 3  S+     0   0   82  642   69  S S   EER RRSDRRDQSSERRGDDDDDDS  AA  RNP  DDY       EQQ T P  PD  NE  S
   206  214 C N  T 3  S+     0   0   11  645   72  G G   YYR ddTVNDNNGNRddNDSLDANN  Rk  dAk  STd       NSS d G  SG  kF  N
   207  215 C M  E <   - G   0 263B   9  637   30  M M   MMM mmMFMMMMMMMmmMMMKMMMM  Mm  mMi  MMm       FMM m M  MM  mM  M
   208  216 C F  E     - G   0 262B  19  643   34  V I   FFV LLILLLVVIVILLMLIILFIF  RL  LFF  IIF       IFF F L  VV  IL  M
   209  217 C c  E     -FG 190 261B   0  643    1  C C   CCC CCCCCCCCCCCCCCCCCCCCC  CC  CCC  CCC       CCC C C  CC  CC  C
   210  218 C A  E     +FG 189 260B   0  643   10  A A   AAA AAAAAAAAAAAAAAAAAAAVA  AA  AAA  AAA       AAA A A  AA  AA  A
   211  219 C G        -     0   0    4  643   18  G G   GGG GGAGGGGGGVGGGGGGGGGGG  GG  EGR  AYG       GGG G G  GG  YG  G
   212  220 C Y        -     0   0   31  452   71  V F   YYY ..AYLFF.F.Y..WF.YDFYF  ..  .YY  VAE       YYY H F  DS  .S  Y
   213  221 C K     >  -     0   0   67  484   87  P L   SSM ..SKSRL.L.L..KA.LKLEL  I.  .LK  LER       SLL E L  WS  HW  E
   214  222 C P  T >4 S+     0   0   63  534   70  Q T   DDD ..GESAE.RAS..SE.SREEE  Y.  .EP  GHR       DEE S E  QK  PM  S
   215  223 C D  T 34 S+     0   0  132  572   39  G G   GGG ..KGGGGDGKG..GG.GGGGG  GP  .GG  RKG       GGG G G  GG  EG  G
   216  224 C E  T 34 S-     0   0   83  609   46  G K   SSG ..DGGGGEKGG..KKGDRGGG  TD  .GG  KDG       GGG G G  GA  GG  G
   217  225 C G    <<  +     0   0   49  117   85  . R   ... NN.....K...NNA...K...  .R  N..  ...       ... . .  ..  ..  .
   218  226 C K        -     0   0  124  137   84  . .   ... TT.....Y...TT..A.....  .A  S..  ...       ... . .  ..  ..  .
   219  227 C R        +     0   0   81  180   80  . .   ... RR.....G...RR..G.....  PG  R..  ...       ... . .  ..  ..  .
   220  228 C G        +     0   0    3  583   68  K .   KKR RR.RTKKKLKKRR.KAK.KVK  KR  RKK  ..K       VKK K T  K.  KK  R
   221  229 C D  B     -A   30   0A  12  624   16  D D   DDD DD.DDDDDDDDDDDDSDDDDD  GA  DDD  D.D       DDD D D  DD  DS  D
   222  230 C A        +     0   0    9  640   48  S A   SSA SSASSASSAASSSTASAAASS  TT  SSS  AAS       ASS S A  ST  AT  A
   223  231 C d    >>  -     0   0   13  644    1  C C   CCC CCCCCCCCCCCCCCCCCCCCC  CC  CCC  CCC       CCC C C  CC  CC  C
   224  232 C E  T 34 S+     0   0   95  644   57  Q E   KKN QQQQQQQQEQHQQAKQKQQQQ  KE  QQQ  TQQ       QQQ Q Q  QQ  QS  Q
   225  233 C G  T 34 S+     0   0   20  645    8  G G   GGG GGGGGGGGGGGGGGGGGGGGG  GR  GGG  FGG       GGG G G  GG  GG  G
   226  234 C D  T X4  +     0   0    0  645    0  D D   DDD DDDDDDDDDDDDDDDDDDDDD  DD  DDD  DDD       DDD D D  DD  DD  D
   227  235 C S  T 3< S+     0   0   16  645    6  S S   SSS SSSSSSSSSSTSSSSSSSSSS  ST  SSS  SSS       SSS S S  SS  SS  S
   228  236 C G  T 3  S+     0   0    0  645    1  G G   GGG GGGGGGGGGGGGGGGGGGGGG  GG  GGD  GGG       GGG G G  GG  GG  G
   229  237 C G    <   -     0   0    0  645    4  G G   GGS GGGGGGGGGGGGGGGGGGGGG  GG  GGG  GGG       GGG G G  GG  GG  G
   230  238 C P  E     - H   0 246B   0  645    7  P P   PPP PPPPPPPPPPPPPGPPPPPPP  PP  PPP  PPP       PPP P P  PP  PP  P
   231  239 C F  E     -EH 166 245B   0  644   24  L L   HHL LLLLLLVLLLLLLLLLLLVLV  LL  LVV  LLA       LVV L L  LL  LL  L
   232  240 C V  E     -EH 165 243B   2  643   42  V V   AAV VVVTVVVVVVVVVMVVLIVVV  VV  VVV  VVV       MVV V V  VV  VV  I
   233  241 C M  E     - H   0 242B   0  643   64  C I   TTC CCSLCCCCIAYCCCCCCCCAC  CC  CCY  FSQ       MCC L C  CC  CC  I
   234  242 C K  E     - H   0 241B  11  644   80  G A   HHY KKGSKENGADNKKPLQAKGYS  ER  KNK  KGY       RNN Y E  RN  QD  K
   235  243 C S     >  -     0   0    1  642   84  G R   YYG VVGIDGGNNNSVVnVKERGPG  SG  VGG  KGV       YGG D e  GG  FG  V
   236  244 C P  T  4 S+     0   0   47  109   82  . .   ... .....R.......p.....S.  ..  ...  ...       ... . t  ..  ..  .
   237  245 C F  T  4 S+     0   0  145  304   83  . D   ... .....V.......S.....N.  ..  ...  ..S       .VV T A  ..  GV  S
   238  246 C N  T  4 S-     0   0   63  501   60  Q R   RRE NN.EE...dKENNKGGG..nQ  KK  NED  ...       D.. e E  K.  K.  N
   239  247 C N     <  +     0   0   85  373   58  . S   GG. GG.G....n..GGLRNS..d.  G.  G..  ..G       S.. d H  ..  H.  .
   240  248 C R        -     0   0   59  432   80  . I   TT. TT.R....I..TTVSTS..Q.  R.  T..  ..R       R.. K Q  ..  T.  R
   241  249 C W  E     - H   0 234B   1  442   42  . W   WW. WW.K....W..WWYWWW..Y.  WG  W..  ..A       W.. W L  ..  W.  L
   242  250 C Y  E     -cH 147 233B  19  521   85  . Y   XX. LLVT..ERY..LLSLVTVEY.  VL  L..  QRI       I.. F T  .A  V.  Y
   243  251 C Q  E     + H   0 232B   0  638   57  L L   LLV QQLLL.LLLLLQQVQLLFLQL  LQ  QLL  VLL       QLL Q L  LL  QL  V
   244  252 C M  E     +     0   0B   0  642   82  Q I   TTH AAVIQLQRIVVAAQAIARQIQ  MV  AQI  CVA       LQQ Y R  QQ  VQ  Y
   245  253 C G  E     -IH 264 231B   0  645    0  G G   GGG GGGGGGGGGGGGGGGGGGGGG  GG  GGG  GGG       GGG G G  GG  GG  G
   246  254 C I  E     -IH 263 230B   0  645   23  L I   IIL VVVLIIVLIVLVVIGVIIVVV  VI  VVL  IVI       VVV I V  LI  II  I
   247  255 C V  E     +I  262   0B   5  643   28  V V   XXV VVVVVVVVVVVVVTVVVVVVV  TV  VVV  VVV       VVV V I  VT  VT  V
   248  256 C S  E     -     0   0B   6  644    5  S S   SSS SSSSSSSSSSSSSSSSSSSSS  SS  SSS  SSS       SSS S S  SS  SS  S
   249  257 C W  E     +I  261   0B  35  642   16  W W   WWW WWWWWWWWWWWWWFWWFFWWW  WW  WWW  FWW       FWW W W  WW  WW  W
   250  258 C G        -     0   0   36  645    5  G G   GGG GGGGGGGgGGGGGGGGGGGGG  sG  GGG  GGG       GGG G G  gg  Gg  G
   251  259 C E  S    S-     0   0   61  627   89  M I   QQQ EEYIMHYvMNREEDETNDYYY  nH  EYY  IYE       NYY Y S  ed  Iq  Y
   252  260 C G  S    S-     0   0   21  637   41  e D   GGG GGGGqSGPDGGGGGGsGDGGG  GG  GGG  GGG       KGG G G  QP  GP  D
   253  261 C d  S    S-     0   0   12  642    1  c C   CCC CCCCcCCCCCCCCCWcCCCCC  CC  CCC  CCC       CCC C C  CC  CC  C
   254  262 C D  S    S+     0   0   28  643   37  G G   AAA AAAGGAAGGAAAAGANAGAGA  AS  AAA  AAA       GAA A G  GG  GA  G
   255  263 C R    >   -     0   0  128  645   82  R K   TTL QQYRRTQSKFRQQGRVKKENQ  DT  QEC  SDR       EEE Y D  LR  EL  K
   256  264 C D  T 3  S+     0   0   93  645   73  P K   VVP PPSERPKKEDPPPKRRPPPPK  SR  PPP  SVA       PRR P R  SS  EP  V
   257  265 C G  T 3  S+     0   0   29  629   69  G N   GGN NNNHGRNENGNNNNNQYKDNN  GG  NGD  RKG       GDD N N  ND  AR  R
   258  266 C K    <   -     0   0   90  639   88  Y K   HHY RRYLKFKKKYLRRKRPYKHSK  YL  RNI  YYK       YHH M K  HR  VR  K
   259  267 C Y        -     0   0   14  641   48  P P   FFP PPPPPPPPPPPPPFPAPPPPP  AY  PPP  PPP       PPP P P  PP  PP  P
   260  268 C G  E     -G  210   0B   3  618   10  G G   GGG GGGGGGGGGGGGGGG.GGGGG  GG  GGG  GGG       GGG G G  GG  GS  G
   261  269 C F  E     -GI 209 249B   3  639   18  V L   VVV IIVVVVVVVVVIIIVIVVVVV  VA  IVV  VVV       VVV V V  VV  VL  V
   262  270 C Y  E     -GI 208 247B   2  644    4  Y Y   YYY YYYYYYYYYYYYYYYYYYYYY  YY  YYY  YYY       YYY Y Y  YY  YY  Y
   263  271 C T  E     -GI 207 246B   2  644   35  T T   TTV TTATTTTTTATTTTITSTATA  AT  TAT  TAT       TAA T T  TT  TT  T
   264  272 C H  E  >  - I   0 245B  31  644   59  N R   RRK RRDNRARNKDYRRARRYRKNK  DR  RKR  DDE       RKK I D  NN  RK  K
   265  273 C V  T >4 S+     0   0    0  643   15  L V   VVV VVVIVVVVVVVVVVVVVLVVV  VV  VVV  VVV       LVV I V  LI  VV  V
   266  274 C F  G >4 S+     0   0   39  642   74  C T   SSC TTAQCACCTAATTYTSPsCTC  VQ  TCS  MAS       TCC S A  CC  SV  S
   267  275 C R  G 34 S+     0   0  132  642   86  K R   QQE YYAKEGNRRVSYYNSKNnNRN  YT  YIN  YHY       QVV S N  KR  GR  N
   268  276 C L  G  S+     0   0   57  641   79  S R   IIL LLRVTQVHRHKLLNHSKLVEV  KE  LNE  KRL       LSS L L  TL  SR  V
   270  278 C K  H  > S+     0   0  164  641   65  N D   EEY DDSPAKDQDTKDDGANTSSDS  DN  DDS  PSD       DGG D A  RD  KK  T
   271  279 C W  H  > S+     0   0   37  641    0  W W   WWW WWWWWWWWWWWWWWWWWWWWW  WW  WWW  FWW       WWW W W  WW  WW  W
   272  280 C I  H  X S+     0   0    1  641   10  I I   LLI IIVIIIIVIIVIIIIIIIIII  II  ILI  III       IVV I I  II  II  I
   273  281 C Q  H >X S+     0   0   79  605   76  R K   QQD HH EHYQRKEEHHRHNDNQRR  RM  HTA  EEE       RRR E Q  QK  IQ  N
   274  282 C K  H >X S+     0   0  135  595   73  E S   KKD HH KDKERSDDHHYHQSSSSS  QR  RSK  KKN       DDD A K  NK  KD  S
   275  283 C V  H 3< S+     0   0   15  570   82  T K   LLV YY VTATTKTTYYVIVIRTFT  TH  YTT  STR       HTT T H  TT  ST  N
   276  284 C I  H << S+     0   0   49  556   45  I T   MML VV MMLMITAIVVIIVTIMLM  VI  V M  IAT       TMM T I  MI  MI  L
   277  285 C D  H <<        0   0  114  506   74  R N   RR  PP GRTA NEAPPDPAR RNS  S   P    KDS       KAA E A  RG  N    
   278  286 C Q     <        0   0  142  322   66        SS  KK KRE   S KKHESS N S      K     ES       DNN   S           
## ALIGNMENTS  561 -  630
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....7....:....8....:....9....:....0....:....1....:....2....:....3
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  I  MIII  IV I II   IIIIIIII L     IIIIII  IIIIV  I     IIII I V  II   
    30   38 B V  B     +A  221   0A  13 2209   20  V  VVTT  IV V VV   VVVVTVVV V     VVVVVV  VVVVV  V     VTVV V V  VV   
    31   39 B E  S    S+     0   0  131 2214   31  G  GGGG  GG G GG   GGGGGGGG N     GGGGGG  GGGGGNNG     GGGG N G  SN   
    32   40 B G        -     0   0   30 2221    1  G  GGGG  GG G GG   GGGGGGGG G     GGGGGG  GGGGGGGG     GGGG G G  GG   
    33   41 B S  E     -B  184   0B  74 2221   88  T  QRQQ  TQ Q QQ   EQQNSRYY K     QQGAQS  SSSDETTA     QSQE E Q  QE   
    34   42 B D  E     -B  183   0B  99 2227   62  N  DPDD  TD D DA   NNNDSNEE E     DDNDDD  DDDLDDDN     KNDA D D  DD   
    35   43 B A        -     0   0    5 2227   45  S  AAAA  AA T AA   AAAAAACC T     AAAAAA  AAAVVAAA     AAAA A A  AA   
    36   44 B E    >   -     0   0   41 2228   84  M  SEAA  QV V VA   PPPIAGTT K     PPQVEL  SSSIRTTP     EVSA V V  QI   
    37   45 B I  T 3  S+     0   0   90 2237   79  K  EEAA  TA E EL   APPPLEPP W     AAAPLA  PPPPQAAE     EPPP P A  PP   
    38   46 B G  T 3  S+     0   0   11 2241   60  G  GGGG  GG G GG   GGGGGGHH G     GGGGGG  GGGGNGGG     GGGG G G  GG   
    39   47 B M  S <  S+     0   0    7 2243   67  E  EKRR  AH H RR   SSSEQASS E     FFSSES  SSSESAAA     EQSS S R  ES   
    40   48 B S  S >  S+     0   0   11 2247   63  W  WWWW  WW W WW   WWWIWWQQ S     WWWWWW  WWWIWWWW     WWWW W W  WW   
    41   49 B P  T 3  S+     0   0    5 2251    4  P  PPPP  PP P PP   PPPPPPPP P     PPPPPP  PPPPPPPP     PPPP P P  PP   
    42   50 B W  T 3  S+     0   0    2 2253   18  W  WWWW  WW W WW   WWWWWWWW W     WWWWWW  WWWWWWWW     WWWW W W  WW   
    43   51 B Q  E <   -J   59   0C   2 2256   32  Q  QQQQ  VQ Q QQ   QFFQQQQQ Q     QQQQQQ  QQQQQQQQ     QQQQ Q Q  QQ   
    44   52 B V  E     -JK  58  91C   0 2257   34  I  VVVV  VV V VV   VAAVVAVV V     VVVAVV  VVVVAAAV     VVAA V V  VV   
    45   53 B M  E     -JK  57  90C   0 2256   51  S  SSSS  SS S SS   SSSASSSS I     SSSSSS  SSSASSSS     SSGS S S  SS   
    46   54 B L  E     -JK  56  89C   0 2257   14  L  ILLL  LL L LL   LVVLILLL L     LLILLL  LLLLLLLL     IILL L L  LL   
    47   55 B F  E     -JK  54  88C   0 2256   82  S  QQYY  QH H QQ   hEEmTRNN L     QQHQHQ  nnnmQhhH     rTsY Q H  rQ   
    48   56 B R  E   > -JK  53  87C  76 1547   74  Y  R.LL  iL Y LF   f..rYH.. .     ..FYFM  fffryffH     hYf. . F  y.   
    49   57 B K  T > 5S+     0   0   41  951   80  .  ....  g. . ..   ...l.... D     ..N...  ....g...     .... D .  .D   
    50   58 B S  T 3 5S+     0   0   72 1192   73  .  .T..  K. . ..   .TTQ.... A     ..T.KE  ...SS...     ...N S .  .S   
    51   59 B P  T 3 5S-     0   0   69 2030   82  K  NLDD  IG G AG   .DDRDNSS K     STLFTR  ...TNVVN     .E.S T G  .T   
    52   60 B Q  T < 5 +     0   0   62 2193   78  G  GGDD  LK Q DR   .GGEGRGG K     PSGGQY  GGGGFDDV     RGGG G Q  EG   
    53   61 B E  E   < -J   48   0C  77 2221   95  Q  SRNN  AN T AA   GRRGNAYY K     SSSKGG  VVVEYGGE     RVSS F T  QF   
    54   62 B L  E     +J   47   0C  17 2246   57  T  HHFF  HH H HH   HPPVHHHH L     HHHHHH  SSSVHHHH     HHFF H Q  HH   
    55   63 B L  E     -     0   0C  17 2261   70  V  FRII  IV I II   FSSFVIFF A     FFIFVV  HHHFTVVV     VVSA F V  VF   
    56   64 B b  E     -J   46   0C   1 2264    1  C  CCCC  CC C CC   CCCCCCCC C     CCCCCC  CCCCCCCC     CCCC C C  CC   
    57   65 B G  E     +J   45   0C   2 2264    3  G  GGGG  GG G GG   GAAGGGGG G     GGGGGG  GGGGGGGG     GGGG G G  GG   
    58   66 B A  E     -J   44   0C   0 2264   13  G  GGGG  GG G GG   GGGGGAGG A     GGGGAA  GGGGGGGG     GGGG G G  GG   
    59   67 B S  E     -JL  43  67C   0 2264   40  S  SSSS  SS S SS   SSSSSTSS V     SSTSST  SSSSTTTS     SSSS S S  SS   
    60   68 B L  E     + L   0  66C   0 2264   10  L  LLLL  LL L LL   LLLLLLLL L     LLLLIL  LLLILLLL     LLLL L L  LL   
    61   69 B I        -     0   0   23 2264   15  I  IIII  VI I II   IIIIMIVV I     IIIIIV  IIILIIII     IVII I I  II   
    62   70 B S  S    S-     0   0   32 2264   62  T  TASS  KS S SS   NNNSSSSS H     NNSNSS  TTTSSTTA     SSTT S S  TS   
    63   71 B D  S    S+     0   0   61 2210   68  D  EREE  ND D EK   SDDEDHEE T     NNDKNN  KKKENNNP     PEDD E D  EE   
    64   72 B R  S    S+     0   0   80 2263   73  S  RQRR  KR R RN   QQQLQSYY S     QQQEKR  DDDRQQQN     HKQQ D R  ED   
    65   73 B W  E     - M   0 132C  12 2264   12  W  WWWW  WW W WW   WWWWWWWW W     WWWWWW  WWWWWWWW     WWWW W W  WW   
    66   74 B V  E     -LM  60 131C   0 2262   11  V  VVII  VI I IV   VVVVVVVV V     VVVVLL  VVVVVIIV     VVVV V I  VV   
    67   75 B L  E     +LM  59 130C   0 2263   23  L  LLLL  LL L LL   LLLILLVV L     LLLLLI  LLLILLLL     LLLL V L  LV   
    68   76 B T  E     - M   0 129C   0 2263   28  T  TTTT  TT T TT   STTTSTSS T     TTTTSS  TTTTTTTT     TSTT T T  TT   
    69   77 B A    >   -     0   0    0 2262    2  A  AAAA  AA A AA   AAAAAAAA A     AAAAAA  AAAAAAAA     AAAA A A  AA   
    70   78 B A  G >> S+     0   0    0 2263    6  A  AAAA  AA A AA   AAAAAAAA A     AAAASA  AAAAAAAA     AAAA A A  AA   
    71   79 B H  G 34 S+     0   0   10 2264    3  H  HHHH  HH H HH   HHHHHHHH H     HHHHHH  HHHHHHHH     HHHH H H  HH   
    72   80 B b  G <4 S+     0   0    0 2264    1  C  CCCC  CC C CC   CCCCCCCC C     CCCCCC  CCCCCCCC     CCCC C C  CC   
    73   81 B L  T <4 S+     0   0    1 2264   68  F  FILL  TL L LL   FLLLFFYY M     FFIVFL  IIILILLF     FFIS G L  LG   
    74   82 B L  E  <  +P   81   0D  46 2264   89  D  SKPP  KR Q QK   SSSVPSKK E     PPVAKY  EDDLGQQA     DPSD V K  DV   
    75   83 B Y  E > > -P   80   0D  49 2249   82  S  NRRR  DE K RG   SRRPSLSS G     RRTGYS  SDFEYIIN     GSFE T G  RR   
    76   84 B P  G > 5S+     0   0   52 2249   88  Q  TDTT  TS T TH   TDDTEPRR S     SANRND  SYFEAHHG     PEFP T S  NT   
    77   85 B P  G 3 5S+     0   0   75  844   90  .  .H..  .. . ..   S.....VV K     GN..AP  DRL.FII.     ..DI S W  ..   
    78   86 B W  G < 5S-     0   0  166  852   93  .  .S..  .. . ..   P.....EE K     SQ..DH  YGN.DSS.     ..LT D I  ..   
    79   87 B D  T < 5 +     0   0  152  869   93  .  .P..  .. . ..   S.....VV L     AL..VA  RIR.VRR.     ..FD V P  ..   
    80   88 B K  E   < +P   75   0D  51  904   83  .  .L..  .. . .W   G..N..RR I     SMR.RW  GTG.SAA.     ..FV V F  ..   
    81   89 B N  E     +P   74   0D 110  936   80  .  .V..  .. . .I   L..P..LL V     DNR.TR  IVI.DWW.     ..TK V L  ..   
    82   90 B F        -     0   0   28 1017   94  .  .W..  .W W .F   T..N..GG R     VPT.FA  TYT.IVV.     ..EL A Y  ..   
    83   91 B T    >>  -     0   0   70 1164   86  .  .E..  .I I .I   V..LHVEE L     TILTIY  VLV.YVVR     LHVG G T  ..   
    84   92 B E  G >4 S+     0   0   35 1455   85  K  SV..  .P P .P   Y..ESKHH G     VDSSYM  YGY.TYYD     NSHQ E V  Q.   
    85   93 B N  G 34 S+     0   0  127 1677   87  V  EWWW  RL F wy   L..DKVNN E     VFSTHG  LRLKyLLP     RKLN F R  p.   
    86   94 B D  G <4 S+     0   0   49 1292   82  S  TKNN  D. . t.   .DD.DSII .     ..WK..  ...V...S     .E.. . .  sS   
    87   95 B L  E <<  +K   48   0C   0 1493   89  Q  AGTT  P. . F.   .LL.DQVV .     ..TK..  ...S...S     FS.. . .  SH   
    88   96 B L  E     -KN  47 108C   3 2025   51  y  lMff  lf i l.   .llfyfLL .     L.LlLM  ...f...y     my.. . L  yL   
    89   97 B V  E     -KN  46 107C   0 1516   29  v  v.vv  av v vi   .vvvvv.. .     ...v..  ...iv..v     iv.. . .  vV   
    90   98 B R  E     -KN  45 106C   0 1577   87  Y  LKWW  VQ W WW   .FFRKV.. .     G.YS..  ...RY..Y     HR.. . .  LV   
    91   99 B I  E     +KN  44 105C   0 1674   49  L  LLLL  IL L LL   .LLVLL.. .     L.FL..  ...VL..L     LL.. . .  LA   
    92  100 B G  S    S+     0   0    7 1756   23  G  GGGG  GG G GG   GGGGGG.. .     Q.GG.R  G.GGGGGG     GGG. . .  GG   
    93  101 B K        +     0   0   13 1789   76  V  ASSS  TS S SS   RRREAE.. .     SVRRYV  R.REKRRR     EAR. . .  TE   
    94  102 B H        +     0   0   36 1883   76  Y  RNII  NI I TI   DQQHHL.. Y     LCEQCM  HHHHHQQY     YHH. . .  IF   
    95  103 B S  B     -Q  181   0E  21 1965   75  Q  QTKK  SH K KD   SDDDQQ.. D     ENTNNA  SSSTNSSQ     EQN. D G  SD   
    96  104 B R  S    S+     0   0   16 2018   82  L  LLVV  IT I IV   QQQVLL.. L     GLQLQR  QQQLLQQQ     LLQ. Q S  SQ   
    97  105 B T  S    S+     0   0   31 2112   87  S  VHGG  KD D GR   QTTSDF.. R     SIAELG  SSSSGNNS     PDST G I  YG   
    98  106 B R  S    S-     0   0   85 2151   87  N  KDDD  RQ Y YQ   LVVQTS.. R     NLGGTN  GGGISGGN     KSGQ S K  PS   
    99  107 B Y        -     0   0   21 2204   90  L  PDSS  HP S SS   FIIAYTNN W     PQPKFH  SSSQNAAF     PYLN D N  KD   
   100  108 B E    >>  -     0   0   22 2250   66  K  GSSS  HR N SS   NNNETPEE E     NGNNNG  NNNEENNN     ASNG A D  AE   
   101  109 B R  T 34 S+     0   0  143 2252   78  N  PRKK  PQ N KK   LFFGPGGG K     NSSPTA  PPPGSKKS     DEPS E Q  NE   
   102  110 B N  T 34 S+     0   0  133 2255   82  P  HKSS  QS G AG   NNNSEQSS W     VNNNAA  KKKTGYYH     TDNN S S  EN   
   103  111 B I  T <4 S+     0   0   58 2257   77  N  ATVV  SV V VK   EEEETSEE E     SPEEQT  EEEEAEEE     MAEP I S  SV   
   104  112 B E     <  -     0   0    0 2258   77  T  VLKK  KT K KE   VVVQEIQQ M     QNVVRR  EEEQIVVE     VKVN Q Q  QQ   
   105  113 B K  E     -N   91   0C  69 2257   91  V  YQYY  KH H YY   SRRDVSFF D     TNSSRL  SSSNAKKF     SVTE V S  EV   
   106  114 B I  E     -N   90   0C  11 2259   71  S  AVYY  IR H YY   RTTHRSII V     VVRRRI  RRRYIRRR     SSRV I V  LL   
   107  115 B S  E     -N   89   0C  12 2260   84  S  QPVV  KV V VV   STTETPSS D     TSSRVR  TTTDSSSK     ETTT N N  RK   
   108  116 B M  E     -N   88   0C  58 2260   71  G  VVSS  VF F SS   VLLVVLSS I     TrIVKR  IIIVPVVV     IVLr I h  AI   
   109  117 B L  E     +O  133   0C   6  452   51  V  ....  .. . ..   ........ .     .i....  ........     ...v . v  V.   
   110  118 B E  E    S+     0   0C  92 1908   74  K  KQ..  K. . ..   SAAADSEE K     .TTA..  KKKLASST     AEEA A F  AA   
   111  119 B K  E     -O  132   0C  92 2029   65  R  RDKK  AK K KK   QSSEQKKK E     .RKAR.  QQQEKEEQ     QYND K K  QK   
   112  120 B I  E     -O  131   0C  20 2160   45  I  VIII  II I II   VIIKIVVV I     VLIIII  AAAQIIII     IIFT V I  FV   
   113  121 B Y  E     -O  130   0C  66 2224   50  I  EVII  II I IV   IVVHIIII L     IIIIIL  VVVHIIII     IIVI F I  IF   
   114  122 B I  E     -O  129   0C  52 2228   82  I  SCII  II F II   RCCMTLRR I     VIVVTL  CCCLVIII     VTCC K T  TK   
   115  123 B H    >   -     0   0   25 2247   20  N  NHHH  HH H HH   HHHHHHHH H     HHHHHH  HHHHHHHH     HHHH N H  HN   
   116  124 B P  T 3  S+     0   0  106 2258   50  K  PPPP  PP P PP   PPPHNPPP P     PPPPTP  PPPPEPPE     PPPP P P  PP   
   117  125 B R  T 3  S+     0   0  162 2261   76  A  LFKK  DQ Q KK   GSSLSDNN N     NNNDGQ  RRRLAQQN     YSDD R Q  SK   
   118  126 B Y    <   -     0   0   15 2261   15  Y  YYYY  FT S YK   YYYYYYYY Y     YYYFYY  YYYYWYYY     YYYY Y I  YF   
   119  127 B N  B > > +R  125   0F  41 2262   68  Q  qSQQ  NE Q dS   SDDdRsnn S     NNNDNd  DDDndNNV     ALnN S Q  Tn   
   120  128 B W  T 3 5 +     0   0   62 1485   76  Y  m...  L. . r.   .FF..vww .     ...R.f  FFFiy...     ..l. w H  .l   
   121  129 B R  T 3 5S+     0   0  192 1311   77  E  ASDD  .N N ..   STTaED.. K     S...D.  .....DDD     GQ.N i T  ..   
   122  130 B E  T < 5S-     0   0  101 1657   80  G  SETT  ET T .D   QTTKEG.. S     T.NGI.  LLL..TTE     DE.S N S  E.   
   123  131 B N  T   5S-     0   0    4 2142   69  S  STTT  TS T TT   TSSsGSTT T     SStTTT  TTTsRTTQ     GGTT S A  ET   
   124  132 B L    > < +     0   0   25 1817   69  .  .L..  Y. . ..   N..ySLII T     SNfMYS  IIIyILL.     LSNY . .  YV   
   125  133 B D  B 3   +R  119   0F   7 2115   65  S  .R..  V. . .N   DDDDQGDD D     DDNNDD  DDDDRDDq     SQEE . .  gR   
   126  134 B R  T 3  S-     0   0   43 2196   57  G  AHAA  NA A AG   NNNNG.SS N     NNNNYY  NNNHNNNn     GGNN N .  gN   
   127  135 B D    <   +     0   0    0 2261    0  D  DDDD  DD D DD   DDDDDDDD D     DDDDDD  DDDDDDDD     DDDD D D  DD   
   128  136 B I        +     0   0    0 2264   11  I  VIII  II I II   IIIIIIII I     IIIIII  IIIIIIII     IIII I I  II   
   129  137 B A  E     -MO  68 114C   0 2263   48  A  AAAA  AA A AA   ACCAAAMM A     AAAAAA  CCCAAAAA     AACC T A  AT   
   130  138 B L  E     -MO  67 113C   0 2264    6  L  LLLL  LL L LL   LLLLLLLL L     LLLLLL  LLLLLLLL     LLLL L L  LL   
   131  139 B M  E     -MO  66 112C   0 2264   30  I  VILL  FL L LL   LLLLILII L     LLMVML  LLLIIVVL     VLLL L L  VL   
   132  140 B K  E     -MO  65 111C  19 2264   49  E  ELKK  HK K KK   RKKKHKKK R     QQKREE  QQQYKKKQ     RQKK K K  QK   
   133  141 B L  E     - O   0 109C   0 2264    8  L  LLLL  LL L LL   LLLLLLLL L     LLLLLL  LLLLLLLL     LLLL L L  LL   
   134  142 B K  S    S+     0   0  111 2264   73  E  KASS  KV A AS   SSSARASS A     SSSSMS  SSSKSHHS     KSSS A V  AA   
   135  143 B K  S    S-     0   0  171 2264   76  K  AFSS  KS S ST   SSSKQRKK Q     SSSSEA  AAASTSSS     KSAA T S  ST   
   136  144 B P        -     0   0   73 2264   40  P  PPQQ  AR R QP   PPPPPPPP P     PPSPPP  PPPPPPPD     PPPP P R  PP   
   137  145 B V        -     0   0   11 2220   48  V  VVVV  VV V VV   VVVVVLAA A     VVVVLV  VVVIVVVV     VVVV A V  VA   
   138  146 B A        -     0   0   75 2253   81  T  TNTT  RT T TT   TDDVTYTT V     TNSPEF  NNNAQTTT     STKN R T  SR   
   139  147 B F        +     0   0   87 2257   43  F  FYFF  YF F FF   FFFLFFLL L     FFFFFF  FFFFRFFY     FFFF F F  FF   
   140  148 B S        -     0   0   40 2259   60  T  TSTT  NT T TT   TSSSSSNN S     NTNSSS  TTTSSSST     TSTT S T  SS   
   141  149 B D  S    S+     0   0   81 2262   69  P  DSSS  DP S SS   DDDNHPQQ Q     NNNHKD  DDDADDDD     RRDD E S  DK   
   142  150 B Y  S    S+     0   0   81 2252   87  Y  YYVV  YF F LV   YYYRYWYY T     YYYYTL  NNNTSHHY     MYYY T F  LT   
   143  151 B I        +     0   0    0 2256   24  I  IIII  II I II   IIIRIIVV I     IIIIVV  IIIVIIII     IIII V I  IV   
   144  152 B H        -     0   0    4 2256   79  L  LQLL  QL L TM   QYYRQLQQ V     SSRRQQ  YYYRMRRL     LRQQ S L  LS   
   145  153 B P        -     0   0    9 2256   44  P  PPPP  PP P PP   PPPPPPPP P     PPPPPP  PPPPPPPP     PPPP A P  PA   
   146  154 B V        -     0   0    1 2260   37  V  VVII  II I II   VVVIIAVV I     VVVVIV  VVVIAIII     IIIV V I  VV   
   147  155 B a  B     -c  242   0B   3 2260   46  C  CCCC  CC C CC   CCCCCCAA C     CCCCCC  CCCCCCCC     CCCC C C  CC   
   148  156 B L        -     0   0   32 2260    9  L  VLLL  LL L LL   LLLLLLLL L     LLLLLV  LLLILLLL     LLLL L L  LL   
   149  157 B P        -     0   0    0 2259   30  P  PSPP  PP P PP   AAAGPPPP P     SSAAPP  AAAGPAAP     PPAA P P  PP   
   150  158 B D     >  -     0   0   51 2255   78  P  DENN  FS N tn   ASSLAESS D     AASAAA  AAAPASSA     TASS S S  KD   
   151  159 B R  H  > S+     0   0  148 1806   76  P  PKII  .V . kk   EAA.AAGG S     TTSSSS  AAA.SNNS     TARA A I  PA   
   152  160 B E  H  > S+     0   0  122 1873   75  A  SATT  .T . QH   GGG.NDCC G     NNSATS  DDD.GSSN     KNKG S T  GD   
   153  161 B T  H  > S+     0   0   10 2003   82  S  VFTT  DK . LH   SSSKANAA L     SSSSHH  RRRRESSV     DASS D K  DD   
   154  162 B A  H  X S+     0   0    7 2020   84  E  AEQQ  VK . KK   ETTDSPAA A     TTRVIT  AAAAIQQH     PSTT D Q  PD   
   155  163 B A  H  < S+     0   0   70 2078   68  L  FELL  FL I IL   FFFFFFDD E     FFFFFF  FFFFLFFF     EFFF F L  LF   
   156  164 B S  H  < S+     0   0   36 2215   78  P  QNAA  QK t PP   SHHtPHGG R     YYYNPT  HHHtPYYP     PPYN P K  GP   
   157  165 B L  H  < S+     0   0    1  515   98  .  ....  K. q ..   ...n.T.. E     ......  ...f....     .... . .  ..   
   158  166 B L     <  +     0   0   34  711   82  .  ....  L. L ..   ...L.N.. L     ......  ...L....     F... . .  ..   
   159  167 B Q  S >  S-     0   0   87  836   93  .  ..II  DI T ..   ...S.L.. T     ......  ...I.NN.     P... . I  ..   
   160  168 B A  T 3  S+     0   0   51 2039   74  A  TTPP  QP I PA   ATTrNTTT q     SSSNPT  NNNkHPPE     VNNN A P  HA   
   161  169 B G  T 3  S+     0   0   42 1713   37  G  GG..  N. P ..   GGGsG... g     GGSGGG  GGGyS..G     GGGG G .  GG   
   162  170 B Y    <   -     0   0   46 1826   85  T  MAAA  TA G ..   TVVSF... Q     VVTTMT  TTTSSAAY     MLTT T A  TS   
   163  171 B K  E     -D  188   0B  33 2112   87  K  NESS  KS S SS   SSSTL.MM E     NNSGSS  SSSPPSSK     SHSS L S  LL   
   164  172 B G  E     -D  187   0B   0 2154   45  C  CCCC  CC C CC   CSSSCCCC T     TTCSCC  SSSACCCC     CCSS C C  CC   
   165  173 B R  E     -DE 186 232B   3 2164   80  W  WWWW  FW W WW   WWWLTFRR V     WWWWWY  WWWRYWWW     WTWW V W  WA   
   166  174 B V  E     -DE 185 231B   0 2189   33  V  VVVV  IV V VV   VVVVVVVV V     VVIVVV  VVVVVVVV     VVVV T V  VT   
   167  175 B T  E     +D  184   0B   0 2202   48  T  TTTT  ST T TT   TTTSTTTT T     TTTTTT  TTTSTTTT     TTTT T T  TT   
   168  176 B G  E     -D  183   0B   1 2202    0  G  GGGG  GG G GG   GGGGGGGG G     GGGGGG  GGGGGGGG     GGGG G G  GG   
   169  177 B W  S    S+     0   0    1 2202    1  W  WWWW  WW W WW   WFFWWWWW W     WWWWWW  WWWWWWWW     WWFF W W  WW   
   170  178 B G  S    S-     0   0    0 2198    1  G  GGGG  GG G GG   GGGGGGGG G     GGGGGG  GGGGGGGG     GGGG G G  GG   
   171  179 B N        -     0   0   33 2021   77  D  SRKK  RK Q KQ   TDDNHNNN       NNKHTV  AAARRKKH     SHTA   T  NR   
   172  180 B L  S    S+     0   0   55 1822   62  I  PLVV  TV V V    VTTLTV          ILIVL  NNNTL  I     LV L   V  IT   
   173  181 B K  S    S-     0   0  147 1551   78  K  SVKK  EK K K    GQQRAK          GNKRM  SSSR   N      A S   K  DK   
   174  182 B E              0   0   49 1397   62  E  EQEE  EE E E    SPPTPE          SKEEE  NNN    S      P S   E  T    
   175  183 B T              0   0  181 1202   57  G   NSS  G  N S    DGGTSG          GNG D  GGG    G      S D   S  N    
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66   S           P             P P PD       PP          AA       P D      
   178  186 C Q        -     0   0   64  328   73   Q     R     P             A S PT       PS        T DD       E P      
   179  187 C P        -     0   0    8  503   39   P     PP    P  PPP        P P PP       PP        PPGR       P AP  PP 
   180  188 C S  S    S+     0   0   81  526   81   N     KD  N Y  SKH        Y Y FA       FH        DNDN       Y TD  DE 
   181  189 C V  B    S-Q   95   0E  21  534   82   V     ST  I P  LTT        T I PV       PT        KRKK       H IT  TL 
   182  190 C L        -     0   0    5  625    5   LL    LL  L L  LLL        L LLLLL      LL        LLLLL    L L LP  LLL
   183  191 C Q  E     -BD  34 168B   9  629   50   QR    QN  Q K  QQR        Q QRKQR      KQ        QQQQQ    Q Q HQ  HQQ
   184  192 C V  E     +BD  33 167B   6  628   86   CY    CC  K E  CCC        E EEQQE      QE        QCCCQ    E E QC  CCE
   185  193 C V  E     - D   0 166B  15  634   49   VV    VA  V V  VAA        V VVVAA      VV        ALLLA    A V VV  ALV
   186  194 C N  E     + D   0 165B   7  634   77   NH    NE  D E  NNN        Q QQKAE      KQ        ADNDA    Q E QD  NDM
   187  195 C L  E     - D   0 164B   0  638   34   IL    LV  V V  LIV        V VVVVV      VV        LVIII    V V VI  IAV
   188  196 C P  E     - D   0 163B  12  639   46   SP    HK  Q P  SET        S GNPPK      PA        PPPPP    P P PD  SPP
   189  197 C I  E     -F  210   0B   9  640   33   VI    LI  I I  VLI        V ILILL      II        LIIIL    L I FI  ILI
   190  198 C V  E     -F  209   0B  10  641   39   VA    LF  I V  VRI        I IIVLI      MI        LVLLL    I V VV  ILV
   191  199 C E    >>  -     0   0   75  641   66   SK    SP  Q E  SSK        N NDETD      EN        SSSTP    S E PS  SAG
   192  200 C R  H 3> S+     0   0   86  640   78   NR    NQ  Q N  EDH        K SFNNY      NN        NDDDK    P S LG  TQN
   193  201 C P  H 3> S+     0   0   77  641   74   ED    DK  D S  EER        A AKHAK      HS        AERRR    E Q PE  AEE
   194  202 C V  H <4 S+     0   0   41  641   84   SA    MK  I L  TEE        M IKIQI      IM        EDDDF    R E ED  SQV
   195  203 C c  H >< S+     0   0    5  645    1   CC    CC  C C  CCC        C CCCCC      CC        CCCCC    C C CC  CCC
   196  204 C K  H >< S+     0   0   91  645   74   SE    AE  S D  RRE        N NNDKN      DN        KDKKE    S D KQ  EEN
   197  205 C D  T 3< S+     0   0  141  645   80   AA    GD  E S  LQD        H YDAES      AH        KRNNE    A R TA  KAQ
   198  206 C S  T <  S+     0   0   15  645   87   HW    AA  A E  LVA        L LFKFD      KL        SASSR    A K KE  DAC
   199  207 C T    <   -     0   0   25  645   71   YL    YY  Y Y  YYY        Y YLYWK      YF        WYYYY    D Y GY  YYY
   200  208 C R  S    S+     0   0  249  645   89   Dq    SP  H h  DPP        q avhgv      hl        gPPPK    v q sP  PPq
   201  209 C I  S    S-     0   0   56  565   53   Ae    EE  Y g  PGG        g ddg.g      gs        .GGGG    g d nG  GGg
   202  210 C R        -     0   0  123  556   82   ..    KQ  M r  .KN        a .yhrY      rd        rMMMR    a r qK  RQQ
   203  211 C I        -     0   0   12  633   24   LV    VI  I I  VII        I ILIIL      II        IIIIF    F V LV  LII
   204  212 C T    >   -     0   0   12  638   73   YF    TT  S V  YTT        W WTVRT      IF        TTTTT    T I TT  MTI
   205  213 C D  T 3  S+     0   0   82  642   69   HS    AD  P K  HAD        G GPGDP      RG        DRDDG    P K NE  DDK
   206  214 C N  T 3  S+     0   0   11  645   72   pp    FA  R d  fNT        D DRdVR      dD        VRSSR    G e NN  TNd
   207  215 C M  E <   - G   0 263B   9  637   30   mm    MM  M v  mMM        M MMmMM      mM        MMMMM    M m AM  MMm
   208  216 C F  E     - G   0 262B  19  643   34   FF    LI  L I  FLV        V MMLVM      LV        IVFFL    L L FL  VVL
   209  217 C c  E     -FG 190 261B   0  643    1   CC    CC  C C  CCC        C CCCCC      CC        CCCCC    C C CC  CCC
   210  218 C A  E     +FG 189 260B   0  643   10   AA    AA  A A  AAA        A AAAAA      AA        AAAAA    A A AA  AAA
   211  219 C G        -     0   0    4  643   18   GG    GG  G G  GGS        G GGGGG      GG        GGGGG    G G GG  GGG
   212  220 C Y        -     0   0   31  452   71   ..    LN  Y .  .TV        D TD..Y      .N        .YYYN    F . SV  .F.
   213  221 C K     >  -     0   0   67  484   87   ..    WN  N .  .KR        P IL..L      .A        .MLLL    L . FP  VL.
   214  222 C P  T >4 S+     0   0   63  534   70   ..    TN  K .  .EK        A QR.AQ      .Q        .DEEH    E S GE  EES
   215  223 C D  T 34 S+     0   0  132  572   39   G.    GG  G .  GGE        G GG.DG      .G        .GGGE    G R KG  GGE
   216  224 C E  T 34 S-     0   0   83  609   46   Gd    GA  K .  GGG        G GG.GG      .G        .GGGH    G G DG  GGG
   217  225 C G    <<  +     0   0   49  117   85   Qt    ..  K N  L..        . ..N..      N.        .....    . . ..  ...
   218  226 C K        -     0   0  124  137   84   DL    ..  . E  D..        . ..T..      T.        ....K    . . ..  ...
   219  227 C R        +     0   0   81  180   80   QK    ..  . K  Q..        . ..R..      R.        ....R    . . ..  G..
   220  228 C G        +     0   0    3  583   68   KQ    K.  . S  KKK        K KRKAK      RK        .RKKV    T R .K  TKQ
   221  229 C D  B     -A   30   0A  12  624   16   DD    DD  D D  DDD        D DDDSD      DD        .DDDD    D D .D  DDD
   222  230 C A        +     0   0    9  640   48   SA    TT  A A  TSS        T ASSSA      SA        .ASSS    A S AS  SSS
   223  231 C d    >>  -     0   0   13  644    1   CC    CC  C C  CCC        C CCCCC      CC        .CCCC    C C CC  CCC
   224  232 C E  T 34 S+     0   0   95  644   57   KQ    GQ  Q Q  NEQ        V FQQMQ      QF        .NQQQ    Q E SQ  EQQ
   225  233 C G  T 34 S+     0   0   20  645    8   GG    GG  G G  GGG        G GGGGG      GG        GGGGG    G G GG  GGG
   226  234 C D  T X4  +     0   0    0  645    0   DD    DD  D D  DDD        D DDDDD      DD        DDDDD    D D DD  DDD
   227  235 C S  T 3< S+     0   0   16  645    6   SS    SS  S S  SSS        S SSSSS      SS        SSSSS    S S SS  SSS
   228  236 C G  T 3  S+     0   0    0  645    1   GG    GG  G G  GGG        G GGGGG      GG        GGGGG    G G GG  GGG
   229  237 C G    <   -     0   0    0  645    4   GG    GG  G G  GGG        G GGGGG      GG        GSGGG    G G GG  GGG
   230  238 C P  E     - H   0 246B   0  645    7   PV    PP  P P  PPP        P PPPPP      PP        PPPPP    P P PP  PPP
   231  239 C F  E     -EH 166 245B   0  644   24   VF    LL  L L  ILL        L LLLLL      LL        LLVVL    L L IL  LVL
   232  240 C V  E     -EH 165 243B   2  643   42   VA    VV  A V  VVV        V AVVVV      VA        VVIVM    V V FV  VVV
   233  241 C M  E     - H   0 242B   0  643   64   CV    CC  C C  CCC        C CCCCC      CC        CCCCC    C C FC  CCC
   234  242 C K  E     - H   0 241B  11  644   80   NW    ND  E K  NNN        D EEKQE      KN        QYNNE    E L DD  GNS
   235  243 C S     >  -     0   0    1  642   84   Gd    GG  E V  RGG        L KQVRD      VK        KGGGR    d W SG  GGW
   236  244 C P  T  4 S+     0   0   47  109   82   .a    ..  . .  ...        . .....      ..        ....P    t . ..  ...
   237  245 C F  T  4 S+     0   0  145  304   83   .T    V.  P .  S.S        . .....      ..        ....G    A . ..  V..
   238  246 C N  T  4 S-     0   0   63  501   60   .E    ..  S N  .K.        D KNNDD      NN        DEQQE    E N NK  ..E
   239  247 C N     <  +     0   0   85  373   58   ..    ..  G G  ...        G GNGGG      GG        G....    R C N.  ..G
   240  248 C R        -     0   0   59  432   80   .R    ..  R T  ...        V LRTAR      TL        A...S    Q T G.  ..I
   241  249 C W  E     - H   0 234B   1  442   42   .W    ..  W W  ...        W WWWWW      WW        W...W    L W R.  ..W
   242  250 C Y  E     -cH 147 233B  19  521   85   YR    .A  F L  ...        Y IYLNY      LY        T...A    V I K.  .EV
   243  251 C Q  E     + H   0 232B   0  638   57   LA    LL  L Q  LLL        Q QLQLV      QQ        LVLLV    L Q QL  LLQ
   244  252 C M  E     +     0   0B   0  642   82   QT    QQ  A A  QYQ        I VAAVA      AI        VHHQY    R V MQ  QQV
   245  253 C G  E     -IH 264 231B   0  645    0   GG    GG  G G  GGG        G GGGGG      GG        GGGGG    G G GG  GGG
   246  254 C I  E     -IH 263 230B   0  645   23   LI    II  L V  LII        I IVVIV      VV        ILIIV    I V VL  IVI
   247  255 C V  E     +I  262   0B   5  643   28   VV    TT  V V  VII        V VTVVT      VV        VVVVT    V V VV  VVV
   248  256 C S  E     -     0   0B   6  644    5   SS    SS  S S  SSS        S SSSSS      SS        SSSSS    S S SS  SSS
   249  257 C W  E     +I  261   0B  35  642   16   FW    WW  W W  MWW        W WWWWW      WW        WWWWW    W W WW  WWW
   250  258 C G        -     0   0   36  645    5   GG    gg  G G  GgG        G GGGgG      DG        gGGGG    G G Gg  gGG
   251  259 C E  S    S-     0   0   61  627   89   QI    ed  M D  QfQ        V STDnT      EV        rQYYY    S H Dh  vYY
   252  260 C G  S    S-     0   0   21  637   41   aG    PP  G G  gPd        G GGGTG      GG        TGGGG    G S GP  PGS
   253  261 C d  S    S-     0   0   12  642    1   cC    CC  C C  cCc        C CCCCC      CC        CCCCC    C C CC  CCC
   254  262 C D  S    S+     0   0   28  643   37   GS    AG  G A  GGA        G GGADG      AG        SAAAG    G G GA  DAG
   255  263 C R    >   -     0   0  128  645   82   QK    LR  L Q  QQV        R RQQTQ      QR        TLEEV    D H RQ  TQH
   256  264 C D  T 3  S+     0   0   93  645   73   PG    PP  P P  PPS        P PRPKK      PP        TPKKK    R A AA  TKR
   257  265 C G  T 3  S+     0   0   29  629   69   YY    EN  N H  GNK        N NNNTN      NN        TNNDD    L D NN  TND
   258  266 C K    <   -     0   0   90  639   88   VG    KR  Y R  IRK        Q RKRPK      RR        PYHHS    K L SK  KKF
   259  267 C Y        -     0   0   14  641   48   PF    PP  Y P  PPP        P PPPGP      PP        APPPP    P P PP  PPP
   260  268 C G  E     -G  210   0B   3  618   10   G.    AG  G G  SGG        G GGG.G      GG        .GGGG    G G GG  GGG
   261  269 C F  E     -GI 209 249B   3  639   18   V.    VV  V I  VVV        V VVIVV      IV        VVVVV    V V VV  VVV
   262  270 C Y  E     -GI 208 247B   2  644    4   YY    YY  Y Y  YYY        Y YYYYY      YY        YYYYY    Y Y YY  YYY
   263  271 C T  E     -GI 207 246B   2  644   35   TT    TT  T T  TTT        T TTTAT      TA        AVAAT    T T TT  TTA
   264  272 C H  E  >  - I   0 245B  31  644   59   NK    KN  R R  NRK        N NKRRR      RN        RKKKK    D R NS  KRR
   265  273 C V  T >4 S+     0   0    0  643   15   LV    VI  I V  LVV        I VVVVV      VI        VVVVV    V V LI  VVV
   266  274 C F  G >4 S+     0   0   39  642   74   CL    VC  T T  CSC        S STTTT      TS        ACCCS    A M SC  CCM
   267  275 C R  G 34 S+     0   0  132  642   86   KN    HR  Q Y  KKK        Q REHKK      YH        KEVLA    N S VK  SNS
   268  276 C L  G  S+     0   0   57  641   79   TM    WL  L L  TLV        I FLLRL      LF        ILLNV    L V NL  LVI
   270  278 C K  H  > S+     0   0  164  641   65   DD    KD  G D  NHD        H RPDGS      DE        PYDNP    A S DD  EDS
   271  279 C W  H  > S+     0   0   37  641    0   WW    WW  W W  WWW        W WWWWW      WW        WWWWW    W W WW  WWW
   272  280 C I  H  X S+     0   0    1  641   10   II    II  I I  III        I MIIII      II        VILLI    I I LI  III
   273  281 C Q  H >X S+     0   0   79  605   76   QK    KK  N H  QWQ        Q QYHDY      HQ        QDKEK    Q H DQ  RER
   274  282 C K  H >X S+     0   0  135  595   73   KA    DK  Q Q  TEK        K KSHSS      HK        KDDSS    E H DK  DEK
   275  283 C V  H 3< S+     0   0   15  570   82   TT    TT  T Y  TTT        T LKYIK      YL        IVTTV      H  I  TTY
   276  284 C I  H << S+     0   0   49  556   45   II    II  M V  IIM        V LMVLM      VM        LLMMT      V  I  MMV
   277  285 C D  H <<        0   0  114  506   74   QE    TG  S P  QRE        A SEPEE      PA        ARASK      P  A  RAP
   278  286 C Q     <        0   0  142  322   66               K   NN        H RRK        KQ          NS       Q     R  
## ALIGNMENTS  631 -  700
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....4....:....5....:....6....:....7....:....8....:....9....:....0
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10   I I I  III I           I I  V   VI I I L IIIIII I  MM  II   IIII VVII
    30   38 B V  B     +A  221   0A  13 2209   20   V I V  VVV V           V V  I   VV V V I VVVVIM V  VV  VV   VTVV VVVV
    31   39 B E  S    S+     0   0  131 2214   31   G G G  GGG G           G G  G   GG N G G GGGGGG G  GG  GG   NGGG GNNG
    32   40 B G        -     0   0   30 2221    1   G G G  GGG G           G G  G   GG G G G GGGGGG G  GG  GG   GGGG GGGG
    33   41 B S  E     -B  184   0B  74 2221   88   S R Q  SQQ T           N V  V   VV Q M R GSNYTV V  QK  RR   ESTS AEEY
    34   42 B D  E     -B  183   0B  99 2227   62   P E D  EDN N           T N  N   DE N D A PEEETD E  ND  DD   NSEP PDNQ
    35   43 B A        -     0   0    5 2227   45   A A A  AAA S           A A  A   AA A S A SAACAA T  AA  AA   AAAA AAAC
    36   44 B E    >   -     0   0   41 2228   84   A Q A  RAG M           V S  Q   RK V T L KYAEQE Q  LT  RR   VEEP TEVE
    37   45 B I  T 3  S+     0   0   90 2237   79   A I A  DLA K           R P  S   AR S K P QPPPTE P  EK  EE   PPAE KPPA
    38   46 B G  T 3  S+     0   0   11 2241   60   K G G  GGG G           G G  G   NN G G G GGGYGG N  GG  GG   GGGR EHGH
    39   47 B M  S <  S+     0   0    7 2243   67   K A A  ERS E           S S  A   SS S A S ASSSAK E  EQ  EE   SQTR KSSS
    40   48 B S  S >  S+     0   0   11 2247   63   W W W  WWW W           W W  W   WI W Y W WWYQWW F  WN  WW   WWWW WWWQ
    41   49 B P  T 3  S+     0   0    5 2251    4   P P P  PPP P           P P  P   PP P P P PPPPPP P  PP  PP   PPPP PPPP
    42   50 B W  T 3  S+     0   0    2 2253   18   W W W  WWW W           W W  W   WW W W W WWWWWW W  WW  WW   WWWW WWWW
    43   51 B Q  E <   -J   59   0C   2 2256   32   Q L Q  QQQ Q           Q Q  Q   QQ Q Q Q QQQQVQ Q  QQ  QQ   QQIQ QQQQ
    44   52 B V  E     -JK  58  91C   0 2257   34   V V V  VVV I           V V  I   IV V V A AVAAVV A  VA  AA   VVVV VVVV
    45   53 B M  E     -JK  57  90C   0 2256   51   S S S  SSS S           S S  A   SA S M F LDSSSS F  SI  SS   SSSS SLSS
    46   54 B L  E     -JK  56  89C   0 2257   14   L L L  LLL L           I L  L   LL L F L VVLLLL L  IV  LL   LILL LLLL
    47   55 B F  E     -JK  54  88C   0 2256   82   Q Q H  RRq S           q h  E   QF Q W P IRrNQR Q  QW  QQ   qTqr QLQN
    48   56 B R  E   > -JK  53  87C  76 1547   74   V i .  LF. Y           l .  R   y. . T I hRy.iV v  RV  YY   rYyy Ii.V
    49   57 B K  T > 5S+     0   0   41  951   80   . g .  ..p .           . p  .   g. D . . p.y.g. q  ..  ..   ..G. .gE.
    50   58 B S  T 3 5S+     0   0   72 1192   73   . K .  ..T .           . K  .   TK A D . R.S.K. S  ..  ..   ..R. .DS.
    51   59 B P  T 3 5S-     0   0   69 2030   82   N I Q  NDY K           . Y  S   SH S L L IRGAIR G  NP  QQ   SDL. HWN.
    52   60 B Q  T < 5 +     0   0   62 2193   78   D L D  GYG G           G G  G   WN G R P RGGGLH N  GG  RR   GGL. DLGG
    53   61 B E  E   < -J   48   0C  77 2221   95   Q A S  TTG Q           S G  S   YR F K T KGFYAM A  SK  SS   FVAS EYYY
    54   62 B L  E     +J   47   0C  17 2246   57   H H H  HHH T           H H  F   HF H G D PHHHHH Y  HY  HH   HHHH HIHH
    55   63 B L  E     -     0   0C  17 2261   70   I M I  RSF V           F F  I   TF F F H FIVFIV A  FY  VV   FVIF QYFF
    56   64 B b  E     -J   46   0C   1 2264    1   C C C  CCC C           C C  C   CC C C C CCCCCC C  CC  CC   CCCC CCCC
    57   65 B G  E     +J   45   0C   2 2264    3   G G G  GGG G           G G  G   GG G G G GGGGGG G  GG  GG   GGGG GGGG
    58   66 B A  E     -J   44   0C   0 2264   13   G G G  GGG G           G G  G   GG G G G GAGGGG G  GG  AA   GGGG GGGG
    59   67 B S  E     -JL  43  67C   0 2264   40   S S S  SSS S           S S  S   SS S S S AAASSS T  SS  SS   SSSS STSS
    60   68 B L  E     + L   0  66C   0 2264   10   L L L  LLL L           L L  L   LL L L L LLLLLL L  LL  LL   LLLL LLLL
    61   69 B I        -     0   0   23 2264   15   I V I  III I           I I  V   II I L I VILVVL I  II  II   IVVI IIII
    62   70 B S  S    S-     0   0   32 2264   62   A K S  SSN T           N S  S   SN S N D DHSNKN A  TS  SS   SSRT AKSN
    63   71 B D  S    S+     0   0   61 2210   68   H S H  PDK D           N S  P   SS Q D D KRNENS D  DS  RR   QEES SPPD
    64   72 B R  S    S+     0   0   80 2263   73   R K Q  QHD S           N E  T   ER N Q Q RQRNKQ R  RN  QQ   SQRR RNNR
    65   73 B W  E     - M   0 132C  12 2264   12   W W W  WWW W           W W  W   WW W W H WWWWWW W  WL  WW   WWWW WWWW
    66   74 B V  E     -LM  60 131C   0 2262   11   V V V  VVV V           I V  V   VV V V V IVVVVV I  VV  VV   VVVV VVVI
    67   75 B L  E     +LM  59 130C   0 2263   23   L L L  LLL L           L L  V   LL V L I LLVVLL L  LL  LL   VLIL LLVV
    68   76 B T  E     - M   0 129C   0 2263   28   T T S  TTS T           S T  T   TT T T T TSTSTT T  TT  TT   TSTS TTTS
    69   77 B A    >   -     0   0    0 2262    2   A A A  AAA A           A A  A   AA A A A AAAAAA A  AA  AA   AAAA AAAA
    70   78 B A  G >> S+     0   0    0 2263    6   A A A  AAA A           A A  A   AA A A A AAAAAA A  AA  AA   AAAA AATA
    71   79 B H  G 34 S+     0   0   10 2264    3   H H H  HHH H           H H  H   HH H H H HHHHHH R  HH  HH   HHHH HHHH
    72   80 B b  G <4 S+     0   0    0 2264    1   C C C  CCC C           C C  C   CC C C C CCCCCC C  CC  CC   CCCC CCCC
    73   81 B L  T <4 S+     0   0    1 2264   68   I T F  FIF F           F L  I   IL R F A VFIYTI L  FF  FF   SFTI IIQW
    74   82 B L  E  <  +P   81   0D  46 2264   89   Y K Q  RKQ D           Q S  A   SP V K V GQVKKH V  SE  PP   VPKL FSVQ
    75   83 B Y  E > > -P   80   0D  49 2249   82   G T S  QKD S           S G  G   SS T R I ESNSDS V  NV  RR   SSDR DNTN
    76   84 B P  G > 5S+     0   0   52 2249   88   H K T  TTS Q           P V  S   SS P N P NKGPTR P  TL  PP   PEMY LEPP
    77   85 B P  G 3 5S+     0   0   75  844   90   L . .  ... .           Q .  S   RS . D . .E.S.. .  ..  ..   G..A .K.F
    78   86 B W  G < 5S-     0   0  166  852   93   E . .  ... .           T .  H   TS . I . .L.S.. .  ..  ..   R..D .Y.S
    79   87 B D  T < 5 +     0   0  152  869   93   Y . .  ... .           S .  T   YQ . R . .S.L.. .  ..  ..   H..Y .W.Q
    80   88 B K  E   < +P   75   0D  51  904   83   K . .  ... .           T .  P   RA . V . .M.E.. .  ..  ..   V..M .V.I
    81   89 B N  E     +P   74   0D 110  936   80   V . .  ... .           P .  S   VS . E . DY.V.. .  ..  VV   V..V .A.A
    82   90 B F        -     0   0   28 1017   94   K . .  .W. .           A .  Y   YS . E . VT.R.. .  ..  KK   V..Q .L.I
    83   91 B T    >>  -     0   0   70 1164   86   I I V  .YI .           G .  K   LL . V . LF.L.. G  ..  LL   LH.L .G.L
    84   92 B E  G >4 S+     0   0   35 1455   85   G D A  KSG K           L S  V   GH G E . PI.GR. Q  SD  SS   GS.G .EGG
    85   93 B N  G 34 S+     0   0  127 1677   87   Y P S  dFT V           S E  V   KV R L a TL.ED. k  Ea  DD   EKRD .HRD
    86   94 B D  G <4 S+     0   0   49 1292   82   T . .  s.. S           V T  .   HR H R w G...PV r  Ts  ..   .EDR ED..
    87   95 B L  E <<  +K   48   0C   0 1493   89   S . N  R.I Q           F T  .   SL H L N Y...LQ Y  SV  ..   .GPM EIH.
    88   96 B L  E     -KN  47 108C   3 2025   51   L l l  flM y           L l  .   LG V G m l.l.my i  lV  yy   .ylL yTF.
    89   97 B V  E     -KN  46 107C   0 1516   29   . v v  vvV v           . v  .   .. . . v v.v.av v  vV  ii   .va. v.V.
    90   98 B R  E     -KN  45 106C   0 1577   87   . V Y  LWK Y           . Y  .   .. I . H S.V.VK Y  LI  RR   .KV. R.V.
    91   99 B I  E     +KN  44 105C   0 1674   49   . I L  LLL L           . L  T   .. L . L L.L.IM L  LL  LL   .LI. L.L.
    92  100 B G  S    S+     0   0    7 1756   23   . G G  GGG G           G G  G   .. G . G GGG.GG G  GG  GG   .GG. G.G.
    93  101 B K        +     0   0   13 1789   76   . T R  TSL V           K R  E   .E E . S LKD.TD A  VA  EE   .AT. G.E.
    94  102 B H        +     0   0   36 1883   76   . N L  HIQ Y           Q R  H   .H H . H HYHHNR H  LY  FF   YHN. R.YH
    95  103 B S  B     -Q  181   0E  21 1965   75   . N T  KDS Q           S T  I   .N D K L NHDHSS D  QK  RR   DQN. M.DH
    96  104 B R  S    S+     0   0   16 2018   82   . I Q  QRQ L           L Q  R   .L R Y R RERIIV R  LI  LL   RLI. M.RI
    97  105 B T  S    S+     0   0   31 2112   87   . H Q  LES S           Q Q  N   SI Q D T KFRRKY T  AT  AA   SDY. H.SW
    98  106 B R  S    S-     0   0   85 2151   87   . G S  HYG N           T G  S   TS S Q V EAKVRR A  RG  RR   SSR. GISM
    99  107 B Y        -     0   0   21 2204   90   S G L  PSS L           S I  P   EN N M K PTSNHQ E  PN  PP   NYID DSNQ
   100  108 B E    >>  -     0   0   22 2250   66   Q P N  SSN K           E N  E   ED A E E GDTEHN S  GP  SS   ASHG SEAE
   101  109 B R  T 34 S+     0   0  143 2252   78   Q P P  PTP N           L I  G   NG E E D DAKGPT E  PK  PP   EEPS EGEG
   102  110 B N  T 34 S+     0   0  133 2255   82   H Y N  HGY P           N Y  T   GS P E S NTATQS D  HE  QQ   PDHS QPPP
   103  111 B I  T <4 S+     0   0   58 2257   77   T S E  AKQ N           S E  E   SE I P E VEKESL N  AE  AA   LAGE AEVE
   104  112 B E     <  -     0   0    0 2258   77   M K E  VEI T           L T  Q   LQ Q Q V VQQQKV R  VI  LL   QKRQ VQQQ
   105  113 B K  E     -N   91   0C  69 2257   91   A K S  IYT V           T S  T   AV V Q H YVTFKI K  YP  SS   VVRA VFVY
   106  114 B I  E     -N   90   0C  11 2259   71   V I R  AYK S           I R  H   II K F I LFVIIP L  AV  SS   LSIL IILM
   107  115 B S  E     -N   89   0C  12 2260   84   V K R  SVT S           T N  D   SS S V G ERKRKI Y  RQ  QQ   STKM PPSS
   108  116 B M  E     -N   88   0C  58 2260   71   v V V  VSV G           V V  V   PV I s V VSIAVQ S  VV  LL   ILVv VVIV
   109  117 B L  E     +O  133   0C   6  452   51   v . .  ... V           . .  .   .. . i . ...... N  ..  ..   ...v ....
   110  118 B E  E    S+     0   0C  92 1908   74   R K S  G.V K           A A  K   SS S A Q EAQSK. S  KK  LL   SKKQ AESD
   111  119 B K  E     -O  132   0C  92 2029   65   D A R  KRQ R           Q K  R   KA R D D KVRKAN E  RQ  RR   KNSK DKKA
   112  120 B I  E     -O  131   0C  20 2160   45   I I V  IIV I           I L  I   II A I I IIVVII I  VI  VV   AIII IIAI
   113  121 B Y  E     -O  130   0C  66 2224   50   I I I  IAI I           I F  I   IY I H C IIFLIF F  EI  VV   IITI VYIY
   114  122 B I  E     -O  129   0C  52 2228   82   V I T  CIN I           N V  T   VR T F V RKKRIV I  SI  LL   TPII YVSW
   115  123 B H    >   -     0   0   25 2247   20   H H H  NPH N           H H  H   HH H H H HHHNHH H  NH  NN   HHHH PHHH
   116  124 B P  T 3  S+     0   0  106 2258   50   Q P P  PDP K           P S  P   EP P P P PHPPPP P  PP  AA   PPPK SPPE
   117  125 B R  T 3  S+     0   0  162 2261   76   Y D D  HKN A           S S  T   SQ Y N G DDHNDK A  KS  NN   SSED DLNR
   118  126 B Y    <   -     0   0   15 2261   15   Y F Y  YHY Y           Y Y  Y   WY Y F F WYYYFF W  YY  FF   WYFF FYWY
   119  127 B N  B > > +R  125   0F  41 2262   68   Q N D  GRn Q           V N  N   nS N N f NDNnNS n  qn  TT   NLIe DnND
   120  128 B W  T 3 5 +     0   0   62 1485   76   S L .  ... Y           . .  .   f. . . e .W.wL. a  ms  ..   ..Ls .d.Y
   121  129 B R  T 3 5S+     0   0  192 1311   77   I . E  ..p E           S S  S   .. S G R K.D..T T  AD  EE   PQ.. EDP.
   122  130 B E  T < 5S-     0   0  101 1657   80   G E E  GHS G           S N  P   .. Q Q T DRD.ET D  SN  EE   TEE. TATQ
   123  131 B N  T   5S-     0   0    4 2142   69   M T T  KTN S           T T  Q   TG N T G NTTDTt A  SS  GG   TGT. TSNT
   124  132 B L    > < +     0   0   25 1817   69   I Y K  V.. .           H N  L   IL F F R FSLLYv .  ..  AA   LSYL FQLL
   125  133 B D  B 3   +R  119   0F   7 2115   65   Q V D  sED S           D D  S   RN N D T DDVDVQ .  ..  QQ   NQVT SGND
   126  134 B R  T 3  S-     0   0   43 2196   57   N N N  gAN G           N N  N   NR N N T SNNSNN G  AA  GG   NGNH HYNY
   127  135 B D    <   +     0   0    0 2261    0   D D D  DDD D           D D  D   DD D D D DDDDDD D  DD  DD   DDDD DDDD
   128  136 B I        +     0   0    0 2264   11   I I V  III I           I I  I   IV V I I VIIIII V  VI  II   LIIL IIVI
   129  137 B A  E     -MO  68 114C   0 2263   48   A A A  AAA A           A A  A   AG T A A AAAMAA A  AA  AA   TAAA AATM
   130  138 B L  E     -MO  67 113C   0 2264    6   L L L  LLL L           L L  L   LL L L I LLLLLL L  LL  LL   LLLL LLLL
   131  139 B M  E     -MO  66 112C   0 2264   30   A F L  VLV I           L L  I   IM L V I LILIFL I  VL  VV   LLFL ALLM
   132  140 B K  E     -MO  65 111C  19 2264   49   L H Q  QKK E           Q R  E   KK K Q K EKKKHK K  EQ  QQ   KQHR VKKK
   133  141 B L  E     - O   0 109C   0 2264    8   L L L  LLL L           L L  L   LL L L L LLLLLL L  LL  LL   LLLL LLLL
   134  142 B K  S    S+     0   0  111 2264   73   D K Q  ESD E           S S  S   ES S M H KSQSKQ K  ES  RR   ASNA ASAA
   135  143 B K  S    S-     0   0  171 2264   76   V K E  RSS K           S S  S   SR S D H ETSKKQ S  AQ  RR   SSKY FYSH
   136  144 B P        -     0   0   73 2264   40   P A A  PRS P           S A  P   PP P R K EPAPAP A  PN  PP   PPAS SKPP
   137  145 B V        -     0   0   11 2220   48   V V V  VVV V           V V  V   VA V A V VA.AVV V  VV  VV   AVVV VAAV
   138  146 B A        -     0   0   75 2253   81   N R T  NTT T           T T  P   TT Q S N NT.TRN K  TP  SS   QTKN NERT
   139  147 B F        +     0   0   87 2257   43   Y Y F  LFF F           F F  L   AI I F F LL.LYF Y  FF  FF   YFYF FLYV
   140  148 B S        -     0   0   40 2259   60   S N T  TSN T           S T  S   SN T T T TT.NNT S  TT  SS   TSNS STTN
   141  149 B D  S    S+     0   0   81 2262   69   A D D  DSD P           D N  D   DS S D D DPVGDS Q  NR  AA   NRDS LDSQ
   142  150 B Y  S    S+     0   0   81 2252   87   Y Y Y  RVY Y           Y Y  R   KK R Y A YYSYYS Y  YY  RR   RYYY YERH
   143  151 B I        +     0   0    0 2256   24   I I I  III I           I I  V   IV V I I IVVVII I  II  VV   IIII IVIV
   144  152 B H        -     0   0    4 2256   79   Q Q R  VLE L           Q R  N   TS S L R RQQQQH R  LL  RR   SRQQ QKSQ
   145  153 B P        -     0   0    9 2256   44   P P P  PPP P           P P  P   PT P P P PPPPPP P  PP  PP   PPPP PLPP
   146  154 B V        -     0   0    1 2260   37   V I V  IIV V           V V  V   GV V V I VVVVII V  VV  VV   VIIV VAVV
   147  155 B a  B     -c  242   0B   3 2260   46   C C C  CCC C           C C  C   CC C C C CCCACC C  CL  CC   CCCC CCCA
   148  156 B L        -     0   0   32 2260    9   L L L  LLL L           L L  L   LL L L L LLLLLV L  VL  LL   LLLL LLLL
   149  157 B P        -     0   0    0 2259   30   P P A  PPA P           A A  P   PP A G P QPPPPP S  PP  PP   APPP PPAP
   150  158 B D     >  -     0   0   51 2255   78   E F A  dNA P           A A  P   EQ T D E rQdTFT I  DT  AA   SAFG EPSE
   151  159 B R  H  > S+     0   0  148 1806   76   K . A  kIA P           A Q  Q   NT S S N aAkRD. S  PT  ..   PA.K .ASA
   152  160 B E  H  > S+     0   0  122 1873   75   T . S  VSG A           G N  G   GT S V G RDECV. G  SS  PP   DN.S .GNC
   153  161 B T  H  > S+     0   0   10 2003   82   F D S  QKN S           S S  H   LD T L Q EPDAFG I  VT  GG   EADL KYEP
   154  162 B A  H  X S+     0   0    7 2020   84   M V I  FQT E           T V  Q   VN S L K RKPPQT D  VV  AA   ASVT SIAA
   155  163 B A  H  < S+     0   0   70 2078   68   V F F  LLY L           L Y  V   LF F E V SAAAKF E  FF  FF   LFFV LLLP
   156  164 B S  H  < S+     0   0   36 2215   78   E Q P  PTA P           G S  S   PP P r S gGGGLH P  EL  PP   PPQK KPPG
   157  165 B L  H  < S+     0   0    1  515   98   . M .  ... .           . .  .   .. . f . dQT... .  ..  ..   ..E. ....
   158  166 B L     <  +     0   0   34  711   82   . L .  ... .           . .  .   .. . F . VLV..V D  ..  ..   ..L. V...
   159  167 B Q  S >  S-     0   0   87  836   93   . D .  .V. .           . .  .   .. . S . QTV.DK Y  ..  TT   ..D. K...
   160  168 B A  T 3  S+     0   0   51 2039   74   D Q A  KPA A           S A  V   HS S g S EVATQA A  SP  PP   ANQA THA.
   161  169 B G  T 3  S+     0   0   42 1713   37   D N G  ..G G           G G  G   NG G v G G...NG D  GG  GG   GGNG GGG.
   162  170 B Y    <   -     0   0   46 1826   85   T T Q  TAT T           T T  S   AT T Q T R...TT E  MQ  TT   LLTM TTLD
   163  171 B K  E     -D  188   0B  33 2112   87   K K S  KSL K           L S  K   PS R L E A..MKK M  KS  RR   KHKL LKTM
   164  172 B G  E     -D  187   0B   0 2154   45   C C S  CCS C           V S  C   CC C G M G..CCC V  CC  CC   CCCC CCCC
   165  173 B R  E     -DE 186 232B   3 2164   80   W F W  WWW W           W W  F   YV V T Y V..RFW T  WV  WW   ATFW WYVT
   166  174 B V  E     -DE 185 231B   0 2189   33   V I I  VVV V           V I  I   VV T V V VAVVIV V  VV  VV   TVIV VVTV
   167  175 B T  E     +D  184   0B   0 2202   48   T S T  TTT T           T T  T   TS T T T TTTTST T  TT  TT   TTST TTTS
   168  176 B G  E     -D  183   0B   1 2202    0   G G G  GGG G           G G  G   GG G G G GGGGGG G  GG  GG   GGGG GGGG
   169  177 B W  S    S+     0   0    1 2202    1   W W W  WWW W           W W  W   WW W W W WWWWWW W  WW  WW   WWWW WWWW
   170  178 B G  S    S-     0   0    0 2198    1   G G G  GGG G           G G  G   GG G G G GGGGGG G  GG  GG   GGGG GGGG
   171  179 B N        -     0   0   33 2021   77   K R D  DQK D           D D  K   RS K Q   R TNRK T  T   SS   RHRQ QNRN
   172  180 B L  S    S+     0   0   55 1822   62   L T V  VNL I           I I  I   LL T L   T V TP T  P   LL   LVTL LLTI
   173  181 B K  S    S-     0   0  147 1551   78   K K R  KQS K           S R  R    S G T   S S ED Y  S   RR   SAQS SNS 
   174  182 B E              0   0   49 1397   62   E E    GES E           S A  H    A T E   N E EP D  E   QQ   GSEE ETG 
   175  183 B T              0   0  181 1202   57   D E    GGA G           D G  P    G T S     G GG G      GG    SEN  D  
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66        N      PPPT P   NG    D  GT    A   P        P    P    A         
   178  186 C Q        -     0   0   64  328   73        T      PPPK P   GT    S  HP  Q D   P      R R    N    D         
   179  187 C P        -     0   0    8  503   39  P   P PP   P PPPSPPP PSP    N  PS  T R P P      P A   PP   PK    P    
   180  188 C S  S    S+     0   0   81  526   81  D   D DN   T FYFSSYH DDN D  D DDD  S N N F      K E   DR   DN    K    
   181  189 C V  B    S-Q   95   0E  21  534   82  N   K KL   V PNPSQPT ILM T  V VVV  I K I P      T T   TI   VK    T    
   182  190 C L        -     0   0    5  625    5  L   L LL   L LLLLLLLLLLL L LL LLL  L L L L      L LM  IL  LPL    L    
   183  191 C Q  E     -BD  34 168B   9  629   50  K   Q QQ   Q KQKLRKRQRHY Q QR RNR  K Q Q K      Q QN  QQ  QHQ    Q    
   184  192 C V  E     +BD  33 167B   6  628   86  C   C QC   C QEEKYQCGAQE V GA ESE  K C K Q      A KY  CK  ECC    C    
   185  193 C V  E     - D   0 166B  15  634   49  V I L VG   V VVVAVVAVAAA A AT AVV  I L V V      V VV  AL  AAL    A    
   186  194 C N  E     + D   0 165B   7  634   77  N R E AY   N KEETDRNRVQV D TN QDN  D E S K      D TQ  YA  ENN    N    
   187  195 C L  E     - D   0 164B   0  638   34  I L V LV   V VVVVVVIVVVV V VV VLV  L I V V      V LL  IV  LII    I    
   188  196 C P  E     - D   0 163B  12  639   46  T P P PQ   S PPPPKPTPPPP I SP RPT  P P E P      P QP  HP  SNP    Q    
   189  197 C I  E     -F  210   0B   9  640   33  T V L LI   V IIIIIIILLVI I VT LVV  I I V I      V IV  LI  III    L    
   190  198 C V  E     -F  209   0B  10  641   39  V A L LV   V MVVLVVILLVH V LV VVV  V L L M      I KV  VI  MLL    R    
   191  199 C E    >>  -     0   0   75  641   66  S K S TS   S EAESGEKDPPS D NN SRD  P S E E      D SD  SD  LDS    S    
   192  200 C R  H 3> S+     0   0   86  640   78  N R D KA   E NNNKRNHRNAW R NQ RNR  R N N N      N QK  RT  HYK    D    
   193  201 C P  H 3> S+     0   0   77  641   74  S E D TQ   E HESTTSERAQT A SQ DEG  D A E H      R EE  EP  EEE    E    
   194  202 C V  H <4 S+     0   0   41  641   84  V S T QS   V IILTQEETEDK L VE TET  A D K I      Q DT  EK  KVD    E    
   195  203 C c  H >< S+     0   0    5  645    1  C C C CC   C CCCCCCCCCCC C CC CCC  C C C C      C CC  CC  CCC    C    
   196  204 C K  H >< S+     0   0   91  645   74  Q E F KR   S DQDAADEDDRN N EN NQN  Q Q K D      E QS  EN  NRD    R    
   197  205 C D  T 3< S+     0   0  141  645   80  A N N TA   K AQSSSMKHSDQ R NK AQK  E N T A      K KK  RL  KAN    Q    
   198  206 C S  T <  S+     0   0   15  645   87  C W A YS   L KQELSQALLVS Y MA SNI  K S W K      W NS  AL  VAS    V    
   199  207 C T    <   -     0   0   25  645   71  Y L Y WY   Y YYYSTYYYYYR Y FY YFY  L Y F Y      H FI  YY  FHY    Y    
   200  208 C R  S    S+     0   0  249  645   89  P r p gP   D hghgyhPhIAa K rq SVk  r P k h      k gt  Ps  kGP    P    
   201  209 C I  S    S-     0   0   56  565   53  s d . .G   . gvgmggGgGdg g gg GSk  g G g g      g gd  Gg  rgG    G    
   202  210 C R        -     0   0  123  556   82  i . q rR   P r.rKepNrDln i kG .Re  t M q r      v Gs  Qk  mpM    K    
   203  211 C I        -     0   0   12  633   24  I V I IV   L IIIIIIIIIIF I II III  L I I I      I IL  IT  VAI    I    
   204  212 C T    >   -     0   0   12  638   73  T F T AT   Y IQVTKVTVTST T PT IES  P T Y I      Y VS  TI  KTT    T    
   205  213 C D  T 3  S+     0   0   82  642   69  D S E DN   H RDKDARDLSED E DD NPT  R D D H      D DN  QK  KSN    P    
   206  214 C N  T 3  S+     0   0   11  645   72  N q N VN   p dDdGSdTpRNN N TQ eSN  G T T d      E HN  Nn  GRA    N    
   207  215 C M  E <   - G   0 263B   9  637   30  M m M MM   m mLvMMmMsMMM M FM yMM  L M M m      M FM  Mm  TTM    M    
   208  216 C F  E     - G   0 262B  19  643   34  L F I IV   F LLIMILVLLLM L IF IIL  I F L L      M IF  LL  VLF    L    
   209  217 C c  E     -FG 190 261B   0  643    1  C C C CC   C CCCCCCCCCCC C CC CCC  C C C C      C CC  CC  CCC    C    
   210  218 C A  E     +FG 189 260B   0  643   10  A A A AA   A AAAAAAAAAAA A AA AAA  A A A A      A AA  AA  GAA    A    
   211  219 C G        -     0   0    4  643   18  G G G GG   G GGGSYGSGGGG G GG GGg  G G G G      G TG  GG  YGG    G    
   212  220 C Y        -     0   0   31  452   71  N D Y .G   G ...P..VYYF. . SY YGp  . Y Y .      Y .V  DF  .IY    T    
   213  221 C K     >  -     0   0   67  484   87  M P L .M   G ...L..RVIRL . KK PLK  . L K .      R .P  EE  NLL    Q    
   214  222 C P  T >4 S+     0   0   63  534   70  A S E AG   Q ...ATSEQERD . DQ GEK  . E D .      N .E  KE  DKE    E    
   215  223 C D  T 34 S+     0   0  132  572   39  G L G AG   D ...GVEEGGGS . GG GGS  G G G .      G .G  YG  QGG    G    
   216  224 C E  T 34 S-     0   0   83  609   46  G K G GG   Q ...GGGGRGRV n GG GKD  E G G .      G .G  GK  GGG    G    
   217  225 C G    <<  +     0   0   49  117   85  . . . ..   . NSN.....I.. k .. ...  . . . N      . A.  ..  ...    .    
   218  226 C K        -     0   0  124  137   84  . . . ..   . TWE........ E .. ..K  K . . S      . P.  ..  ...    .    
   219  227 C R        +     0   0   81  180   80  . . . ..   . RGK........ K .. ..K  D . . R      . R.  ..  ...    .    
   220  228 C G        +     0   0    3  583   68  K Q K AI   K RRSVKHKK.V. E YQ V.Y  I K R R      K KQ  KK  KKK    K    
   221  229 C D  B     -A   30   0A  12  624   16  D D D SD   D DGDDDDDDDDG D DD DDD  D D D D      D DD  DD  DDD    D    
   222  230 C A        +     0   0    9  640   48  T A S SS   S STAASSSATSV A AT SAA  A S S T      S SS  SA  SSS    S    
   223  231 C d    >>  -     0   0   13  644    1  C C C CC   C CCCCCCCCCCC C CC CCC  C C C C      C CC  CC  CCC    C    
   224  232 C E  T 34 S+     0   0   95  644   57  V Q Q MQ   N QNQQQQQQQAQ K KR GIQ  T Q Q Q      Q AQ  QK  QKQ    E    
   225  233 C G  T 34 S+     0   0   20  645    8  G G G GG   G GGGGGGGGGGG G GQ GGG  G G G G      G GG  GG  GGG    G    
   226  234 C D  T X4  +     0   0    0  645    0  D D D DD   D DDDDDDDDDDD D DD DDD  D D D D      D DD  DD  DDD    D    
   227  235 C S  T 3< S+     0   0   16  645    6  S S S SS   S SSSSSSSSSSS S SS SSS  G S S S      S SS  SS  SSS    S    
   228  236 C G  T 3  S+     0   0    0  645    1  G G G GG   G GGGGGGGGGGG G GG GGG  G G G G      G GG  GG  GGG    G    
   229  237 C G    <   -     0   0    0  645    4  G G G GG   G GGGGGGGGGGG G GG GSG  A G G G      G GG  GG  GGG    G    
   230  238 C P  E     - H   0 246B   0  645    7  P V P PP   P PPPPPPPPPPP P PP PGP  A P P P      P PP  PP  PPP    P    
   231  239 C F  E     -EH 166 245B   0  644   24  L F M LL   L LLLLLLLLLLL L MF LLL  L V L L      L LY  VL  LLV    L    
   232  240 C V  E     -EH 165 243B   2  643   42  V A V VL   I VVVLVVVTVLV L VV VMI  F V T V      M MA  VV  VIV    V    
   233  241 C M  E     - H   0 242B   0  643   64  C V C CC   C CCCFSCCCCAA C VA CVC  C C I C      M ML  CC  CCC    C    
   234  242 C K  E     - H   0 241B  11  644   80  N K E QT   N KKKQGRDMNKY S QE PRG  P N K K      E NR  NL  ENN    N    
   235  243 C S     >  -     0   0    1  642   84  G D G QG   G VWVRGVGRIDP N RG RLK  M N K V      K RD  GV  LGG    G    
   236  244 C P  T  4 S+     0   0   47  109   82  . E . ..   . ..........S . .. ...  T . . .      . ..  ..  ...    .    
   237  245 C F  T  4 S+     0   0  145  304   83  . N . ..   . .R.E.....RN . P. G..  E . . .      A G.  .G  ...    T    
   238  246 C N  T  4 S-     0   0   63  501   60  E S . DQ   . NEND.N.ANHn D D. NDE  d Q D N      N ND  .Q  N..    .    
   239  247 C N     <  +     0   0   85  373   58  . D . G.   . G.GG.G.GNGa . N. GN.  q . D G      . .G  ..  G..    .    
   240  248 C R        -     0   0   59  432   80  . R . A.   . TTTR.T.RKRQ . R. SE.  Q . R T      R RR  .S  T..    .    
   241  249 C W  E     - H   0 234B   1  442   42  . W . W.   . WWWF.W.WYWY . W. FF.  F . M W      W QF  .W  W..    .    
   242  250 C Y  E     -cH 147 233B  19  521   85  . V Q T.   Y LVLVRLSVTTF . VK VV.  E . V L      Y CW  SL  FEE    .    
   243  251 C Q  E     + H   0 232B   0  638   57  L A L LL   L QQQILQLLLIQ F VL LLF  Q L L Q      L QA  LQ  QIL    L    
   244  252 C M  E     +     0   0B   0  642   82  H T Q VQ   Q AVAVVAQVMYI V AI TCS  I Q I A      I VA  QA  VQQ    H    
   245  253 C G  E     -IH 264 231B   0  645    0  G G G GG   G GGGGGGGGGGG G GG GGG  G G G G      G GG  GG  GGG    G    
   246  254 C I  E     -IH 263 230B   0  645   23  I I V II   L VVVIVVIVVVV I IV IVI  I V L V      I II  LV  IIV    I    
   247  255 C V  E     +I  262   0B   5  643   28  T V V VV   V VVVVVVIVTTV V II VVV  V V V V      V VV  VI  VVV    I    
   248  256 C S  E     -     0   0B   6  644    5  S S S SS   S SSSSSSSSSSS S AS SSS  N S S S      s SS  SS  SSS    S    
   249  257 C W  E     +I  261   0B  35  642   16  W W W WW   F WWWWWWWWFFW . WW WFF  W W W W      y WW  WW  WWW    W    
   250  258 C G        -     0   0   36  645    5  g G G GG   g DGGGGGGGGGg g GG GGG  G G G D      S GG  gG  GgG    g    
   251  259 C E  S    S-     0   0   61  627   89  l I H SL   a EKDIYEQKNEi g MH KRK  V F V E      . IV  yE  IhY    f    
   252  260 C G  S    S-     0   0   21  637   41  V G G sq   P GGGGGGdSGGd G RE GKK  G G Q G      . GD  PG  GPG    P    
   253  261 C d  S    S-     0   0   12  642    1  C C C cc   C CCCCCCcCCCc C CC CCC  C C C C      C CC  CC  CCC    C    
   254  262 C D  S    S+     0   0   28  643   37  G S A SA   G AGAGAAAAAAA G GA AAG  N A A A      A AG  AA  SGA    G    
   255  263 C R    >   -     0   0  128  645   82  S R Q PQ   Q QLQRALVLKRR N EL RLD  E E L Q      Q TK  QR  NQE    Q    
   256  264 C D  T 3  S+     0   0   93  645   73  P G R SP   V PTPPVPTPPQP P PA PPP  K K P P      R DQ  PQ  KSK    P    
   257  265 C G  T 3  S+     0   0   29  629   69  N Y N KN   G NNQYNNRNYGH E NG NHK  N N S Y      G TG  NN  GLD    N    
   258  266 C K    <   -     0   0   90  639   88  K G K PR   V RFRKYRKRIRF K SY YVY  F Q L R      Q YT  RR  YKH    R    
   259  267 C Y        -     0   0   14  641   48  P F P GP   P PPPPPPPPPYP P PP VPP  P P P P      P GY  PP  PPP    P    
   260  268 C G  E     -G  210   0B   3  618   10  G . G .G   G GGGGGGGGGGG G GG GGG  G G G G      G .G  GG  GGG    G    
   261  269 C F  E     -GI 209 249B   3  639   18  I . V VV   V IVIIVIVVVIV V VV VVI  T V V I      I VV  VV  VVV    V    
   262  270 C Y  E     -GI 208 247B   2  644    4  F Y Y YY   Y YYYYYYYYYYY Y YY YYF  Y Y Y Y      Y YY  YY  YYY    Y    
   263  271 C T  E     -GI 207 246B   2  644   35  A T T AT   T TATTATTTTAT T MA LTT  T A T T      H TT  TI  TTA    T    
   264  272 C H  E  >  - I   0 245B  31  644   59  K K K RK   N RRRRDRKNRKN R RR QKR  D K R R      R RR  NR  EKR    R    
   265  273 C V  T >4 S+     0   0    0  643   15  V L V VV   L VVVVVVVVVVV L IV VVL  V V I I      V IV  LV  VVV    V    
   266  274 C F  G >4 S+     0   0   39  642   74  F L C TC   C TTTNATCASET s SA TSt  F C S T      A ST  CT  SFC    P    
   267  275 C R  G 34 S+     0   0  132  642   86  N N N KN   K YSYHAHKTSNR k KS SSr  E K E Y      H SN  KA  FDI    Q    
   268  276 C L  G  S+     0   0   57  641   79  L V V RV   T LLLLRLVSILE L KR MTL  K T V L      V EM  NH  KNN    V    
   270  278 C K  H  > S+     0   0  164  641   65  N D S AG   E DPDNSDDPERD S DD SDQ  P T D D      D TE  KN  KED    Q    
   271  279 C W  H  > S+     0   0   37  641    0  W W W WW   W WWWWWWWWWWW W WW FWW  W W W W      W WW  WW  WWW    W    
   272  280 C I  H  X S+     0   0    1  641   10  I I I II   I IIIIVIIIIII I II III  I L V I      I II  II  IIL    I    
   273  281 C Q  H >X S+     0   0   79  605   76  S K K DR   E HRHI HQQNRR A NR N R  D Q   H      S NN  QH  IQE    R    
   274  282 C K  H >X S+     0   0  135  595   73  D K T QR   K HHQE QK ERS A KA E D  K Q   R      Y RK  EQ  DSR    D    
   275  283 C V  H 3< S+     0   0   15  570   82  I E T IT   T YHYH CT KT  I IT T V  H T   Y      I  T  TV  HIT    T    
   276  284 C I  H << S+     0   0   49  556   45  I M M II   V VIVT IM II  M I  I    L M   V      I  M  II  LIM    I    
   277  285 C D  H <<        0   0  114  506   74  Q E A AQ   Q PHPS PD  A  K    S    E A   P      N  Q  QP  RAA    R    
   278  286 C Q     <        0   0  142  322   66  N   S        KSKD RN  E  Q           S   E      S  E      Q      K    
## ALIGNMENTS  701 -  770
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  V  VIIII   I I  IIIIIVVI I IIIV VVIII I I II M     MIIIM III  IIVI  I 
    30   38 B V  B     +A  221   0A  13 2209   20  V  VVVVT   T M  LVVVVVVV I VVIV VVVVV V V VV V     VVVVVVMVV  VVVV  V 
    31   39 B E  S    S+     0   0  131 2214   31  G  GSGNG   G G  GGGGGNNN G GGGG GGGGG N N GG G     GNGGGGGNG  GNGN  G 
    32   40 B G        -     0   0   30 2221    1  G  GGGGG   G G  GGGGGGGG G GGGG GGGGG G G GG G     GGGGGGGGG  GGGG  G 
    33   41 B S  E     -B  184   0B  74 2221   88  A  HQQES   S Q  AQQQQEEE T EEQE YEEEE E E KH Q     QETQQEVEE  TEEE  T 
    34   42 B D  E     -B  183   0B  99 2227   62  N  SDNTN   G D  DDDDDDDD E DDND LDNDD E D KD D     DNADNDDNV  DNDN  D 
    35   43 B A        -     0   0    5 2227   45  A  AATAA   A A  AAAAAAAA A AAAV EVAAA A A AA A     AAAAASAAA  SAVA  S 
    36   44 B E    >   -     0   0   41 2228   84  T  EHQVV   A A  QAPPPKKI Q PPAR ERSPE V V YQ L     LVQSLMEVK  KVRV  K 
    37   45 B I  T 3  S+     0   0   90 2237   79  A  LPKSP   A V  EAAAAPPP A AAPQ QAPAL P P EL E     EPTPEEESK  KSAS  K 
    38   46 B G  T 3  S+     0   0   11 2241   60  G  GGGGG   G G  GGGGGHHG G GGGN GNGGG G G GG G     GGGGGGGGN  GGNG  G 
    39   47 B M  S <  S+     0   0    7 2243   67  S  GQQSQ   R R  RQFFFSSS A AANS GSSAR S S AA E     ESAREEKSE  ESSS  E 
    40   48 B S  S >  S+     0   0   11 2247   63  W  WWWWW   W W  WWWWWWWW W WWWW SWWWW W W WW W     WWWWWWWWF  WWWW  W 
    41   49 B P  T 3  S+     0   0    5 2251    4  P  PPPPP   P P  PPPPPPPP P PPPP PPPPP P P PP P     PPPPPPPPP  PPPP  P 
    42   50 B W  T 3  S+     0   0    2 2253   18  W  WWWWW   W W  WWWWWWWW W WWWW WWWWW W W WW W     WWWWWWWWH  WWWW  W 
    43   51 B Q  E <   -J   59   0C   2 2256   32  Q  IQQQQ   Q Q  QQQQQQQQ V QQQQ QQQQQ Q Q QQ Q     QQVQQQQQQ  QQQQ  Q 
    44   52 B V  E     -JK  58  91C   0 2257   34  V  VVVVV   V V  VAVVVIIV V AAAA QVVVG V V AV V     VVVVVAVVA  IVVV  I 
    45   53 B M  E     -JK  57  90C   0 2256   51  S  SSSSS   S S  SMSSSSSS S SSSS VSTSS S S SS S     SSSSSSSSL  SSSS  S 
    46   54 B L  E     -JK  56  89C   0 2257   14  L  LLLLI   I L  LLLLLLLL L LLLL LLLLL L L LL I     ILLIILVLL  LLLL  L 
    47   55 B F  E     -JK  54  88C   0 2256   82  H  QLRqT   T R  RQQQQQQQ q HHNQ LQFhR Q Q Rq Q     QQQQQlRqG  SqQQ  S 
    48   56 B R  E   > -JK  53  87C  76 1547   74  L  v.IyY   Y V  Ii...yyD y IIRy RyIfL . D Ry R     R.i.RyVyw  Yyy.  Y 
    49   57 B K  T > 5S+     0   0   41  951   80  A  f....   . .  .v...dd. G ...g Rg... T . .g .     .Dg.....p  ..gQ  . 
    50   58 B S  T 3 5S+     0   0   72 1192   73  S  PES..   . .  .A...GGK R ...S AS... S K .V .     .SKG....E  ..SS  . 
    51   59 B P  T 3 5S-     0   0   69 2030   82  V  RNASE   D N  NGTGTEET V NNEN DS..W S T NG N     NSIAN.RSE  KSSN  K 
    52   60 B Q  T < 5 +     0   0   62 2193   78  N  ARGGG   G Q  NGSSSWWG L GGGF GFDGD G G HF G     GGLNGNHGY  GGFG  G 
    53   61 B E  E   < -J   48   0C  77 2221   95  F  VVLFV   T I  RTSRARRF V GGGY SYESS F F AK S     SFAGSKMFK  EFYF  E 
    54   62 B L  E     +J   47   0C  17 2246   57  H  HAHHH   H H  HAHHHHHH H HHQH GHSHH H H HH H     HHHHHHHHF  PHHH  P 
    55   63 B L  E     -     0   0C  17 2261   70  I  VVIFV   V I  VLFFFTTF V SSFT FTLFV F F IL F     FFIFFLVFE  VFTF  V 
    56   64 B b  E     -J   46   0C   1 2264    1  C  CCCCC   C C  CCCCCCCC C CCCC CCCCC C C CC C     CCCCCCCCC  CCCC  C 
    57   65 B G  E     +J   45   0C   2 2264    3  G  GGGGG   G G  GGGGGGGG G GGGG GGGGG G G GG G     GGGGGGGGG  GGGG  G 
    58   66 B A  E     -J   44   0C   0 2264   13  G  GGGGG   G G  GGGGGGGG G GGGG GGGGV G G AG G     GGGGGGGGG  GGGG  G 
    59   67 B S  E     -JL  43  67C   0 2264   40  T  SSSSS   S S  SSSSSTTS A TTST TTSSS S S TS S     SSSSSSSSS  SSTS  S 
    60   68 B L  E     + L   0  66C   0 2264   10  L  LLLLL   L L  LLLLLLLL L LLLL LLLLL L L LL L     LLLLLLLLL  LLLL  L 
    61   69 B I        -     0   0   23 2264   15  I  IIIIV   V I  IIIIIIII V IIII IIIIL I I II I     IIVIIIIII  IIII  I 
    62   70 B S  S    S-     0   0   32 2264   62  S  SSHNS   S S  LNNNNAAS R NNSS SATNS S S SN T     TSKTTSNNS  ANAN  A 
    63   71 B D  S    S+     0   0   61 2210   68  S  ETPQE   E E  ASNNNAAE E NNSN DNDNH E E HE E     EQSDDNSQE  NQNQ  N 
    64   72 B R  S    S+     0   0   80 2263   73  Q  NTSYK   Q R  QQQQQNND R QQEQ QQQER A D SY R     RSKQRQQYR  SYQY  S 
    65   73 B W  E     - M   0 132C  12 2264   12  W  WWWWW   W W  WWWWWWWW W WWWW WWWWW W W WS W     WWWWWWWWY  WWWW  W 
    66   74 B V  E     -LM  60 131C   0 2262   11  V  VVVVV   V V  VIVVVVVV V IIVV VVVVA V V AV V     VVVVVVVVV  IVVV  I 
    67   75 B L  E     +LM  59 130C   0 2263   23  L  LLLVL   L L  LLLLLMMV L LLLL VLLLL V V LL L     LVLLLVLVL  LVLV  L 
    68   76 B T  E     - M   0 129C   0 2263   28  T  TTTTS   S T  TSTTTTTT T TTTT STTST T T TT T     TTTTTTTTT  TTTT  T 
    69   77 B A    >   -     0   0    0 2262    2  A  AAAAA   A A  AAAAAAAA A AAAA AAAAA A A AA A     AAAAAAAAA  AAAA  A 
    70   78 B A  G >> S+     0   0    0 2263    6  A  AAAAA   A A  AAAAAAAA A AAAA AAAAA A A AA A     AAASAAAAA  AAAA  A 
    71   79 B H  G 34 S+     0   0   10 2264    3  H  HHHHH   H H  HHHHHHHH H HHHH HHHHH H H HH H     HHHHHHHHH  HHHH  H 
    72   80 B b  G <4 S+     0   0    0 2264    1  C  CCCCC   C C  CCCCCCCC C CCCC CCCCC C C CC C     CCCCCCCCC  CCCC  C 
    73   81 B L  T <4 S+     0   0    1 2264   68  M  LIFRF   F I  IFFFFIIG T FFII MIIFF E G FV F     FKTIFFIRF  FRIR  F 
    74   82 B L  E  <  +P   81   0D  46 2264   89  V  KERVP   P Q  LKPPKKKV K QQTG QGTSE V V PR S     SVKGSQYVK  DVGV  D 
    75   83 B Y  E > > -P   80   0D  49 2249   82  I  DSSSS   R R  SSSSSPPR D RRGP GSPST R R PR N     NTDGNRSSR  SSSQ  S 
    76   84 B P  G > 5S+     0   0   52 2249   88  R  ILSAE   E S  RTRRGDDT A TTKS PYfTD K T PQ T     TPTDTSRPG  QPYA  Q 
    77   85 B P  G 3 5S+     0   0   75  844   90  .  .....   . .  ..G.S..S . ..SS V.n.L . S .I .     .........  ....  . 
    78   86 B W  G < 5S-     0   0  166  852   93  .  .....   . .  ..S.A..D . ..DS D.S.S . D .D .     .........  ....  . 
    79   87 B D  T < 5 +     0   0  152  869   93  .  .....   . .  ..A.S..V . ..PY H.T.D . V .P .     .........  ....  . 
    80   88 B K  E   < +P   75   0D  51  904   83  .  .....   . .  ..S.G..V . ..ST V.I.P . V .Y .     .........  ....  . 
    81   89 B N  E     +P   74   0D 110  936   80  .  .....   . .  ..G.V..V . ..AY T.V.S . V VY .     .........  ....  . 
    82   90 B F        -     0   0   28 1017   94  .  .....   H .  ..V.N..V . ..IR V.Y.G . A KW .     .........  ....  . 
    83   91 B T    >>  -     0   0   70 1164   86  T  .L..H   L .  ..N.V..G . SSTV G.L.W . G LR .     .....M...  ....  . 
    84   92 B E  G >4 S+     0   0   35 1455   85  P  RPQGS   R .  .SVSV..E . TTVY R.GSM . E PV S     SG..SD...  N..G  N 
    85   93 B N  G 34 S+     0   0  127 1677   87  G  EPRNK   E M  .tVAL..F S SSFL d.HTV . F QM E     ERR.ET.rN  Vr.Y  V 
    86   94 B D  G <4 S+     0   0   49 1292   82  A  PSPHE   . .  .n.S...D D NN.. d.NSQ S D .I T     THD.TS.hP  Sh.H  S 
    87   95 B L  E <<  +K   48   0C   0 1493   89  W  QDSRS   D I  .V.G...Q P VV.. KTYGF H Q .G S     SFPISN.RD  QRTY  Q 
    88   96 B L  E     -KN  47 108C   3 2025   51  V  fyyVy   y f  fVLv.ffG l IIL. LyLlG L G fL l     lVlllyiVI  yVyV  y 
    89   97 B V  E     -KN  46 107C   0 1516   29  V  alv.v   v v  yV.v.vv. a VVG. .v.i. V . v. v     v.vvvvv.V  v.v.  v 
    90   98 B R  E     -KN  45 106C   0 1577   87  Y  VVMIR   K W  SSGV.FF. V YYR. .Y.YQ V . V. L     LVIHLLKIR  YIYI  Y 
    91   99 B I  E     +KN  44 105C   0 1674   49  L  VLLLL   L M  VLLL.VV. I LLI. .L.LL A . L. L     LLGLLLVLL  LLLL  L 
    92  100 B G  S    S+     0   0    7 1756   23  G  GGGGG   G G  KGQG.GG. G GGNG .G.GT G . G. G     GGTGGGGGG  GGGG  G 
    93  101 B K        +     0   0   13 1789   76  R  VSEEA   A S  MRSL.KK. T RRQK .K.RS V . E. A     VENAVVDEE  VEKE  V 
    94  102 B H        +     0   0   36 1883   76  E  HMLHH   H I  GILQGHH. N RRAH .H.EM S . LH R     RYNYLNRHH  YHHH  Y 
    95  103 B S  B     -Q  181   0E  21 1965   75  T  NSKDQ   Q K  DTQSLNN. N FFGN .N.SP D . QD Q     QDINQKSDN  RDND  R 
    96  104 B R  S    S+     0   0   16 2018   82  Q  LSLRL   L A  VEGLQLL. I QQPL .L.QS L . LT L     LRKLLLVRI  LRLR  L 
    97  105 B T  S    S+     0   0   31 2112   87  A  FYYQD   D G  SQSQSLL. H QQNG .G.EF S . FS V     VSGLAAYQD  SQGG  S 
    98  106 B R  S    S-     0   0   85 2151   87  G  QPTYS   S Y  VGNGLEES G QQPS RK.GW S S SR K     KSYQRNRYD  LYKS  L 
    99  107 B Y        -     0   0   21 2204   90  P  RNSNY   Y S  YSPSQDDD H PPNN ASFSS D D SP P     PNHSPSQND  LNSS  L 
   100  108 B E    >>  -     0   0   22 2250   66  N  HNPSS   S S  TNNNGEEE Y NNEE EEDNL E E PE G     GAHNGQNSS  QSEA  Q 
   101  109 B R  T 34 S+     0   0  143 2252   78  P  RDPEE   P H  RPSPSVVE P EEVS PSPPQ E E KR P     PEPPPPTED  NESE  N 
   102  110 B N  T 34 S+     0   0  133 2255   82  N  NDNQD   E V  NHVNNGGN H NNSG GGDNA A N QH H     HPHNHHSPN  PPGS  P 
   103  111 B I  T <4 S+     0   0   58 2257   77  E  TGSIA   A T  TQSRPSSI T EERA ESPEY V I ST A     ALSEAKLIQ  NISV  N 
   104  112 B E     <  -     0   0    0 2258   77  V  KVSQK   E E  SVQVNKKQ K VVSI QINVY Q Q IV M     VQKEVLVQV  TQIQ  T 
   105  113 B K  E     -N   91   0C  69 2257   91  R  KQFVV   V Y  LSTSRAAV K SSVA QAKST V V SK Y     YVKIYSIVD  VVAV  V 
   106  114 B I  E     -N   90   0C  11 2259   71  S  IIAKS   R L  ILVRVIIL I RRII IIVRR L L SR A     ALIRALPMF  SMIK  S 
   107  115 B S  E     -N   89   0C  12 2260   84  T  KRSST   T I  ISTTSFFK K SSQS QSTSY R K PR R     RSKGRGISE  RSSS  R 
   108  116 B M  E     -N   88   0C  58 2260   71  V  ITVIV   V S  PVTIrPPI I VVAP VPqVF I I LV V     VIVIVLKII  SIPI  S 
   109  117 B L  E     +O  133   0C   6  452   51  .  .V...   . .  V...v... . .... ..l.V . . .. .     .........  V...  V 
   110  118 B E  E    S+     0   0C  92 1908   74  S  KVRSK   A .  ES.TTEEA K SS.A QAESS A A SR K     KSKAKR.SE  KSAA  K 
   111  119 B K  E     -O  132   0C  92 2029   65  Q  EQRRY   Q K  NK.TTKKK A EE.K KKDEN E K KD R     RKAHRRTKS  RKKK  R 
   112  120 B I  E     -O  131   0C  20 2160   45  V  IIIAI   V I  IIVLLIIV I II.I VIIII V V VI V     VAISVIIAI  IAIA  I 
   113  121 B Y  E     -O  130   0C  66 2224   50  L  IIIII   M I  IIIIIVVF I IITI LIIIY V F IF E     EIIFEIFIE  IIII  I 
   114  122 B I  E     -O  129   0C  52 2228   82  V  IKIST   P I  VVVVVVVK I NNCV VVCRL E K LV S     STIVSRVSR  ISVT  I 
   115  123 B H    >   -     0   0   25 2247   20  H  HHHHH   H H  YHHHHHHN H HHHH HHHHS H N HH N     NHHHNHHHH  HHHH  H 
   116  124 B P  T 3  S+     0   0  106 2258   50  P  PPPPP   P P  PPPPPEEP P PPPE PEPPP P P PS P     PPPPPPPPP  PPEP  P 
   117  125 B R  T 3  S+     0   0  162 2261   76  D  QSSYS   S K  ENNNNKKK N NNSA HAEDR L K DQ L     LFDDKIKYE  DYAY  D 
   118  126 B Y    <   -     0   0   15 2261   15  Y  FYYYY   Y H  FYYFYWWF F YYYW FWYYY W F YF Y     YWFYYYFYY  YYWY  Y 
   119  127 B N  B > > +R  125   0F  41 2262   68  N  IeqNL   R E  rdNNNnnS I NNdd hdDNL N S sQ q     qNNNqSsNK  QNdN  Q 
   120  128 B W  T 3 5 +     0   0   62 1485   76  .  .yt..   . .  lr...llI L ..fy fy..G L I s. m     m.L.m.i.F  F.y.  F 
   121  129 B R  T 3 5S+     0   0  192 1311   77  .  P.iSQ   Q .  .TSSSLL. . SS.. ..AS. . . DM A     AP.PAG.SR  ES.S  E 
   122  130 B E  T < 5S-     0   0  101 1657   80  N  DGPQE   E D  RNEAVVVL E QQ.. ..SD. H L GE S     STEHSE.QA  GQ.Q  G 
   123  131 B N  T   5S-     0   0    4 2142   69  t  TPTNG   G K  TNTTTAAT S TTTR TRTTN A T ST S     STNTSSVNS  SNRN  S 
   124  132 B L    > < +     0   0   25 1817   69  f  Y..FS   . .  V.S.ALLV Y QQNI FINSS L V .F .     .LYY..VFY  .FIF  . 
   125  133 B D  B 3   +R  119   0F   7 2115   65  N  E..NQ   s N  Q.DqDGGN V DDDR DRDNP R N RE .     .NVD.sKNH  NNRN  N 
   126  134 B R  T 3  S-     0   0   43 2196   57  N  NGGNG   g A  NNNnNNNN N NNNN SNNNY N N GN A     ANNNAgNN.  GNNN  G 
   127  135 B D    <   +     0   0    0 2261    0  D  DDDDD   D D  DDDDDDDD D DDDD DDDDD D D DD D     DDDDDDDDD  DDDD  D 
   128  136 B I        +     0   0    0 2264   11  I  IIIII   I I  LLIIIIII I IIVI VIIMI I I II V     VLIIVIIII  IIII  I 
   129  137 B A  E     -MO  68 114C   0 2263   48  A  AAATA   A A  ATAAAAAT A CCCA AACAA A T AA A     ATAAAAATA  ATAT  A 
   130  138 B L  E     -MO  67 113C   0 2264    6  L  LLLLL   L L  LLLLLLLL L LLLL LLLLL L L LL L     LLLLLLLLL  LLLL  L 
   131  139 B M  E     -MO  66 112C   0 2264   30  L  FVILL   L L  LLLLLIIL F LLLI LIVLV L L VF V     VLFLVVLLI  ILIL  I 
   132  140 B K  E     -MO  65 111C  19 2264   49  K  HQQKQ   R K  HKQQQKKK H KKKK RKKRK K K KK E     EKHQEEKKK  EKKK  E 
   133  141 B L  E     - O   0 109C   0 2264    8  L  LMLLL   L L  LLLLLLLL L LLLL LLLLL L L LL L     LLLLLLLLL  MLLL  M 
   134  142 B K  S    S+     0   0  111 2264   73  Q  KDGSS   N F  LASSSSSA K SSSS ASSSS A A AY D     EAKSEEQSK  DSSS  D 
   135  143 B K  S    S-     0   0  171 2264   76  S  RSSSS   R S  YSSSSEET K TTAT RTTSA T T QK T     ASKAARHSE  QSTS  Q 
   136  144 B P        -     0   0   73 2264   40  P  APPPP   P Q  PPPPQPPP A PPPP PPPTP P P PS P     PPASPPPPN  PPPP  P 
   137  145 B V        -     0   0   11 2220   48  V  VV.VV   V V  VVVVVVVA V VVVV VVVVV A A LV V     VAVVVIVVV  VVVA  V 
   138  146 B A        -     0   0   75 2253   81  Q  SN.QT   A T  NTNTTTTR R SSNQ LQKET R R SR T     TQKNTQNQR  TQQQ  T 
   139  147 B F        +     0   0   87 2257   43  F  YF.MF   F F  FFFFFLLF Y FFFR RRFFY L F FY F     FYYFFFFIF  FIRL  F 
   140  148 B S        -     0   0   40 2259   60  N  NN.NS   S T  TNTTNSSS N TTTS GSTTT S S SN T     STTTTTTNS  TNST  T 
   141  149 B D  S    S+     0   0   81 2262   69  D  DNSSR   R S  SDNNNDDQ D DDND PDDKK G Q PD N     NKEDNNTSK  PSDS  P 
   142  150 B Y  S    S+     0   0   81 2252   87  F  YLQRY   H L  NYYYYHHT Y YYYS TSYYH A T WY Y     YRYYYYNRV  YRSR  Y 
   143  151 B I        +     0   0    0 2256   24  I  VIIVI   I I  IIIIIVVV I IIII AIIII V V II I     IIIIIIIVI  IVII  I 
   144  152 B H        -     0   0    4 2256   79  R  QLMSR   R L  QSTTTQQS Q RRYM AMQRQ S S LQ L     LTQQLLYSR  LSMS  L 
   145  153 B P        -     0   0    9 2256   44  P  PPPPP   P P  PPPPPLLA P PPPP PPPPP P A PP P     PPPPPPPPP  PPPP  P 
   146  154 B V        -     0   0    1 2260   37  V  IIVVI   I I  IVVVVAAV I IIVA AAIVI V V AI V     VVIVVIVVA  AVAV  A 
   147  155 B a  B     -c  242   0B   3 2260   46  C  CCCCC   C C  CCCCCCCC C CCCC CCCCC C C CC C     CCCCCCCCC  CCCC  C 
   148  156 B L        -     0   0   32 2260    9  L  LLLLL   L L  ILLLLIIL L LLLL LLLLL L L LL L     MLLLVLILL  LLLL  L 
   149  157 B P        -     0   0    0 2259   30  A  PPPAP   P P  PASPPPPP P AAAP PPAAQ P P PP P     PAPAPPPAW  PAPA  P 
   150  158 B D     >  -     0   0   51 2255   78  S  FGASA   A S  QAASSPPS F AAAA DASAA S S KA D     DSFSDTSSt  PSAA  P 
   151  159 B R  H  > S+     0   0  148 1806   76  N  FTPSA   A I  .ATTTAAA . TTAS PSEQS T A AT P     PP.HPA.Sq  PSSS  P 
   152  160 B E  H  > S+     0   0  122 1873   75  V  KAQSN   N T  .GNGNEED . GGNG HGNGT N D HH S     SN.NSS.SN  ASGS  A 
   153  161 B T  H  > S+     0   0   10 2003   82  S  EETTA   A K  QSSSSTT  D SSSE LESS  T   NF V     VEDSVVETI  ATET  A 
   154  162 B A  H  X S+     0   0    7 2020   84  Q  VQHSS   S Q  TDTTTVV  V TTTI SITD  S   PN T     VAVTVQSSN  LSIS  L 
   155  163 B A  H  < S+     0   0   70 2078   68  F  FLFIF   F L  FFFFFLL  F YYVL KLFF  F   FL F     FLFFFFFVV  LVLI  L 
   156  164 B S  H  < S+     0   0   36 2215   78  H  NIVPP   P K  QPYYYSS  Q AAYP YPYP  P   YN E     EPQHEPPPS  PPPP  P 
   157  165 B L  H  < S+     0   0    1  515   98  .  .....   . .  .....NN  I .... L...  .   .I .     ..K.....A  ....  . 
   158  166 B L     <  +     0   0   34  711   82  .  L....   . .  V....LL  L .... L...  .   .N .     ..L...V.L  ....  . 
   159  167 B Q  S >  S-     0   0   87  836   93  .  N....   . I  E....YY  D .... R...  .   .N .     ..D...K.I  ....  . 
   160  168 B A  T 3  S+     0   0   51 2039   74  T  TDSSN   N P  AGSSSPP  G AATH RHNA  T   TQ T     AAQESAASA  ASHS  A 
   161  169 B G  T 3  S+     0   0   42 1713   37  S  DGGGG   G .  GGGGG..  N GGRS GNGG  G   NS G     GGNGGGGG.  GGNG  G 
   162  170 B Y    <   -     0   0   46 1826   85  T  TNTTL   F A  TTVVV..  T SSTS SFTT  S   VY T     MLTTMMTT.  VTFT  V 
   163  171 B K  E     -D  188   0B  33 2112   87  P  RLLKH   K S  RSNNN..  K NNRP YPST  L   SV K     NTKHKKKT.  KTPR  K 
   164  172 B G  E     -D  187   0B   0 2154   45  C  CCCCC   C C  CSTTTCC  C VVSC GCST  C   CS C     CCCSCCCC.  CCCC  C 
   165  173 B R  E     -DE 186 232B   3 2164   80  W  FWWVT   T W  WWWWWYY  F WWWY KYWW  A   SY W     WAFWWWWV.  WVYV  W 
   166  174 B V  E     -DE 185 231B   0 2189   33  A  VVVTV   V V  VVVVVII  I IIIV VVVV  T   VI V     VTIVVVVT.  VTVT  V 
   167  175 B T  E     +D  184   0B   0 2202   48  T  STTTT   T T  TTTTTTT  S TTTT TTTT  T   T  T     TTSTTTTTT  TTTT  T 
   168  176 B G  E     -D  183   0B   1 2202    0  G  GGGGG   G G  GGGGGGG  G GGGG GGGG  G   G  G     GGGGGGGGG  GGGG  G 
   169  177 B W  S    S+     0   0    1 2202    1  W  WWWWW   W W  WFWWWWW  W WWWW WWFW  W   W  W     WWWFWWWWF  WWWW  W 
   170  178 B G  S    S-     0   0    0 2198    1  G  GGGGG   G G  GGGGGGG  G GGGG GGGG  G   G  G     GGGGGGGGG  GGGG  G 
   171  179 B N        -     0   0   33 2021   77  N  KNKRH   H Q  KTTTNRR  R TTKR ARDT  K   N  S     SRRDTNKRS  DRRK  D 
   172  180 B L  S    S+     0   0   55 1822   62  L  TITTV   V V  LLIIILL  T II L TLTI  T   I  P     PLTLPILTM  ITLT  I 
   173  181 B K  S    S-     0   0  147 1551   78  R  TGKGA   A S  KSRRG    K NN   R TG  R   K  S     SSEGSQVGE  KG G  K 
   174  182 B E              0   0   49 1397   62  S  EE QP   P T  ESSST    E TT   H GS  H   E  E     EGENEEPQT  EQ S  E 
   175  183 B T              0   0  181 1202   57  N  EN TS   S G  SGGGG    E GG     SD  N   G        E EG GGTA  GT T  G 
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                QP                     P P E  G    P          P     P   
   178  186 C Q        -     0   0   64  328   73   P            SN        R T          H P S  S   PP          P     P   
   179  187 C P        -     0   0    8  503   39   P      P P   PP        P P          P P N  P  PPPP         P     PP  
   180  188 C S  S    S+     0   0   81  526   81   F      D S   DR        K D          Q Y D  V  DFFH         F     FS  
   181  189 C V  B    S-Q   95   0E  21  534   82   P      K V   VI        S K          T P V  Q  TPPT         P     PV  
   182  190 C L        -     0   0    5  625    5   L      LLL L LL        L L    L     L L L  L LLLLL         L     LL L
   183  191 C Q  E     -BD  34 168B   9  629   50   K      QQQ R QQ        Q Q    R     Q K R  Q QHKKR         K     EQ R
   184  192 C V  E     +BD  33 167B   6  628   86   Q      QEE Y CK        C Q    E     K Q A  T ECEQC         Q     EE F
   185  193 C V  E     - D   0 166B  15  634   49   V      AAV L VL        V A    V     L V A  V VAVVA         VL    VV V
   186  194 C N  E     + D   0 165B   7  634   77   K      AER N TA        S A    L     K K Y  T MNEKN         KD    QQ R
   187  195 C L  E     - D   0 164B   0  638   34   V      LLV L VV        L L    V     V V V  V VIVVI         VI    VV L
   188  196 C P  E     - D   0 163B  12  639   46   P      PSP K PP        H P    E     P P P  P PSPPT         PP    PP P
   189  197 C I  E     -F  210   0B   9  640   33   I      LIV M MI        L L    I     I I A  I IIIVI         VI    IV V
   190  198 C V  E     -F  209   0B  10  641   39   M      LMI I VI        L L    R     I V V  I VIVVI         VL    VI A
   191  199 C E    >>  -     0   0   75  641   66   E      SLN K SD        S S    T     D E S  N GSEEE         ES    EE D
   192  200 C R  H 3> S+     0   0   86  640   78   N      NHN N ET        N N    H     S N Q  K NDNNH         NF    NN R
   193  201 C P  H 3> S+     0   0   77  641   74   H      AES D KP        D A    A     E H E  E ESSSQ         SS    RS E
   194  202 C V  H <4 S+     0   0   41  641   84   I      QKL D VK        M E    F     V L E  L VSRVK         VD    LV A
   195  203 C c  H >< S+     0   0    5  645    1   CC     CCC C YC        C C    C     C C C  C CCCCC         CC    CC C
   196  204 C K  H >< S+     0   0   91  645   74   DE     RNE N EN        A K    T     S D S  D NSDDE         DN    DQ Q
   197  205 C D  T 3< S+     0   0  141  645   80   AL     KKA S PL        R K    E     H A D  T QQARN         RK    LE R
   198  206 C S  T <  S+     0   0   15  645   87   KM     FVM R FL        A F    R     L Q F  A RDEKA         KS    KM W
   199  207 C T    <   -     0   0   25  645   71   YY     WFY Y YY        Y W    Y     Y Y Y  Y YYYYY         YY    YF L
   200  208 C R  S    S+     0   0  249  645   89   hh     Gkq y Ds        S g    r     w h v  k qPhhP         hP    hh w
   201  209 C I  S    S-     0   0   56  565   53   aa     Sre g Sf        E .    v     g g g  g gGggG         gG    gg d
   202  210 C R        -     0   0  123  556   82   Yr     KmH M .a        K k    e     P r .  G QHrpN         pM    hk p
   203  211 C I        -     0   0   12  633   24   TL     IVI I .I        V I    V     I I V  L ILIII         II    II F
   204  212 C T    >   -     0   0   12  638   73   GI     TKP D .K        T T    T     T V T  P IMVVT         VT    VL S
   205  213 C D  T 3  S+     0   0   82  642   69   DQ     EKN E .D        E D    S     E R D  D KSKQD         RD    RP Q
   206  214 C N  T 3  S+     0   0   11  645   72   nd     MGI K TD        F V    V     D d R  G dTdeT         eA    dS N
   207  215 C M  E <   - G   0 263B   9  637   30   im     .TF M IM        M M    M     M m M  Q mMvnM         mM    mF M
   208  216 C F  E     - G   0 262B  19  643   34   VL     IVI I FL        L I    F     L L V  I LVILV         LF    LV F
   209  217 C c  E     -FG 190 261B   0  643    1   RC     CCC C CC        C C    C     C C C  C CCCCC         CC    CC C
   210  218 C A  E     +FG 189 260B   0  643   10   DA     AGA A AA        A A    A     A A A  A AAAAA         AA    AA S
   211  219 C G        -     0   0    4  643   18   DG     GYG L GG        G G    G     G G G  a GGGGS         GG    GG G
   212  220 C Y        -     0   0   31  452   71   MS     ..R . .F        L .    G     Y . F  y SVN.V         .Y    .Y .
   213  221 C K     >  -     0   0   67  484   87   LV     .NK . .A        W .    G     L . K  G EEE.Q         .L    .A .
   214  222 C P  T >4 S+     0   0   63  534   70   CQ     ADK A .E        T A    A     E N E  V GGQDE         DE    NN .
   215  223 C D  T 34 S+     0   0  132  572   39   AG     SQG E GG        G S    Q     G K G  G QGSSG         SG    EG .
   216  224 C E  T 34 S-     0   0   83  609   46   GK     GGG G EK        G G    D     E G G  G DGDGG         GG    GK d
   217  225 C G    <<  +     0   0   49  117   85   N.     ... . ..        . .    .     . . .  . .....         ..    .. a
   218  226 C K        -     0   0  124  137   84   T.     ... . G.        . .    .     . . .  . .....         ..    .. V
   219  227 C R        +     0   0   81  180   80   R.     ... . H.        . .    .     . . .  . .....         ..    .. Q
   220  228 C G        +     0   0    3  583   68   RK     VKA T KK        K V    .     R H K  K .T.RK         RK    HR Q
   221  229 C D  B     -A   30   0A  12  624   16   DD     SDD D DD        D S    .     D D D  D .D.DD         ND    DD D
   222  230 C A        +     0   0    9  640   48   SS     SSS A SA        T S    A     A S A  A SSASS         FS    SS A
   223  231 C d    >>  -     0   0   13  644    1   CY     CCC C YC        C C    C     C C C  C CCCCC         CC    CC C
   224  232 C E  T 34 S+     0   0   95  644   57   QQ     KQE Q WK        G M    S     L Q Q  Q QEQQQ         QQ    QE Q
   225  233 C G  T 34 S+     0   0   20  645    8   GG     GGG G GG        G G    G     G G G  G GGGGG         GG    GG G
   226  234 C D  T X4  +     0   0    0  645    0   DD     DDD D DD        D D    D     D D D  D DDDDD         DD    DD D
   227  235 C S  T 3< S+     0   0   16  645    6   SS     SSS S SS        S S    S     S S S  S SSSSS         SS    SS S
   228  236 C G  T 3  S+     0   0    0  645    1   GG     GGG G GG        G G    G     G G G  G GGGGG         GG    GG G
   229  237 C G    <   -     0   0    0  645    4   GG     GGG G GG        G G    G     G G G  G GGGGG         GG    GG G
   230  238 C P  E     - H   0 246B   0  645    7   PP     PPP P PP        P P    P     P P P  P PPPPP         PP    PP V
   231  239 C F  E     -EH 166 245B   0  644   24   LL     LLM L VL        L L    F     L L L  L LLLLL         LV    LL F
   232  240 C V  E     -EH 165 243B   2  643   42   VV     VVV V VV        V V    A     M V V  A VVVVV         VV    VV A
   233  241 C M  E     - H   0 242B   0  643   64   CC     CCV A CC        C C    L     C C D  I CCCCC         CC    CL V
   234  242 C K  E     - H   0 241B  11  644   80   KP     QEQ S NF        N Q    W     Q K G  N SGKKN         KN    KQ R
   235  243 C S     >  -     0   0    1  642   84   VI     KLR D GM        G K    S     V V N  G WGVVQ         VG    VR D
   236  244 C P  T  4 S+     0   0   47  109   82   ..     ..E . ..        . .    N     . . .  . .....         ..    .. .
   237  245 C F  T  4 S+     0   0  145  304   83   ..     ..R G .N        V .    R     . . T  . .....         ..    .P R
   238  246 C N  T  4 S-     0   0   63  501   60   NN     DND R .Q        . D    T     D K .  . E.NN.         N.    ED n
   239  247 C N     <  +     0   0   85  373   58   GD     RGN L ..        . V    Q     G G .  . G.DG.         G.    DG d
   240  248 C R        -     0   0   59  432   80   TT     ATR S .T        . A    S     A A .  . I.TT.         T.    TR I
   241  249 C W  E     - H   0 234B   1  442   42   WW     WWF L .W        . W    W     W W .  . W.WW.         W.    WY W
   242  250 C Y  E     -cH 147 233B  19  521   85   LI     TFV Y LV        . T    W     L L .  R VIMLS         LE    LE V
   243  251 C Q  E     + H   0 232B   0  638   57   QQ     LQL L LQ        L L    L     L Q L  L QLQQL         QL    QL A
   244  252 C M  E     +     0   0B   0  642   82   AA     MVG F QA        Q V    A     A A V  A VQAAQ         AQ    AV T
   245  253 C G  E     -IH 264 231B   0  645    0   GG     GGG G GG        G G    G     G G G  G GGGGG         GG    GG G
   246  254 C I  E     -IH 263 230B   0  645   23   VI     IIV V LV        I I    I     I V V  I IIVVI         VV    VT I
   247  255 C V  E     +I  262   0B   5  643   28   VV     VVI V VI        T V    V     I V V  V VVVVI         VV    VV V
   248  256 C S  E     -     0   0B   6  644    5   SS     SSS S SS        S S    S     S S S  S SSSSS         SS    SS S
   249  257 C W  E     +I  261   0B  35  642   16   WW     WWW W WW        W W    W     W W W  W WWWWW         WW    WH W
   250  258 C G        -     0   0   36  645    5   GG     GGG G GG        g G    g     G G G  G GgGGg         GG    GG G
   251  259 C E  S    S-     0   0   61  627   89   EF     SII D LE        e S    r     E E K  N YvDDd         DY    EI I
   252  260 C G  S    S-     0   0   21  637   41   GG     gGG Q pG        P d    G     G G G  G SPGGP         GG    GR G
   253  261 C d  S    S-     0   0   12  642    1   CC     cCC C cC        C c    C     C C C  C CCCCC         CC    CC C
   254  262 C D  S    S+     0   0   28  643   37   AA     SSA G AA        A S    G     A A A  A GDAAA         AA    AA G
   255  263 C R    >   -     0   0  128  645   82   QR     TNE E RR        L T    V     E H E  K HTQKI         KE    QA E
   256  264 C D  T 3  S+     0   0   93  645   73   PP     SKP T PQ        P S    S     R A A  P RTPPT         PK    PP G
   257  265 C G  T 3  S+     0   0   29  629   69   NF     SGN G GN        E S    N     N N G  D DTHNR         NN    NY Y
   258  266 C K    <   -     0   0   90  639   88   RR     PYQ K IR        K P    L     R R Y  Y FKRRK         RH    RL G
   259  267 C Y        -     0   0   14  641   48   PP     GPP P PP        P G    P     P P P  P PPPPP         PP    PP F
   260  268 C G  E     -G  210   0B   3  618   10   GG     .GG G GG        A .    G     G G G  G GGGGG         GG    GG .
   261  269 C F  E     -GI 209 249B   3  639   18   IV     VVV I AV        V V    V     V I V  V VVIIV         IV    IV .
   262  270 C Y  E     -GI 208 247B   2  644    4   YY     YYY Y YY        Y Y    Y     Y Y Y  Y YYYYY         YY    YY Y
   263  271 C T  E     -GI 207 246B   2  644   35   TT     TTT A TI        T A    T     I T A  T ATTTT         TA    TM T
   264  272 C H  E  >  - I   0 245B  31  644   59   RQ     HER N NR        K R    R     S R R  E RKRRK         RK    RR K
   265  273 C V  T >4 S+     0   0    0  643   15   VV     VVI V LV        V V    I     L L V  V VVVVV         VV    VT V
   266  274 C F  G >4 S+     0   0   39  642   74   TL     TSS A CT        V T    g     S T A  A MCTTC         TC    TT L
   267  275 C R  G 34 S+     0   0  132  642   86   YS     KFE R KS        H K    s     A H A  A SRYSK         SL    YF N
   268  276 C L  G  S+     0   0   57  641   79   LT     IKR Y KH        Q I    R     R L R  R ILLLV         LN    LK V
   270  278 C K  H  > S+     0   0  164  641   65   DD     PKD D QD        K P    Q     S D D  Q SDDDD         DE    DP D
   271  279 C W  H  > S+     0   0   37  641    0   WW     RWW W WW        W W    W     W W W  W WWWWW         WW    WW W
   272  280 C I  H  X S+     0   0    1  641   10   II     VII I II        I V    I     V I V  I IIIII         IL    IL I
   273  281 C Q  H >X S+     0   0   79  605   76   HQ     QIN I DH        K Q    H     E H S  D RRHHQ         HE    YR K
   274  282 C K  H >X S+     0   0  135  595   73   HR     EDQ D NR        D K    N     K R E  K KDQQE         QS    RS K
   275  283 C V  H 3< S+     0   0   15  570   82   YT     IRI T II        T I    Q     I Y V  H YTHYT         YT    YV E
   276  284 C I  H << S+     0   0   49  556   45   VL     LLL I II        I L    L     V V    L VMVVM         VM    V  M
   277  285 C D  H <<        0   0  114  506   74   PA     ARQ K QP        S A          Q P    Q PRPPK         PA    P  G
   278  286 C Q     <        0   0  142  322   66   KE      Q  D  E                       K       RKQN         Q     K  D
## ALIGNMENTS  771 -  840
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10    IIIII  VI VI  LI   I     III II V  III  VIIII     I III VIIII VVIIII
    30   38 B V  B     +A  221   0A  13 2209   20    VVVIV  VV VI  IT   V     VVV VV V  VIV  VVVVV     V VVV IVVII VVVVVV
    31   39 B E  S    S+     0   0  131 2214   31    NGGGG  GG GG  EG   G     NGG GG G  GSG  GGGAN     S GSG GNGGG GGNNNN
    32   40 B G        -     0   0   30 2221    1    GGGGG  GG GG  GG   G     GGG GG G  GGG  GGGGG     G GGG GGGGG GGGGGG
    33   41 B S  E     -B  184   0B  74 2221   88    EYSST  KS RT  KS   K     EMR TV T  VSR  EVRKQ     S TSH VEEFT EEEEEE
    34   42 B D  E     -B  183   0B  99 2227   62    TEDEE  PS DE  AG   R     EPE DD D  VDE  DDNDE     D PDE DNPEE DEDDDD
    35   43 B A        -     0   0    5 2227   45    ACAAA  AA AA  GA   A     AAA AA A  AAA  AAAAA     A AAA VAAAA AAAAAA
    36   44 B E    >   -     0   0   41 2228   84    VARVR  KA VQ  RA   E     VPQ TR D  KQP  RRLET     K EKT RVSTN RRVVIV
    37   45 B I  T 3  S+     0   0   90 2237   79    SQRAP  LS PA  RA   E     PDT NQ E  PPR  PQPLP     L PLP QSPPP PPPPPP
    38   46 B G  T 3  S+     0   0   11 2241   60    GHEHG  GG GG  GG   G     GRG GG G  GNN  NGGGG     G KGG NGGGG NNGGGG
    39   47 B M  S <  S+     0   0    7 2243   67    SSASA  AE EA  DQ   E     SKA AS E  ASS  SSAQQ     Q EQQ SSSSS SSSSSS
    40   48 B S  S >  S+     0   0   11 2247   63    WQWWW  WF VW  SW   W     WWW WW W  WWW  WWWFF     F FFW WWWVW WWWWWW
    41   49 B P  T 3  S+     0   0    5 2251    4    PPPPP  PP PP  PP   P     PPP PP P  PPP  PPPPP     P PPP PPPPP PPPPPP
    42   50 B W  T 3  S+     0   0    2 2253   18    WWWWW  WW FW  WW   W     WWW WW W  WWW  WWWYY     W HWW WWWWW WWWWWW
    43   51 B Q  E <   -J   59   0C   2 2256   32    QQVQQ  MM FV  QQ   Q     QQL QQ Q  QMQ  QQQQQ     Q MQM QQQQM QQQQQQ
    44   52 B V  E     -JK  58  91C   0 2257   34    VVVAA  VV AV  IV   V     VVV IV V  VVV  VVVAV     V AVA VVVVV VVVVVV
    45   53 B M  E     -JK  57  90C   0 2256   51    SSSRI  AS SS  LS   S     SSS SS S  AQE  SSSMY     I RIA SPSSS SSSSSS
    46   54 B L  E     -JK  56  89C   0 2257   14    LLLVL  LI IL  LI   I     LLL LL L  LII  LLLLL     L LLI LLLLL LLLLLL
    47   55 B F  E     -JK  54  88C   0 2256   82    QNHVY  gQ eq  QT   R     QQQ RQ h  INi  QQQRT     k gkF QQqQQ QQQQqQ
    48   56 B R  E   > -JK  53  87C  76 1547   74    .LF.Y  nF .y  .Y   .     DIi YY v  wYk  yYyiy     . r.l y.rR. yy..r.
    49   57 B K  T > 5S+     0   0   41  951   80    D....  k. nG  N.   .     ..g .. .  h.p  s.lmk     d sdr gD... snDD.D
    50   58 B S  T 3 5S+     0   0   72 1192   73    G....  K. IR  S.   E     A.R .. .  D.N  G.SEN     A NAR IG..D GGSK.K
    51   59 B P  T 3 5S-     0   0   69 2030   82    R.NAN  SR FV  KD   N     INS RD G  KNL  QDGKD     W KWG ST.SN QKTTTT
    52   60 B Q  T < 5 +     0   0   62 2193   78    GGSAG  PN KL  GG   R     GNG GG Q  GNT  WGYGK     D TDR FGGGG WWGGGG
    53   61 B E  E   < -J   48   0C  77 2221   95    FYMGK  EE YV  KT   L     FVA SV G  AGT  RVSRS     D KDE YFGSF RYFFFF
    54   62 B L  E     +J   47   0C  17 2246   57    HHHVF  WH KH  FH   H     HHH HH H  QHHH HHHAS     L WLF HHHHP HHHHHH
    55   63 B L  E     -     0   0C  17 2261   70    FFLEQ  KY KV  LV   V     FVV IQ V  FHYY TQRLR     L LLW TFTFF TTFFFF
    56   64 B b  E     -J   46   0C   1 2264    1    CCCCC  CC CC  CC   C     CCC CC C  CCCC CCCCC     C CCC CCCCC CCCCCC
    57   65 B G  E     +J   45   0C   2 2264    3    GGGGG  GG GG  GG   G     GGA GG G  GGGG GGGGG     G GGG GGGGG GGGGGG
    58   66 B A  E     -J   44   0C   0 2264   13    GGAGG  GG GG  GG   G     GGG GG A  GGGG GGGGG     G GGG GGGGG GGGGGG
    59   67 B S  E     -JL  43  67C   0 2264   40    SSSSS  SA VT  VS   S     SSS SS S  STSS SSSSS     S TSA TSSTT SSSSSS
    60   68 B L  E     + L   0  66C   0 2264   10    LLLLL  LL LL  LL   L     LLL LI L  LLLL LILLI     I LIL LLLLL LLLLLL
    61   69 B I        -     0   0   23 2264   15    IIVIL  RI IV  IV   I     IIV II I  IVII IIIIL     I III IIILI IIIIII
    62   70 B S  S    S-     0   0   32 2264   62    SNSDS  IA SR  HS   S     SAK SS S  DSDD ESQSN     S SSN SNSNN EASSSS
    63   71 B D  S    S+     0   0   61 2210   68    PDETN  SN NE  PE   S     EPN ND P  PPPP QDNES     D .DE DQSSR QNEEEE
    64   72 B R  S    S+     0   0   80 2263   73    YQEQR  RQ RR  FQ   Q     QRR QR N  EQYY NRNEN     T KTR LYRQE NSDDND
    65   73 B W  E     - M   0 132C  12 2264   12    WWWFW  HW WW  WW   W     WWW WW W  WWWW WWWWN     W rWY WWWWW WWWWWW
    66   74 B V  E     -LM  60 131C   0 2262   11    VILVV  VI VV  VV   V     VVV VI L  VVII VIVVV     V vVV VVVVV VVVVVV
    67   75 B L  E     +LM  59 130C   0 2263   23    VIVIV  LL LL  LL   V     VLL LI V  LVLL LILLL     L LLL IVVLL LLVVVV
    68   76 B T  E     - M   0 129C   0 2263   28    TSTTS  TT TT  TS   T     TTT TS S  TTTT TSSTT     T TTT TTSSS TTTTTT
    69   77 B A    >   -     0   0    0 2262    2    AAAAA  AA AA  AA   A     AAA AA A  AASS AAAAA     A AAA AAAAA AAAAAA
    70   78 B A  G >> S+     0   0    0 2263    6    AAAAA  AS AA  AA   A     AAA AA A  AASS AAAGA     A AAA AAAAA AAAAAA
    71   79 B H  G 34 S+     0   0   10 2264    3    HHHHH  HH HH  HH   H     HHH HH H  HHHH HHHHH     H HHH HHHHH HHHHHH
    72   80 B b  G <4 S+     0   0    0 2264    1    CCCCC  CC CC  CC   C     CCC CC C  CCCC CCCCC     C CCC CCCCC CCCCCC
    73   81 B L  T <4 S+     0   0    1 2264   68    TWVLF  AL TT  TF   F     GIT FF Y  FVFF IFFVV     T LTL IRFLR IIGGGG
    74   82 B L  E  <  +P   81   0D  46 2264   89    VQYAG  IY LK  DP   D     VFK QP I  EDWW SPREW     I YIS GVAVI SSVVVV
    75   83 B Y  E > > -P   80   0D  49 2249   82    SNGTA  HS SD  SR   G     .GD YE D  IHTT SEAGR     N SNH SSDSN SSRRKR
    76   84 B P  G > 5S+     0   0   52 2249   88    PPRNS  RS WA  GE   P     .FA SR d  TVYY SRNAA     r PqP RSFGA SSTTtT
    77   85 B P  G 3 5S+     0   0   75  844   90    RYHTS  SR ..  D.   .     .E. .. p  KKNN ....E     g .gS TRPM. ..T...
    78   86 B W  G < 5S-     0   0  166  852   93    NALDQ  LI ..  G.   .     .E. .. A  DDNN ....Q     T .TG YNNT. ..H...
    79   87 B D  T < 5 +     0   0  152  869   93    HQQPA  YR ..  F.   .     .Y. .. K  KPII ....G     V .VY RHAV. ..Q...
    80   88 B K  E   < +P   75   0D  51  904   83    RIPNG  VN ..  K.   .     .T. .. W  SKSS ....T     Q .QK VRGV. ..V...
    81   89 B N  E     +P   74   0D 110  936   80    VASSS  VN ..  V.   L     .V. .. V  QNTT ....A     L .LY YVDA. ..V...
    82   90 B F        -     0   0   28 1017   94    IVKWW  RL ..  RH   V     .R. .. A  YYQQ ....F     F .FR LIWG. ..A...
    83   91 B T    >>  -     0   0   70 1164   86    LVWTT  IK ..  LL   A     .M. R. F  MNFF ....V     N .NP GLKE. ..G...
    84   92 B E  G >4 S+     0   0   35 1455   85    GGKVV  AE ..  GR   S     RGT S. L  LEEE ..R.G     P .PG KGAH. ..E...
    85   93 B N  G 34 S+     0   0  127 1677   87    EDAIY  Dl .S  KE   K     SSN P. G  RlII ..N.L     N NNQ HEVD. ..F...
    86   94 B D  G <4 S+     0   0   49 1292   82    ..V.L  L. .D  ..   .     STP A. .  ...R R.PS.     . G.. ..VLR RR.SdS
    87   95 B L  E <<  +K   48   0C   0 1493   89    ..L.G  N. .P  .D   .     HLV D. .  ...L T.ES.     A AA. D.GSR TT.DVD
    88   96 B L  E     -KN  47 108C   3 2025   51    ..GLL  L. Fl  .y   y     RLm yy L  L..G yyyf.     L vLl L.NRl yy.VVV
    89   97 B V  E     -KN  46 107C   0 1516   29    .....  .v .a  .v   v     V.a vv .  .i.. vvav.     . v.v ....v vv.V.V
    90   98 B R  E     -KN  45 106C   0 1577   87    .....  .Q .V  .K   H     V.V RL .  .TR. VLVH.     . R.R ....I VG.VVV
    91   99 B I  E     +KN  44 105C   0 1674   49    .....  .I AI  .L   L     I.I LM H  .LL. VMLL.     . L.L ....A VL.AAA
    92  100 B G  S    S+     0   0    7 1756   23    ...G.  .G TG  .G   G     G.G GG D  GGG. GGGG.     . G.G ....G GG.GGG
    93  101 B K        +     0   0   13 1789   76    ..LD.  .I LT  .A   E     E.T AS Q  EEEE RSLA.     . E.E ..H.D RR.EEE
    94  102 B H        +     0   0   36 1883   76    HHHHH  .N RN  YH   Y     H.N YI S  HHHH QIHVH     . L.H .YE.H QH.FFF
    95  103 B S  B     -Q  181   0E  21 1965   75    DHDDS  .N AN  HQ   E     D.N QY K  NKDD SYNEN     . D.H .DL.N SNDDDD
    96  104 B R  S    S+     0   0   16 2018   82    RIQRR  .Q II  RL   L     R.V LN R  FRVV LNIFR     . F.I TRN.L LLQQQQ
    97  105 B T  S    S+     0   0   31 2112   87    QWLRS  KD LH  LD   P     S.K ST S  NSRR STFKR     . A.Y AQA.A SYGGGG
    98  106 B R  S    S-     0   0   85 2151   87    YMNLN  RE GG  RS   K     K.G IP A  EAKK TPMEE     . S.S TSW.T TVSSSS
    99  107 B Y        -     0   0   21 2204   90    NYMVL  DM DR  TY   P     S.S TI P  DSYY VIEPE     . D.D SNFNN VADDDD
   100  108 B E    >>  -     0   0   22 2250   66    NETEN  DK KY  ES   A     NRE TR E  EEEE ERGEE     . K.R ESSDE EEAEEE
   101  109 B R  T 34 S+     0   0  143 2252   78    EGHES  DP LP  VP   S     EPP SK V  GGGG SKSGP     . D.D GEGGG SSEEEE
   102  110 B N  T 34 S+     0   0  133 2255   82    PTPNS  GP NH  NE   T     DQH NN Q  TTFY GNPGT     . D.Q GQSHT GGSNNN
   103  111 B I  T <4 S+     0   0   58 2257   77    IESQT  AT NT  EA   M     ILS EV E  EEEE SVVDQ     . A.A SIGEE SSIIVI
   104  112 B E     <  -     0   0    0 2258   77    QQTEV  HS KK  QE   V     QGK IV H  QQEE LVVGQ     . Q.Q IQEQQ LLQQQQ
   105  113 B K  E     -N   91   0C  69 2257   91    VYVTV  PS TK  TV   S     TMK II R  DRII TIKRR     . P.P AVQSA TAVVVV
   106  114 B I  E     -N   90   0C  11 2259   71    MMVLA  IA II  VR   S     MVI SA L  FFII IAATI     . E.I IKTRI IVLLLL
   107  115 B S  E     -N   89   0C  12 2260   84    SSRDR  QV EK  WT   A     RIK NE K  YSQQ AEKVP     N DND SSRGR ASKKKK
   108  116 B M  E     -N   88   0C  58 2260   71    IVYVN  mD VI  VV   V     VPV VV R  IVGG VVIlF     m fmf PINVA VVIIII
   109  117 B L  E     +O  133   0C   6  452   51    ..I.V  i. ..  ..   .     .V. .. .  .... ...s.     s vsv ..I.. ......
   110  118 B E  E    S+     0   0C  92 1908   74    AENVS  E. EK  NA   S     .RN DK .  EADD SKKTA     S QSE EAKEE SSAAAA
   111  119 B K  E     -O  132   0C  92 2029   65    RAQAR  SK KA  KQ   L     GDA ST .  KRQK KTQEA     N KNS KRRRR KKKKQK
   112  120 B I  E     -O  131   0C  20 2160   45    AIITV  KI II  CV   I     KII VV I  YILL SVIFV     I IIA IAIIV SIVVVV
   113  121 B Y  E     -O  130   0C  66 2224   50    IYIII  LI YI  VM   V     VVI LV I  YIYF VVIIY     I IIV IVIII VVFFFF
   114  122 B I  E     -O  129   0C  52 2228   82    TWIIV  IL VI  KP   V     ICI VY V  IVII IYIRY     I EIQ VTVPA IVKKKK
   115  123 B H    >   -     0   0   25 2247   20    HHNHH  HH HH  HH   H     THH NH H  HHHH HHHHH     H HHH HHHHH HHNNNN
   116  124 B P  T 3  S+     0   0  106 2258   50    PQPSE  PP PP  EP   P     HSP PS P  PPPP ESAES     P PPP PPQPP EKPPPP
   117  125 B R  T 3  S+     0   0  162 2261   76    YSHGR  DE DN  NS   Y     PFD LS S  KQGG KSSEG     D DDR EYQND KDKKKK
   118  126 B Y    <   -     0   0   15 2261   15    YYYYY  YF FF  YY   Y     QYF FY F  YYLL WYYYY     Y YYF WYYYY WWFFFF
   119  127 B N  B > > +R  125   0F  41 2262   68    NDNdN  Vk KI  TR   A     WdN Tl n  dfvv nlDRN     N NNA dNNNN nnnsns
   120  128 B W  T 3 5 +     0   0   62 1485   76    .Y.s.  Yh RL  ..   .     Nr. .v f  k.dd nv.R.     . Y.R y.K.. nnflfl
   121  129 B R  T 3 5S+     0   0  192 1311   77    S.KTT  .. ..  KQ   G     P.V Sa .  .pii QaH.G     . ... .SGDP QQ....
   122  130 B E  T < 5S-     0   0  101 1657   80    QTLNT  S. EE  EE   V     N.E PN .  .TSS LNIEE     D .DH .QVNH LI....
   123  131 B N  T   5S-     0   0    4 2142   69    NTTAS  EN TS  TG   G     TTS Gi T  TAPP AiASS     K tKG NNRTT ASTTTT
   124  132 B L    > < +     0   0   25 1817   69    FLK.H  HY LY  SS   L     ILY .d F  TIGG QdIVS     L lLF IFHLL QKIVVV
   125  133 B D  B 3   +R  119   0F   7 2115   65    NDD.D  HI AV  DP   S     DTD gn D  DNDD GnTSR     N YNY RNDDD GGNNRN
   126  134 B R  T 3  S-     0   0   43 2196   57    NYSNY  DN NN  NG   A     NNN gr Y  NNYY NrNND     N NNN NNYNN NNNNNN
   127  135 B D    <   +     0   0    0 2261    0    DDDDD  DD DD  DD   D     DDD DD D  DDDD DDDDD     D DDD DDDDD DDDDDD
   128  136 B I        +     0   0    0 2264   11    IIIIV  II II  II   I     III II I  MIVV IIIII     V IVI IIIII IIIIII
   129  137 B A  E     -MO  68 114C   0 2263   48    TMAAA  AA AA  AA   A     TAA TA A  AAAA AAAAA     S ASA ATAMM AATTTT
   130  138 B L  E     -MO  67 113C   0 2264    6    LLLLL  IL LL  ML   L     LLL LV L  LLLL LVLVV     L LLL LLLLL LLLLLL
   131  139 B M  E     -MO  66 112C   0 2264   30    LMMLM  LL LF  LV   V     IVF LI L  IIII LILIV     I LIV ILMII LLLLLL
   132  140 B K  E     -MO  65 111C  19 2264   49    RKHKE  KR LH  HR   K     KLH KS E  KKKK KSLKR     Q QQR KKEKK KKKKKK
   133  141 B L  E     - O   0 109C   0 2264    8    LLLLL  LL LL  LL   L     LLL LL L  LLLL LLLLL     L LLL LLLLL LLLLLL
   134  142 B K  S    S+     0   0  111 2264   73    SAQKS  EK KK  VN   E     TAK TT E  DNKK ATHPS     P DPM ASSSS AAAAAA
   135  143 B K  S    S-     0   0  171 2264   76    SHYSG  KE EK  EK   E     AHK SK K  RKRR SKDQR     E REE SSSST SNTTTT
   136  144 B P        -     0   0   73 2264   40    PPKPG  DP PA  PP   P     PSA PP P  PPPP SPFRH     P APS PPAPP SPPPPP
   137  145 B V        -     0   0   11 2220   48    VVVVV  VI VV  VV   V     VVV IL A  AAAA VLVVI     L VLA VVVVA VVAAAA
   138  146 B A        -     0   0   75 2253   81    QTQVS  SK QR  MA   H     TNR AQ E  TRVV PQTPT     T STS QQVTT PSRRQR
   139  147 B F        +     0   0   87 2257   43    MVYYF  FI FY  YF   F     LYY YF Y  LLFF LFYFF     F FFF LMLII LLFFFF
   140  148 B S        -     0   0   40 2259   60    TNTTT  SS NN  NS   S     NSN TT S  NNHH TTSSN     S NST STSSN TTSSSS
   141  149 B D  S    S+     0   0   81 2262   69    SEDND  ER RD  KR   R     AAN ED T  KKKK DDDDD     D VDD ASTSS DDKQEQ
   142  150 B Y  S    S+     0   0   81 2252   87    RYYAY  YF NY  YH   T     HSY YY A  RYRC KYYRR     T YTA SRRWR KKTTTT
   143  151 B I        +     0   0    0 2256   24    VVIIV  IS II  AI   I     VII II V  VVVV IIIIV     I KIV IVVVV IIVVVV
   144  152 B H        -     0   0    4 2256   79    SRQSQ  RL QQ  LR   L     AQQ LQ R  NNYH QQHRQ     R HRR TSKSS QQSSSS
   145  153 B P        -     0   0    9 2256   44    PPPPP  PP PP  PP   P     PPP PP P  TLSS LPPPP     P PPP PPPPP LLAAAA
   146  154 B V        -     0   0    1 2260   37    VVVLV  IV II  II   I     VVI VV I  IAVV GVVVV     I AII AVVAA GAVVVV
   147  155 B a  B     -c  242   0B   3 2260   46    CACCC  CC CC  CC   C     CCC CC C  CCCC CCCAH     Q CQC CCCSC CCCCCC
   148  156 B L        -     0   0   32 2260    9    LLLLL  LL LL  LL   L     LLL VL L  LLLL LLLLL     L LLL LLLLL LLLLLL
   149  157 B P        -     0   0    0 2259   30    APPPP  PP PP  PP   S     PPP PP P  PPPP PPGPP     V PVP PAPPP PPPPPP
   150  158 B D     >  -     0   0   51 2255   78    SKEEA  IQ EF  TA   t     AVF ST D  ERSS PTSTD     g fgE TSEDG APQSTS
   151  159 B R  H  > S+     0   0  148 1806   76    SAKVP  ED P.  RA   d      K. T. T  AQVV A..GR     s dsP SSASQ AAAAVA
   152  160 B E  H  > S+     0   0  122 1873   75    SCNGF  EE G.  DN   P      N. S. S  DGTT G..HG     A GAA GSGMG GGTDDD
   153  161 B T  H  > S+     0   0   10 2003   82    TPQDQ  SD ED  LA   E      FG Q. H  DEAA T.VDD     D QDV ETQVQ TTDDDD
   154  162 B A  H  X S+     0   0    7 2020   84    SVQSR  LE DV  AS   P      EV S. V  EENN I.TDN     S GST ISESH IIDDDD
   155  163 B A  H  < S+     0   0   70 2078   68    IAFFF  RL EF  EF   F      AF FY F  FLLL LYVYR     I SIA LIVAV LLFFFF
   156  164 B S  H  < S+     0   0   36 2215   78    PGLAP  nY TQ  hP   P      EQ Yg P  KSTT PgPNQ     D EDt PPPGS PPPPPP
   157  165 B L  H  < S+     0   0    1  515   98    .....  n. .I  l.   .      .R .r .  .... .rDR.     . N.r ..... ......
   158  166 B L     <  +     0   0   34  711   82    .....  F. .L  T.   .      .L .L .  .... .LSR.     . F.E ..... ......
   159  167 B Q  S >  S-     0   0   87  836   93    ....Y  I. FD  R.   .      .N .A .  .... .ALMF     F IFP ..... ......
   160  168 B A  T 3  S+     0   0   51 2039   74    S.PDP  GI YG  NN   V      TR ED A  PDTT NDTAA     V AVl DSATD NNAAAA
   161  169 B G  T 3  S+     0   0   42 1713   37    G.GGG  .G GN  GG   G      GN GG G  GGGG NG..G     G .Gg QGG.G NNGGGG
   162  170 B Y    <   -     0   0   46 1826   85    TDTTK  YR RT  RL   M      TT MQ K  TKTT YQ..L     S .SV AST.T YYTTTT
   163  171 B K  E     -D  188   0B  33 2112   87    KMSES  NE HK  QR   M      RT QM A  KIKK VMA.T     L .LM PKENR VPLLLL
   164  172 B G  E     -D  187   0B   0 2154   45    CCCCC  PA GC  MC   C      CC CG I  CCCC CGC.G     A .AA CCCVV CCCCCC
   165  173 B R  E     -DE 186 232B   3 2164   80    VTFVF  FM TF  MT   W      WF ST W  TYYY YTFIT     T .TT YVVIT YYVAAA
   166  174 B V  E     -DE 185 231B   0 2189   33    TVIVV  VV VI  VV   V      VI VV V  IAVV VVIAV     I .IA VTVVI VVTTTT
   167  175 B T  E     +D  184   0B   0 2202   48    TSATS  AT AS  TT   T      TS TT T  STTT TTTSA     A IAI TTTTT TTTTTT
   168  176 B G  E     -D  183   0B   1 2202    0    GGGGG  GG GG  GG   G      GG GG G  GGGG GGGGG     G GGG GGGGG GGGGGG
   169  177 B W  S    S+     0   0    1 2202    1    WWWWW  WW WW  WW   W      WW WW W  WWWW WWWWF     F WFW WWFWW WWWWWW
   170  178 B G  S    S-     0   0    0 2198    1    GGGGG  GG GG  GG   G      GG GG G  GGGG GGGGG     G GGG GGGGG GGGGGG
   171  179 B N        -     0   0   33 2021   77    RND T  RW KR  SH   D      QR NN H  A KK RNVKN       Q T RKYNN RRLKKK
   172  180 B L  S    S+     0   0   55 1822   62    TI  L  LM LT  TV   L      LT IV T  L TT LVTTL         L L T T LLTTTT
   173  181 B K  S    S-     0   0  147 1551   78    G   S  RS  K  SA          KQ GE Q  Q AA QEKK              R   QQKKKK
   174  182 B E              0   0   49 1397   62    Q   D   E  E  DP          EE S  E  E EE S ED              E   STH   
   175  183 B T              0   0  181 1202   57    T   G      E   S           E A  G  G GG N                 G   NNT   
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66          P     PP  P    N T       P             NNNPD     T            
   178  186 C Q        -     0   0   64  328   73          S     PP  P    G R       P             PPPER     Q            
   179  187 C P        -     0   0    8  503   39  P      PP     PP  P   GPPPP      P PP          SSSPP P   S            
   180  188 C S  S    S+     0   0   81  526   81  T      KY     FF  F   EDSDS      F KK          RRRRD N   D            
   181  189 C V  B    S-Q   95   0E  21  534   82  V      VH     PP  P   RVRTV      P SS          YYYII Q   V            
   182  190 C L        -     0   0    5  625    5  L      LL  L  LL  LLL LLLLL   L  L II          LLLLL L   L     L      
   183  191 C Q  E     -BD  34 168B   9  629   50  Q      QQ  M  EK  KQR QHQQQ   Q  K LL          RRRQR H   R     M      
   184  192 C V  E     +BD  33 167B   6  628   86  C      CE  P  EE  QQE CEEEE   Q  Q SS          KKKKQ S   E     Q      
   185  193 C V  E     - D   0 166B  15  634   49  VA     LV  S  VV  VAV LAAAV   V  V AA    V     AAALA V   V     A      
   186  194 C N  E     + D   0 165B   7  634   77  NN     NE  K  QQ  KAQ DRRRQ   L  K SS    T     NNNAV Q   D     R      
   187  195 C L  E     - D   0 164B   0  638   34  VV     IV  V  VV  VIV AMVVV   L  V VV    V     VVVVI V   V     V      
   188  196 C P  E     - D   0 163B  12  639   46  SS     TP  P  PP  PPN PPPPP   P  P SS    P     KKKPP K   Q     P      
   189  197 C I  E     -F  210   0B   9  640   33  VI     VI  I  IV  ILL ILLIV   I  I II    I     VVVII V   Y     I      
   190  198 C V  E     -F  209   0B  10  641   39  VI     LV  L  VV  VLI LILHI   Q  M VV    V     LLLIV L   M     M      
   191  199 C E    >>  -     0   0   75  641   66  SE     NG  S  EE  EPD SPPTE   E  E DD    S     SSSDS P   T     E      
   192  200 C R  H 3> S+     0   0   86  640   78  EH     HH  L  NN  NKF DRRNN   L  N HH    N     MMMTN R   N     W      
   193  201 C P  H 3> S+     0   0   77  641   74  EK     EK  N  RQ  GRK AKSRS   W  H DD    E     AAAPK L   T     N      
   194  202 C V  H <4 S+     0   0   41  641   84  VE     RV  K  LL  IFK DITDV   Y  I QQ    E     AAAKE K   E     K      
   195  203 C c  H >< S+     0   0    5  645    1  CC     CC  C  CC  CCC CCCCC   C  C CC    C     CCCCC C   C     C      
   196  204 C K  H >< S+     0   0   91  645   74  SE     QN  R  DD  DEN RNTKQ   Q  D LR    K     RRRNN Q   D     N      
   197  205 C D  T 3< S+     0   0  141  645   80  KK     EK  N  LL  AED NYRNE   Y  A RR    R     NNNLE Q   T     S      
   198  206 C S  T <  S+     0   0   15  645   87  LA     AH  A  KK  QRF SKQAM   L  K SS    A     TTTLP L   S     A      
   199  207 C T    <   -     0   0   25  645   71  YY     YY  Y  YY  YYL YKNYF   R  Y YY    S     TTTYI Y   N     Q      
   200  208 C R  S    S+     0   0  249  645   89  DP     pq  G  hh  hKv Psvgh   R  h gg    i     IIIsa Q   G     y      
   201  209 C I  S    S-     0   0   56  565   53  PG     .g  a  gg  gGd Ggg.g   .  g ..    t     ggggg g   G     g      
   202  210 C R        -     0   0  123  556   82  .N     qp  s  hh  qRy MKkrk   N  r kk    .     hhhkE n   Y     A      
   203  211 C I        -     0   0   12  633   24  LI     II  V  II  IFL IILVI   F  I II    .     IIITI I   I     I      
   204  212 C T    >   -     0   0   12  638   73  YT     DK  L  VV  VTT TETKL   P  I TT    Y     LLLIT T   E     T      
   205  213 C D  T 3  S+     0   0   82  642   69  HD     KD  S  RR  RGP DKPAP   D  R KK    D     DDDKK D   D     D      
   206  214 C N  T 3  S+     0   0   11  645   72  pT     TD  S  dd  eRR ATQKS   n  d DD    s     SSSnR S   N     K      
   207  215 C M  E <   - G   0 263B   9  637   30  mM     MM  V  mm  mMM MMMMF   t  m MM    t     MMMmM M   M     M      
   208  216 C F  E     - G   0 262B  19  643   34  FL     FL  I  LL  LLM FLLVV   L  L II    F     IIILL F   M     I      
   209  217 C c  E     -FG 190 261B   0  643    1  CC     CC  C  CC  CCC CCCCC   C  C CC    C     CCCCC C   C     C      
   210  218 C A  E     +FG 189 260B   0  643   10  AA     AA  A  AA  AAA AAAAA   A  A AA    A     AAAAA A   A     A      
   211  219 C G        -     0   0    4  643   18  GS     GG  G  GG  GGG GGGGG   G  G AA    G     yyyGG S   W     G      
   212  220 C Y        -     0   0   31  452   71  .V     DS  W  ..  .ND FHY.Y   G  . ..    F     yyyFY .   S     Y      
   213  221 C K     >  -     0   0   67  484   87  .R     EK  T  ..  .LL LLLAA   E  . ..    R     EEEEK .   Q     D      
   214  222 C P  T >4 S+     0   0   63  534   70  .K     SG  E  NN  .QR EERQN   G  . AA    R     TTTEY V   S     Q      
   215  223 C D  T 34 S+     0   0  132  572   39  GE     GR  G  EE  .EG GGGPG   G  . PP    K     DDDGG A   A     G      
   216  224 C E  T 34 S-     0   0   83  609   46  GG     RD  K  GG  GQG GGGPK   K  . GG    P     AAAKG G   D     G      
   217  225 C G    <<  +     0   0   49  117   85  Q.     ..  .  ..  ... ...E.   .  N ..    .     ..... .   .     .      
   218  226 C K        -     0   0  124  137   84  D.     ..  .  ..  RK. ...E.   .  S ..    .     ..... .   .     .      
   219  227 C R        +     0   0   81  180   80  Q.     ..  .  ..  KR. ...R.   .  R ..    .     ..... Y   .     .      
   220  228 C G        +     0   0    3  583   68  KK     ..  K  HH  RVR KIIAR   .  R KK    L     ...KP K   .     K      
   221  229 C D  B     -A   30   0A  12  624   16  DD     D.  D  DD  DDD DDDDD   D  D DD    A     ...DD D   .     D      
   222  230 C A        +     0   0    9  640   48  SS     SS  S  SS  SSS SASTS   T  T AA    P     ...AA A   A     A      
   223  231 C d    >>  -     0   0   13  644    1  CC     CC  C  CC  CCC CCCCC   C  C CC    C     CCCCC C   C     C      
   224  232 C E  T 34 S+     0   0   95  644   57  NQ     QQ  E  QQ  QQQ QQDKE   T  Q SS    F     QQQKT N   Q     Q      
   225  233 C G  T 34 S+     0   0   20  645    8  GG     GY  G  GG  GGG GGGGG   G  G GG    G     GGGGG A   G     A      
   226  234 C D  T X4  +     0   0    0  645    0  DD     DD  D  DD  DDD DDDDD   D  D DD    D     DDDDD D   D     s      
   227  235 C S  T 3< S+     0   0   16  645    6  SS     SS  S  SS  SSS SSSSS   S  S SS    V     SSSSS S   S     s      
   228  236 C G  T 3  S+     0   0    0  645    1  GG     GG  G  GG  GGG GGGGG   G  G GG    G     GGGGG G   G     G      
   229  237 C G    <   -     0   0    0  645    4  GG     GG  G  GG  GGG GGGGG   G  R GG    S     GGGGG G   G     G      
   230  238 C P  E     - H   0 246B   0  645    7  PP     PP  P  PP  PPP PPPPP   P  P PP    P     PPPPP P   P     P      
   231  239 C F  E     -EH 166 245B   0  644   24  LL     VQ  L  LL  LLL VLLML   L  L LL    M     LLLLL A   L     L      
   232  240 C V  E     -EH 165 243B   2  643   42  IV     VV  V  VV  VMV VSVVV   V  V VV    V     VVVVS V   I     V      
   233  241 C M  E     - H   0 242B   0  643   64  CC     CC  W  CC  CCC CCCCL   L  C SS    I     FFFCC D   L     C      
   234  242 C K  E     - H   0 241B  11  644   80  NN     NS  Q  KK  KVE GLEQQ   S  K GG    Q     EEELL M   K     K      
   235  243 C S     >  -     0   0    1  642   84  GG     GW  E  VV  VRQ GGNSR   D  V DD    S     PPPVr D   G     Y      
   236  244 C P  T  4 S+     0   0   47  109   82  ..     ..  .  ..  ... .....   N  . ..    P     ....s .   S     .      
   237  245 C F  T  4 S+     0   0  145  304   83  ..     ..  .  ..  .SN .PSGP   W  . ..    R     RRRGR G   T     S      
   238  246 C N  T  4 S-     0   0   63  501   60  ..     TN  N  EN  RGN .DNeD   D  N ..    T     PPPQk Q   T     .      
   239  247 C N     <  +     0   0   85  373   58  ..     .C  Q  DG  GE. .DSgG   S  G ..    G     GGG.q .   G     G      
   240  248 C R        -     0   0   59  432   80  ..     .A  R  TT  TSR .HVPR   K  T ..    R     KKKSE .   E     K      
   241  249 C W  E     - H   0 234B   1  442   42  ..     .W  W  WW  WWW .WWYY   K  W ..    W     VVVWW .   D     W      
   242  250 C Y  E     -cH 147 233B  19  521   85  YS     .V  Y  LL  LVY EYKKE   F  L KK    V     EEELF .   V     T      
   243  251 C Q  E     + H   0 232B   0  638   57  LL     LQ  L  QQ  QVL LVVLL   V  Q LL    I     QQQQL L   Q     L      
   244  252 C M  E     +     0   0B   0  642   82  QQ     QV  I  AA  AYA QVVWV   V  A VV    V     IIIAA A   V     D      
   245  253 C G  E     -IH 264 231B   0  645    0  GG     GG  G  GG  GGG GGGGG   G  G GG    G     GGGGG G   G     G      
   246  254 C I  E     -IH 263 230B   0  645   23  LI     LV  L  VV  VVV VVVIT   I  V II    L     VVVVL I   V     I      
   247  255 C V  E     +I  262   0B   5  643   28  VI     VV  V  VV  VTT VTTTV   I  V VV    F     VVVIV V   V     V      
   248  256 C S  E     -     0   0B   6  644    5  SS     SS  S  SS  SSS SSSSS   S  S SS    G     SSSSS S   S     S      
   249  257 C W  E     +I  261   0B  35  642   16  FW     WW  W  WW  WWW WWWWH   V  W FF    W     WWWWW W   W     W      
   250  258 C G        -     0   0   36  645    5  Gg     gG  G  GG  GGG GGGgG   G  D GG    S     GGGGG g   G     G      
   251  259 C E  S    S-     0   0   61  627   89  Kd     yY  Y  EE  EYT YHYnI   P  E KK    E     IIIE. a   L     R      
   252  260 C G  S    S-     0   0   21  637   41  aP     PK  G  GG  GGG GGGiR   s  G EE    G     GGGGs n   G     D      
   253  261 C d  S    S-     0   0   12  642    1  cC     CC  C  CC  CCC CCCcC   c  C CC    C     CCCCc c   C     C      
   254  262 C D  S    S+     0   0   28  643   37  GA     AG  A  AA  GGG AAADA   G  A AA    A     AAAAG A   A     A      
   255  263 C R    >   -     0   0  128  645   82  QV     QL  R  QL  QAQ EIQPA   T  Q HH    Q     RRRRS H   M     L      
   256  264 C D  T 3  S+     0   0   93  645   73  VT     PH  P  PP  PKR PAPnP   N  P SS    P     PPPQP E   A     A      
   257  265 C G  T 3  S+     0   0   29  629   69  GR     DN  N  NN  NDN DNNwY   D  Y KK    R     GGGN. D   T     Y      
   258  266 C K    <   -     0   0   90  639   88  VK     KF  Y  RR  RSK HKARL   T  R FF    K     MMMRF S   F     K      
   259  267 C Y        -     0   0   14  641   48  PP     PP  P  PP  PPP PPPPP   Q  P PP    Y     PPPPk P   P     P      
   260  268 C G  E     -G  210   0B   3  618   10  GG     GG  A  GG  GGG GGGGG   G  G GG    A     GGGGg G   G     G      
   261  269 C F  E     -GI 209 249B   3  639   18  VV     VV  I  II  IVV VVVVV   L  I VV    Y     VVVVV V   V     I      
   262  270 C Y  E     -GI 208 247B   2  644    4  YY     YY  Y  YY  YYY YYYYY   Y  Y YY    Y     YYYYY Y   Y     Y      
   263  271 C T  E     -GI 207 246B   2  644   35  TT     TT  T  TT  TTT ATATM   T  T AA    T     TTTIT T   S     T      
   264  272 C H  E  >  - I   0 245B  31  644   59  NK     NQ  R  RR  RKK KKVRR   N  R NN    R     LLLRR S   R     R      
   265  273 C V  T >4 S+     0   0    0  643   15  LV     LA  T  VV  VVV VVVVT   V  I VV    V     VVVVV V   I     V      
   266  274 C F  G >4 S+     0   0   39  642   74  CC     CM  D  TT  TST CSTET   H  T AA    S     SSSTS A   S     T      
   267  275 C R  G 34 S+     0   0  132  642   86  KK     MS  Y  YY  YAE KSRRF   Y  Y EE    K     YYYAC H   A     Q      
   268  276 C L  G  S+     0   0   57  641   79  TF     TV  Y  LL  LVL VLLLK   V  L KK    R     LLLHR H   F     V      
   270  278 C K  H  > S+     0   0  164  641   65  EN     KP  D  DD  DPP TDGRP   P  D PP    R     DDDNE D   D     S      
   271  279 C W  H  > S+     0   0   37  641    0  WW     WW  W  WW  WWW WWFWW   W  W WW    W     WWWWW W   W     W      
   272  280 C I  H  X S+     0   0    1  641   10  II     II  I  II  III IIIIL   I  I II    I     IIIII I   I     I      
   273  281 C Q  H >X S+     0   0   79  605   76  EH     RR  D  YH  HKY RDNQR   S  H ML    H     RRRHK V   Q     N      
   274  282 C K  H >X S+     0   0  135  595   73  KE     DQ     RR  QSS NEERS   Q  R GG    S     AAARD H   S     N      
   275  283 C V  H 3< S+     0   0   15  570   82  TV     TY     YY  YVK TMKKV      Y AA    I     HHHI  N   T     K      
   276  284 C I  H << S+     0   0   49  556   45  VM     IV     VV  VTM MIML       V II    V     TTTI  M   V     M      
   277  285 C D  H <<        0   0  114  506   74  Q       P     PP  PKE RH R       P EE    K     TTTP            A      
   278  286 C Q     <        0   0  142  322   66                KK  K R NH S       E RR    R     DDDK            S      
## ALIGNMENTS  841 -  910
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  I IIMII V   IIIVI IIIIIVVIIIIIIIIIMIIIIIIMIVIIIIIMMIIIIIIIIIMV IMIVIIV
    30   38 B V  B     +A  221   0A  13 2209   20  V VTVVV V   VVVVV VVVVTVVVVVVVVIVIVVVIVVVVVVVVVVVVVVIVVIVVVIVV TVIVVTV
    31   39 B E  S    S+     0   0  131 2214   31  N NGGGN G   GGGGG GGGNGGGGGGGGGGGGGGGGNGGGGGNGGGGGGGGNNGNGGGGG GGGNGGN
    32   40 B G        -     0   0   30 2221    1  G GGGGG G   GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGG
    33   41 B S  E     -B  184   0B  74 2221   88  E ESQQQ E   FTVNQ QQQESSVTFFMQYTSTQRELERRQQEEQLGQQQFTEELEYYTQE NQTEFSE
    34   42 B D  E     -B  183   0B  99 2227   62  N NGDDT D   EDEDD NDDNGDDDQQNDTEAEDNTPNDDDDENDDAVDDAEDDRDEEEDN SDEETNE
    35   43 B A        -     0   0    5 2227   45  A AAAAA A   TATAS AASAAVVACCSACAAAAACAAAAASAAAAAAAAAAAASACCAAA AAAACAA
    36   44 B E    >   -     0   0   41 2228   84  V VALLV R   KPALS TPSVARRPTTKTEQGQQLQLVKKQETVQEQKQQAQVVPVQQQLR TLQEANE
    37   45 B I  T 3  S+     0   0   90 2237   79  L PPEES P   PAPPL VELPAPPAAAKLEARAEPENSPPEPPPELRPEESAPPDPPPAEP PEAPESP
    38   46 B G  T 3  S+     0   0   11 2241   60  G GGGGG Y   HGNGG VGGGGNNGHHGGNGGGGGARGGGGGNGGGGGGGGGGGRGNNGGY GGGYNGY
    39   47 B M  S <  S+     0   0    7 2243   67  S SQEQS S   SSEER NRRSQSSSSSERSAEAEASKSQQEESSRRQQEEETSSKSSSAES QEASSQS
    40   48 B S  S >  S+     0   0   11 2247   63  W WWWWW W   HWFYW WWWWWWWWQQWWLWWWWWVWWWWWFWWWWWWWWVWWWWWQQWWW WWWWVWW
    41   49 B P  T 3  S+     0   0    5 2251    4  P PPPPP P   PPPCP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPP
    42   50 B W  T 3  S+     0   0    2 2253   18  W WWWWW W   WWWWW WWWWWWWWWWWWYWWWWWYWWWWWWWWWWWWWWWWWWWWWWWWW WWWSYWW
    43   51 B Q  E <   -J   59   0C   2 2256   32  Q QQQQQ Q   QQQQQ QQQQQQQQQQQQQVQIQQQQQQQQQQQQQQQQQQVQQQQQQVQQ QQVQQQQ
    44   52 B V  E     -JK  58  91C   0 2257   34  V VVVVV A   VVVVV AVVVVAIVVVIVVVVVVVVVVVVVLVVVGVVVVVVVVVVAAVVA VVVVVVY
    45   53 B M  E     -JK  57  90C   0 2256   51  S SSSSS S   FSFAS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSLSSQ
    46   54 B L  E     -JK  56  89C   0 2257   14  L LIILL L   IILLL LLLLILLIIILLLLLLILLLLLLILLLLLLLIILLLLLLLLLIL IILLLIV
    47   55 B F  E     -JK  54  88C   0 2256   82  Q qTQWQ Q   kHVIR QRRQTQQHNNNRNqwQQQNQQRRQRQQRrrRQQKQQQQQNNqQQ LQqQNIS
    48   56 B R  E   > -JK  53  87C  76 1547   74  . rYRI. y   fYl.Y ..Y.YyyYLLYY.yriRy...FFRRy..wrFRR.v......yRy FRyy.Y.
    49   57 B K  T > 5S+     0   0   41  951   80  D ....D s   t.aN. .T.D.gg......D.g.l..Q....nDT......gDD.D..G.s ..Gs...
    50   58 B S  T 3 5S+     0   0   72 1192   73  S ...TG G   N.NS. TE.K.SS......H.K.S.TQ....GSS.....EHKKTK..R.S ..RG..G
    51   59 B P  T 3 5S-     0   0   69 2030   82  S SDNER K   KNHLD SKDSDSNN..KDSTRGNGAENSSNNKST..RNNGVTTSTSSVNS DNVGSSG
    52   60 B Q  T < 5 +     0   0   62 2193   78  G GGGDG W   MNQNG GEGGGFWNGGNGGLRPGYGDGGGGGWGGDGGGGALGGNGGGLGW GGLWGGW
    53   61 B E  E   < -J   48   0C  77 2221   95  F FTSGF Y   FRLQT SGTFVYYRYYEASAETSSYKFYYSLYFHSQNSSRSFFRFYYVSH TSVSYVS
    54   62 B L  E     +J   47   0C  17 2246   57  H HHHHH H   SHFYH HHHHHHHHHHFHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHFHHF
    55   63 B L  E     -     0   0C  17 2261   70  F FVFIF T   TISLL FILFVTTIYYILFIRIFRFLFSSFITFIVVQFFFVFFIFFFVFT VFVTFVT
    56   64 B b  E     -J   46   0C   1 2264    1  C CCCCC C   CCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCC
    57   65 B G  E     +J   45   0C   2 2264    3  G GGGGG G   GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGG
    58   66 B A  E     -J   44   0C   0 2264   13  G GGGGG G   GGGGG GGGGGGGGGGGGGGAGGGGAGGGGGGGGAGGGGAGGGGGGGGGG GGGGGGG
    59   67 B S  E     -JL  43  67C   0 2264   40  S SSSSS T   STSAS SSSSSTSTSSSSSTVSSSSSSSSSSSSSSSSSSTTSSSSSSTST SSTSSSS
    60   68 B L  E     + L   0  66C   0 2264   10  L LLLLL L   ILLLL LLLLLLLLLLLLLLLLLLLLLIILLLLLLLLLLVLLLLLLLLLL LLLLLLL
    61   69 B I        -     0   0   23 2264   15  I IVIII I   IIIIL IILIVIIIIIIIIVVVIIIIIIIIIIIILIIIIVVIIIIVVVII VIVIIVI
    62   70 B S  S    S-     0   0   32 2264   62  S SSTHN A   qHSGS NHSSSDDHNNTSNRAKAQNDNHHADTSHSSDAAGRSSASSSRTA STRDNSD
    63   71 B D  S    S+     0   0   61 2210   68  Q QDEEQ T   sSDTG REGQEKKSDDDSKEEDENERQPPESKQPHRPEEDEEEREEEEET EDEPDEP
    64   72 B R  S    S+     0   0   80 2263   73  S SQRVY N   NQRQD EVDSQQQQQQSEQRRRRNQRNRRRQNSSRQRRRRRDDRDYYRRN QRRDQQD
    65   73 B W  E     - M   0 132C  12 2264   12  W WWWWW W   LWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWW
    66   74 B V  E     -LM  60 131C   0 2262   11  V VVVVV V   VVIVV VVVVVVVVIIVVVVLVVVVVVVVVAVVVAVVVVLVVVVVVVVVV VVVVVVV
    67   75 B L  E     +LM  59 130C   0 2263   23  V VLLLV L   LMLLL VLLVLLLMVVMLVLLLLLVLVLLLVLVLLLLLLLLVVLVVVLLL LLLLVLL
    68   76 B T  E     - M   0 129C   0 2263   28  T TSTTT T   TTTTT TTTTSTTTSSATSTSTTSSTTTTTSTTTTTTTTSTTTTTSSTTT STTTSST
    69   77 B A    >   -     0   0    0 2262    2  A AAAAA A   AAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAA
    70   78 B A  G >> S+     0   0    0 2263    6  A AAAAA A   AAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAGAAG
    71   79 B H  G 34 S+     0   0   10 2264    3  H HHHHH H   HHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHH
    72   80 B b  G <4 S+     0   0    0 2264    1  C CCCCC C   CCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCC
    73   81 B L  T <4 S+     0   0    1 2264   68  N SFFFR I   LILVF FFFNFIIIWWFFYTFTFFYVNFFFFINFFVFFFFTGGIGYYTFI FFTIYFI
    74   82 B L  E  <  +P   81   0D  46 2264   89  V VPSRV S   HIETP SCPVPSSIQQDPKKDKPRMFVHHPASVTEPFSSNKVVSVKKKSS PSKSKPS
    75   83 B Y  E > > -P   80   0D  49 2249   82  S SRNRS S   DNNNE SREIRSSNNNSEPDVQNASSSSSNQSSIESYNNHDRRSISSDNS RNDSYSS
    76   84 B P  G > 5S+     0   0   52 2249   88  P PETSP T   HTVIR IPRPERSTPPLRRAYSTNRDPSSTPSPfeSSTTTATTHTRRATT ETASRES
    77   85 B P  G 3 5S+     0   0   75  844   90  . G.SL. .   ..... .....T....K...G......KK....ssL.............. .......
    78   86 B W  G < 5S-     0   0  166  852   93  . R.QN. .   ..... .....Y....V...D......NN....QGN.............. .......
    79   87 B D  T < 5 +     0   0  152  869   93  . H.TP. .   ..... .....R....S...P......PP....FWP.............. .......
    80   88 B K  E   < +P   75   0D  51  904   83  . V.SS. .   G.... .....V....Y...K......AA....PTR.............. .......
    81   89 B N  E     +P   74   0D 110  936   80  . V.LF. .   S.... .....L....Y...Q......FF....VID.............. .......
    82   90 B F        -     0   0   28 1017   94  . VHYY. .   W.... ....HL....T...W......YY....PQL.............. .....H.
    83   91 B T    >>  -     0   0   70 1164   86  . LLQH. .   T..V. .L..LG....V...A......GG.F..VFQ.............. H....L.
    84   92 B E  G >4 S+     0   0   35 1455   85  G GKVV. R   A..R. .N.GKK....Y...ARSR...IISS.GPGI.SSK.......SS. HSS..A.
    85   93 B N  G 34 S+     0   0  127 1677   87  R EELKr k   PN.sN PSNREH.N..L..SFDEN...EEEA.RSQQQEEVS......DQ. KED..Q.
    86   94 B D  G <4 S+     0   0   49 1292   82  . Y...h r   AIVdR A.RH..RIYY.N.D.PTP..NAATSR.S..DTTENSS.S..PTR DTPR..R
    87   95 B L  E <<  +K   48   0C   0 1493   89  H DD..R V   KNIAV RSVVDNTNSS.R.P.LSE..HGGSETHY..VSSQPDN.D..LSK DSLK.DK
    88   96 B L  E     -KN  47 108C   3 2025   51  F RyLVV L   lvvil lflVyLyvll.iilLmlyilVVVlfyFLLLmllvlVVlVvlmly ylmyiyy
    89   97 B V  E     -KN  46 107C   0 1516   29  V .i... .   vlvvv vvv.v.vlaa.wva.avavvV..vvvVL..hvvaaVVvVvvavv vvavvvv
    90   98 B R  E     -KN  45 106C   0 1577   87  V .K..I .   VYTRF SKFVK.FYII.RRV.VLVRKV..LNVVR..ILLHVVMKVRRVLL KLVVRKV
    91   99 B I  E     +KN  44 105C   0 1674   49  L .L..L L   ALLVA LVALL.LLLL.VLI.ILLLLL..LLLLMT.QLLLIAALALLILL LLILLLL
    92  100 B G  S    S+     0   0    7 1756   23  G .GGGG G   GGGGG GGGGG.GGGGGFGG.GGGGGG..GGGGGSGAGGGGGGGGGGGGG GGGGGGG
    93  101 B K        +     0   0   13 1789   76  E .AAGE K   ARADA LGAEA.KRDDAAET.TALEDE..AAQEEMEGAATTEEDEEETAK AATEEVE
    94  102 B H        +     0   0   36 1883   76  Y .HRLH Y   HQHHV QLVYH.HQNNYGHN.NRHHTH..RYHHLPQERRTNFFTFHHNRY HRNHHYH
    95  103 B S  B     -Q  181   0E  21 1965   75  D .QQTD N   STNDA STADQ.STHHQANNGNQNNND..QQNDKSILQQSNDDNDNNNQN QQNDNQD
    96  104 B R  S    S+     0   0   16 2018   82  R .LLLR L   VQVLR LLRRLPLQIILVIITILIILR..LLLLLFLKLLLIQQVQIIILL LLIRILR
    97  105 B T  S    S+     0   0   31 2112   87  S SDVSQ E   KSDTT QSTSDLSSWWSSKHPNVFENSLLVSYSYWYLVVLHGGHGVVHVA DVHTEDT
    98  106 B R  S    S-     0   0   85 2151   87  S SSRLS A   NTDSS GLSSSSQTMMAQVGFRQMVASRRQVTSTSTYQQGGSSHSIIGRA SKGVVSV
    99  107 B Y        -     0   0   21 2204   90  N NYPLS E   LSDRP PTPNYSESNNLLLHLSPETGSLLPPANSLKTPPLHDDRDNNRPE YPRTEYT
   100  108 B E    >>  -     0   0   22 2250   66  A ASGES E   EVKYH NEHATEEVEEDSEHSHGGESAYYGSEAPQPEGGGHEESEEEYGE TGHEESE
   101  109 B R  T 34 S+     0   0  143 2252   78  E EPPPE Q   RAEGA PPAEPSNAGGNPGPGPPSGEETTPGSEHARHPPGPEEKEGGPPQ PPPGGAG
   102  110 B N  T 34 S+     0   0  133 2255   82  P PEHHP G   TNISV NHVPEGGNTTSRNYAHHPNNPAAHIGPNYYPHHSHNNTNTTHHG AHHPGAP
   103  111 B I  T <4 S+     0   0   58 2257   77  L LAASI S   QPHPQ GSQLASSPEETGETETAVETIRRALSLSYSSAAPTIIAIEETAS AATEETE
   104  112 B E     <  -     0   0    0 2258   77  Q QEMTQ V   QNQGL VTLQEQVNQQVKQKGKVVQLQEEVMLQFTIKMMAKQQLQQQKMV ETKQQEQ
   105  113 B K  E     -N   91   0C  69 2257   91  V VVFLV T   KEEAG SLGVVAAEFFSLFKQKYKFVVIIYNAVYRLLYYKKVVVVFFKFA VYKVFVV
   106  114 B I  E     -N   90   0C  11 2259   71  L LRAVK A   SVNQV RVVLRIIVMMRLIILIAAIIRIIAVVLAYIIAAVILLVLIIIAA RSIIIRI
   107  115 B S  E     -N   89   0C  12 2260   84  S STQAS S   RKYTQ MAQSTSGKSSGGHKEKRKDPTPPRDSSTFPPRRGNKKPKTTKQS TRKSNAS
   108  116 B M  E     -N   88   0C  58 2260   71  V IVVVI T   VvRlA VVAIVPAvVVVVAIRVVISVIVVVSVIVVVVVVLIIIVISSIVP VVIVSVV
   109  117 B L  E     +O  133   0C   6  452   51  . ..... .   .lSv. .......l......V............................. .......
   110  118 B E  E    S+     0   0C  92 1908   74  S SAKRS E   .QRA. SR.SAAGQDDKKAKAKRKEKSKKR.SSKSRKRRRKAARAEEKKE EKKAAEA
   111  119 B K  E     -O  132   0C  92 2029   65  R KERNR K   NSDT. KN.KQRKSAAKGKARARQKDKRRR.KQRNHRRRRTKKDKKKARK KRAAKKA
   112  120 B I  E     -O  131   0C  20 2160   45  A AVVIA I   AIYTV VIVAVIIIIIIIIIIIVIVIIIIVITAIIIIVVVIVVIVVVIVI VVITVVT
   113  121 B Y  E     -O  130   0C  66 2224   50  I IIEFI I   YIYYI IFIIIIIIYYIIIIYIEIIIILLEHVIFYVIEEMIFFVFIIIEI IEIYIIF
   114  122 B I  E     -O  129   0C  52 2228   82  T TPSVT V   IVIIY KVYTSVVVWWKYRVKISIRFTIISIVTILLFSSLIKKIKRRISV PSIVRSV
   115  123 B H    >   -     0   0   25 2247   20  H HHNHH H   PHHHH NYHYHHHHHHNHHHHHNHHPYHHNHHHHSHQNNHHNNHNNNHNH HNHHHHH
   116  124 B P  T 3  S+     0   0  106 2258   50  P PTPPP E   GPPHG PPGPTEEPQQPSPPPPPAPSPPPPPQPPPPDPPPPPPRPPPPPE PPPPPPP
   117  125 B R  T 3  S+     0   0  162 2261   76  S SSLTY K   DSDNG ITGSSNASSSNGKNFFLSGNGKKLTDSSRHNLLLNSSYKNNNLK SLNQKSQ
   118  126 B Y    <   -     0   0   15 2261   15  W WYYYY W   YFWHY YYYWYWWFYYFYYFYFYYYFWYYYFWWFYYYYYYFFFFFYYFYW YYFWYYW
   119  127 B N  B > > +R  125   0F  41 2262   68  N NNqLN n   snDNl NLlNQdnnDDLlNInDqDsDNttqknNQLDlqqNIssMSddIqn RqINnRN
   120  128 B W  T 3 5 +     0   0   62 1485   76  . ..mW. f   yl..r .Wr..yflYYYl.LyLm.wF.kkmiq.W..hmm.Lff.FwwLmy HmL.w..
   121  129 B R  T 3 5S+     0   0  192 1311   77  S PQAAT S   ..SSp SEpPQ.....EpN...AH..S..AGVP.GGTAAP...S....AS EA.S.ES
   122  130 B E  T < 5S-     0   0  101 1657   80  T TESDQ V   ..NQT IDTTE...QQGDEE.ESI.ANAASNSSRNDVSSGE..SL..ESV GSES.ES
   123  131 B N  T   5S-     0   0    4 2142   69  T TGSAN A   T.TTi TAiTGNT.TTSsTSTTSATSTHHSSKTSSaNSSTSTTgTDTSSA SSSCTGC
   124  132 B L    > < +     0   0   25 1817   69  M L..SF S   FLLLe NSeLSIILLM.eLYLY.ILLMWW...MY.h...LYVViVLIY.S ..YLLSL
   125  133 B D  B 3   +R  119   0F   7 2115   65  N Ns.SN G   VNHDn DSnNQRRNDDSnDVDV.TDTNGG..GNKPGG..DVRRERDDV.G Q.VSDQS
   126  134 B R  T 3  S-     0   0   43 2196   57  N NgAGN Y   NNGNn NGnNGNNNYYGnNNYNANNNNAAAGYNGYKGAAFNNNNNSSNAY GANNNGN
   127  135 B D    <   +     0   0    0 2261    0  D DDDDD D   DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDD
   128  136 B I        +     0   0    0 2264   11  V LIVII I   IIIII IIILIIIIIIIIIIVIVIIILIIVIIVVIMIVVLIIIIIIIIVI IVIIIII
   129  137 B A  E     -MO  68 114C   0 2263   48  T TAAAT A   ASGAA CAATAAASMMAAMAAAAAMATAAAAATAAAAAAAATTATMMAAA AAAALAA
   130  138 B L  E     -MO  67 113C   0 2264    6  L LLLLL L   LLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLL LLLLLLL
   131  139 B M  E     -MO  66 112C   0 2264   30  L LLVVL I   LMILV LLVLLIIMMMMVVFLFVLIALVVVILLLVLVVVLFLLALIIFVI LVFLIVL
   132  140 B K  E     -MO  65 111C  19 2264   49  K KREQR K   KKRKH KRHKQKKKKKEHKHEHELKLKEEEKKKQKKEEEEHKKLKKKHEK REHKKRK
   133  141 B L  E     - O   0 109C   0 2264    8  L LLLLL L   LLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLL LLLLLLL
   134  142 B K  S    S+     0   0  111 2264   73  A ASEDS T   ESPQS SDSASSESAAEASKAKEHKASGGEAAADSTDEEAKAAHASSKET SEKSSSS
   135  143 B K  S    S-     0   0  171 2264   76  S SRATS E   KQEGS STSSSTTQHHTSTKGKEDTYSIIESNSSARHAASKTTFTKKKAE SAKHSIH
   136  144 B P        -     0   0   73 2264   40  P PPPPP H   PPSQS PPSPPPAPPPPPPAPAPFPSPPPPPPPPPPPPPPAPPPPPPAPH PPASPPS
   137  145 B V        -     0   0   11 2220   48  A AVV.V V   FVIAL V.LAVVVVVVVVAVVVVVVVVLLVVVA.VVVVVLVAAVAAAVVV IVVAAVA
   138  146 B A        -     0   0   75 2253   81  Q QTTLQ E   VNEEP TLPRTTTNTTTTIRRKSTINQLLSTSQ.TPKTTARVVNRTTRTA TTRETNE
   139  147 B F        +     0   0   87 2257   43  Y YFFRM L   FFFLL FQLYFFIFVVFLIYRYFYLYFFFFFLY.YFLFFFYFFYFLLYFL FFYLIYL
   140  148 B S        -     0   0   40 2259   60  T TSTPT S   NSSKT TPTTSTGSNNTSNNSNTSNSTSSTTTT.TSSTTNNSSSSNNNTS STNTSST
   141  149 B D  S    S+     0   0   81 2262   69  T NRNSS D   KQDPE KSEQRDDQQQPEADRDNDDSNDDNDDTVNNHNNKDQQTQKKDND RNDPSRP
   142  150 B Y  S    S+     0   0   81 2252   87  R RYYQR K   FYYGY FQYRYKTYYYYYRYLYYYHHRSSYLKRQHFQYYYYTTHTYYYYK YYYERNE
   143  151 B I        +     0   0    0 2256   24  I IIIFV I   VIVVI IFIIIIIIVVIIVIVIIIVIIFFIIIIIIIIIIIIVVIVVVIII IIIVVIV
   144  152 B H        -     0   0    4 2256   79  S SRLTS K   HRRCQ VSQSRSTRKKLQSQRQLHLQSKKLMQSTQQRLLQQSSQSQQQLE RLQQAQQ
   145  153 B P        -     0   0    9 2256   44  P PPPPP L   PPPIP PPPPPPPPPPPPTPPPPPPPPNNPPLPPPPTPPPPAAPAPPPPL PPPPTPT
   146  154 B V        -     0   0    1 2260   37  V VIVVV A   IIIIV VVVVIAAIVVVVIIIIVVIVVVVVVAVVIIIVVVIVVVVVVIVA IVIIIVA
   147  155 B a  B     -c  242   0B   3 2260   46  C CCCCC C   CCCCC CCCCCCCCAACCSCCCCCSCCDDCCCCCCTQCCCCCCCCAACCC CCCCSCC
   148  156 B L        -     0   0   32 2260    9  L LLVLL L   LLLLL LLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLVL LMLPLLL
   149  157 B P        -     0   0    0 2259   30  A APPPA P   PADPP APPAPPPAPPPPPPPPPGPPNQQPPPAPQAPPPPPPPPPPPPPP PPPPPPP
   150  158 B D     >  -     0   0   51 2255   78  S SADAS P   KASSA AQASADEAKKSASFEFDSKKTAADTPSEAPADDLFSSESNNFDA ADFPSAP
   151  159 B R  H  > S+     0   0  148 1806   76  S PAPAS A   INP.A PAAPASANA.Q.A.PGP.D.NPPPPASP.P.PPA.AA.AG..PA AP.RSAR
   152  160 B E  H  > S+     0   0  122 1873   75  N DNSQS E   DNARG GQGDNGGNC.E.L.VVS.C.SKKSEGNQ.G.SSI.DD.DC..SE NS.DCND
   153  161 B T  H  > S+     0   0   10 2003   82  E EAVTT S   ESEGQ SAQEASYSP.V.ADPFVVAENDDVVTEISTSVVQDDDQDA.DVS AIDYAAY
   154  162 B A  H  X S+     0   0    7 2020   84  A ASVPN I   SISSA TPAESIVIAAQ.AVRQITPLLKKIVIAQTQGIIKVDDADA.VVI SIVIPSI
   155  163 B A  H  < S+     0   0   70 2078   68  L LFFLI L   LFLVL FLLLFLLFACLLAFPNFVAFPVVFFLLFFVLFFFFFFFFD.FFL FFFLAFL
   156  164 B S  H  < S+     0   0   36 2215   78  T PPETP S   PYNPV FTVPPPPYGPAgGQPLEPGEQQQEPPTPEPQEEPQPPMPGGQES PEQPGPP
   157  165 B L  H  < S+     0   0    1  515   98  . ..... .   ..... ...........q.I.D.D................I.....CI.. ..I....
   158  166 B L     <  +     0   0   34  711   82  . ..... .   ..D.. ...........I.L.W.S.V........F.L...L..V..AL.. ..L....
   159  167 B Q  S >  S-     0   0   87  836   93  . ..... .   ..YE. .........A.I.D.N.L.E........QQR...D..Q..AD.. ..D....
   160  168 B A  T 3  S+     0   0   51 2039   74  E ANTPS S   INVTD SPDANHHN.AADTGDTTTTT.PPTNNETNKVTTVGTTAATDGTS NSGHTNH
   161  169 B G  T 3  S+     0   0   42 1713   37  G GGGGG N   GGGGG GGGGGNNG.GGG.NG.G..GGGGGGNGGR.GGGGNGGDG.GNGN GGNG.GG
   162  170 B Y    <   -     0   0   46 1826   85  L LLMTT T   YTERK VTKLLSATDDTK.TA.M..TLTTMIYLTTTTMMRTTTTT.TTMT LMTT.LT
   163  171 B K  E     -D  188   0B  33 2112   87  T KQNVR A   KSTRV SVVKQPPSMMMIEKRRNAEETKKNNPTLDLPNNKKVVKLMMKNA QEKKQHK
   164  172 B G  E     -D  187   0B   0 2154   45  C CCCCC C   CCVCC ACCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCC
   165  173 B R  E     -DE 186 232B   3 2164   80  V ATWWV Y   MWVTT WWTATYYWMMWTLFVFWFLWVWWWTYVWWWWWWMFVVWARRFWY TWFYLTY
   166  174 B V  E     -DE 185 231B   0 2189   33  T TVVVT V   VALVV VVVTVVVAVVVVIIIIVIIVTVVVVVTVVVVVVIITTVTVVIVV VAIVIVV
   167  175 B T  E     +D  184   0B   0 2202   48  T TTTTT T   ATTTT TTTTTTTTSSTSSSTSTTSTTTTTTTTTTTTTTSSTTTTSSSTT TTSITTT
   168  176 B G  E     -D  183   0B   1 2202    0  G GGGGG G   GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGG
   169  177 B W  S    S+     0   0    1 2202    1  W WWWWW W   WWWYW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWW
   170  178 B G  S    S-     0   0    0 2198    1  G GGGGG G   GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGG
   171  179 B N        -     0   0   33 2021   77  R RHSAK R   SN YN AANRHRRNNNDNNRSRSVNRRRRSTNRKNDNSSNRKKKKNNRSR HSRRNHR
   172  180 B L  S    S+     0   0   55 1822   62  L LVPTT L   LI MT ITTLVLLIIITL TVTST VTTTSILLTIIVPPTTTTVTTTTPL VPTL VL
   173  181 B K  S    S-     0   0  147 1551   78  S  ASQG Q   RG GQ  HQSA  G  QQ KRESK SSRRSRQSKKRGSSQKKKNKMMKSQ ASKS A 
   174  182 B E              0   0   49 1397   62  G  PEEQ T   EK E   E GP  K  E  EEEEE EGEEE TGKEKEEEEE  E SSEET PEE  P 
   175  183 B T              0   0  181 1202   57     SE T N   SD T      S  D  G  EGE     GG  N GDNS  GE  T SSEEN S E  S 
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66   N       S                                                    N       
   178  186 C Q        -     0   0   64  328   73   D     P T       P                                            T       
   179  187 C P        -     0   0    8  503   39   S     P AP      P                                            P       
   180  188 C S  S    S+     0   0   81  526   81   S     Y HE      Y                                            D       
   181  189 C V  B    S-Q   95   0E  21  534   82   E     N KE      N                                            K       
   182  190 C L        -     0   0    5  625    5   L     L LLL     L                                            L       
   183  191 C Q  E     -BD  34 168B   9  629   50   L     Q QNQ     Q                                            Q       
   184  192 C V  E     +BD  33 167B   6  628   86   G     E ACE     E                                            Q       
   185  193 C V  E     - D   0 166B  15  634   49   A     A VVV     A                                            A       
   186  194 C N  E     + D   0 165B   7  634   77   W     K GTG     K                                            A       
   187  195 C L  E     - D   0 164B   0  638   34   I     V LVV     V                                            L       
   188  196 C P  E     - D   0 163B  12  639   46   P     S WDN     S                                            P       
   189  197 C I  E     -F  210   0B   9  640   33   L     V ILL     V                                            L       
   190  198 C V  E     -F  209   0B  10  641   39   I     V FVY     V                                            L       
   191  199 C E    >>  -     0   0   75  641   66   D     D DDN     D                                            S       
   192  200 C R  H 3> S+     0   0   86  640   78   S     V RSW     V                                            N       
   193  201 C P  H 3> S+     0   0   77  641   74   S     K DDE     K                                            A       
   194  202 C V  H <4 S+     0   0   41  641   84   V     T YYY     T                                            S       
   195  203 C c  H >< S+     0   0    5  645    1   C     C CCC     C                                            C       
   196  204 C K  H >< S+     0   0   91  645   74   Q     S ENT     S                                            K       
   197  205 C D  T 3< S+     0   0  141  645   80   S     Q DST     Q                                            K       
   198  206 C S  T <  S+     0   0   15  645   87   N     A TPK     A                                            F       
   199  207 C T    <   -     0   0   25  645   71   Y     Y NSS     Y                                            W       
   200  208 C R  S    S+     0   0  249  645   89   a     n nsv     n                                            g       
   201  209 C I  S    S-     0   0   56  565   53   g     g ggg     g                                            .       
   202  210 C R        -     0   0  123  556   82   r     l DWv     l                                            k       
   203  211 C I        -     0   0   12  633   24   I     I LVI     I                                            I       
   204  212 C T    >   -     0   0   12  638   73   T     Q DYN     Q                                            T       
   205  213 C D  T 3  S+     0   0   82  642   69   D     P DEK     P                                            D       
   206  214 C N  T 3  S+     0   0   11  645   72   R     D SGe     D                                            L       
   207  215 C M  E <   - G   0 263B   9  637   30   M     M MMe     M                                            M       
   208  216 C F  E     - G   0 262B  19  643   34   L     L FFL     L                                            V       
   209  217 C c  E     -FG 190 261B   0  643    1   C     C CCC     C                                            C       
   210  218 C A  E     +FG 189 260B   0  643   10   A     A AAA     A                                            A       
   211  219 C G        -     0   0    4  643   18   G     R gGg     R                                            G       
   212  220 C Y        -     0   0   31  452   71   S     . fIe     .                                            .       
   213  221 C K     >  -     0   0   67  484   87   A     . NMD     .                                            .       
   214  222 C P  T >4 S+     0   0   63  534   70   K     . GPG     .                                            A       
   215  223 C D  T 34 S+     0   0  132  572   39   G     G DED     G                                            S       
   216  224 C E  T 34 S-     0   0   83  609   46   D     P gGg     P                                            G       
   217  225 C G    <<  +     0   0   49  117   85   .     . d.d     .                                            .       
   218  226 C K        -     0   0  124  137   84   .     . G.G     .                                            .       
   219  227 C R        +     0   0   81  180   80   .     . GGG     .                                            .       
   220  228 C G        +     0   0    3  583   68   .     G KKK     G                                            V       
   221  229 C D  B     -A   30   0A  12  624   16   G     D DDD     D                                            S       
   222  230 C A        +     0   0    9  640   48   F     A AAA     A                                            S       
   223  231 C d    >>  -     0   0   13  644    1   C     C CCC     C                                            C       
   224  232 C E  T 34 S+     0   0   95  644   57   H     Q QQQ     Q                                            M       
   225  233 C G  T 34 S+     0   0   20  645    8   G     D GGG     D                                            G       
   226  234 C D  T X4  +     0   0    0  645    0   D     D DDD     D                                            D       
   227  235 C S  T 3< S+     0   0   16  645    6   Y     S SSS     S                                            S       
   228  236 C G  T 3  S+     0   0    0  645    1   G     G GGG     G                                            G       
   229  237 C G    <   -     0   0    0  645    4   G     G GGG     G                                            G       
   230  238 C P  E     - H   0 246B   0  645    7   P     P PPP     P                                            P       
   231  239 C F  E     -EH 166 245B   0  644   24   L     L LVL     L                                            L       
   232  240 C V  E     -EH 165 243B   2  643   42   V     V VRV     V                                            V       
   233  241 C M  E     - H   0 242B   0  643   64   D     C CMC     C                                            C       
   234  242 C K  E     - H   0 241B  11  644   80   K     Q EGN     Q                                            Q       
   235  243 C S     >  -     0   0    1  642   84   N     V NDD     V                                            K       
   236  244 C P  T  4 S+     0   0   47  109   82   .     . ...     .                                            .       
   237  245 C F  T  4 S+     0   0  145  304   83   .     A ...     A                                            .       
   238  246 C N  T  4 S-     0   0   63  501   60   .     . E.G     .                                            D       
   239  247 C N     <  +     0   0   85  373   58   .     G G.G     G                                            G       
   240  248 C R        -     0   0   59  432   80   .     T Q.K     T                                            A       
   241  249 C W  E     - H   0 234B   1  442   42   R     W V.A     W                                            W       
   242  250 C Y  E     -cH 147 233B  19  521   85   K     Q VDT     Q                                            T       
   243  251 C Q  E     + H   0 232B   0  638   57   L     Q LVL     Q                                            L       
   244  252 C M  E     +     0   0B   0  642   82   I     A YIY     A                                            V       
   245  253 C G  E     -IH 264 231B   0  645    0   G     G GGG     G                                            G       
   246  254 C I  E     -IH 263 230B   0  645   23   I     V VIV     V                                            I       
   247  255 C V  E     +I  262   0B   5  643   28   V     V VTV     V                                            V       
   248  256 C S  E     -     0   0B   6  644    5   S     S SSS     S                                            S       
   249  257 C W  E     +I  261   0B  35  642   16   W     W WWW     W                                            W       
   250  258 C G        -     0   0   36  645    5   G     G GGG     G                                            G       
   251  259 C E  S    S-     0   0   61  627   89   T     E YLQ     E                                            S       
   252  260 C G  S    S-     0   0   21  637   41   H     G GGG     G                                            g       
   253  261 C d  S    S-     0   0   12  642    1   C     C CCC     C                                            c       
   254  262 C D  S    S+     0   0   28  643   37   G     G AAA     G                                            S       
   255  263 C R    >   -     0   0  128  645   82   Q     R AQR     R                                            T       
   256  264 C D  T 3  S+     0   0   93  645   73   S     P KSK     P                                            S       
   257  265 C G  T 3  S+     0   0   29  629   69   D     D NYG     D                                            S       
   258  266 C K    <   -     0   0   90  639   88   K     R NLS     R                                            P       
   259  267 C Y        -     0   0   14  641   48   P     P PPP     P                                            G       
   260  268 C G  E     -G  210   0B   3  618   10   G     G GGG     G                                            .       
   261  269 C F  E     -GI 209 249B   3  639   18   V     V VVV     V                                            V       
   262  270 C Y  E     -GI 208 247B   2  644    4   Y     Y WYY     Y                                            Y       
   263  271 C T  E     -GI 207 246B   2  644   35   T     A GTV     A                                            A       
   264  272 C H  E  >  - I   0 245B  31  644   59   K     R TDD     R                                            R       
   265  273 C V  T >4 S+     0   0    0  643   15   V     V VVV     V                                            V       
   266  274 C F  G >4 S+     0   0   39  642   74   N     T SGW     T                                            T       
   267  275 C R  G 34 S+     0   0  132  642   86   H     A YFG     A                                            E       
   268  276 C L  G  S+     0   0   57  641   79         V ISR     V                                            M       
   270  278 C K  H  > S+     0   0  164  641   65         N DDD     N                                            P       
   271  279 C W  H  > S+     0   0   37  641    0         W WWW     W                                            W       
   272  280 C I  H  X S+     0   0    1  641   10         I III     I                                            V       
   273  281 C Q  H >X S+     0   0   79  605   76         H MGR     H                                            R       
   274  282 C K  H >X S+     0   0  135  595   73         H DNK     H                                            Q       
   275  283 C V  H 3< S+     0   0   15  570   82         H TIT     H                                            I       
   276  284 C I  H << S+     0   0   49  556   45         I MII     I                                            L       
   277  285 C D  H <<        0   0  114  506   74         P NED     P                                            A       
   278  286 C Q     <        0   0  142  322   66         E  NE     E                                            D       
## ALIGNMENTS  911 -  980
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  MIII IIIIVVVVIIIIIIVIIIIMIIMI II  IIIIMII  IIIIMI IIIIIIMIII VII IIVVI
    30   38 B V  B     +A  221   0A  13 2209   20  VTVV VVYVVVVVVVVVTVVVVVIVVVVV VV  VIVIVVV  TVVVVV VVVVVVLVIT VTV VVVVV
    31   39 B E  S    S+     0   0  131 2214   31  GGSG GGGGGGGGGGGNGNGNGGGGGNGN NN  NGGGGGN  GGNNGG GGGGGNGGGG GGN GGNNG
    32   40 B G        -     0   0   30 2221    1  GGGG GGGGGGGGGGGGGGGGGGGGGGGG GG  GGGGGGG  GGGGGG GGGGGGGGGG GGW GGGGG
    33   41 B S  E     -B  184   0B  74 2221   88  QSEQ YVTSDDDEENEESEEEEQTEQEQV EE  ELQTQLE  NREEQT QQQQQEEYTS QSE EEEEV
    34   42 B D  E     -B  183   0B  99 2227   62  DSDA EDTDDDDDDDDDNNEDDDENDENN DN  NRDEDDN  DEDDDD AANNDNVEES DSD DDEED
    35   43 B A        -     0   0    5 2227   45  AAAA CAAAVVVVAAAAAAAAAAAASAAA AA  ASAAAAA  SAAAAS AAAAAAGCAA AAA AAAAA
    36   44 B E    >   -     0   0   41 2228   84  LKQE RYVGRRRRPIEVVVRVEVQQSVQV VA  VPAQQEV  TQIIMS AALLPVKRQD AVV PPRRR
    37   45 B I  T 3  S+     0   0   90 2237   79  APPR KYPAEEEPAPLPASPPLEVELPDS PS  PDAAELP  PTPPEP AAPPASKKAA AAP AAPPQ
    38   46 B G  T 3  S+     0   0   11 2241   60  GGGG NGGGNNNNGGGGGGNGGGGRGGGG GG  GRGGGGG  GGGGGG GGGGGGGNGG GGG GGHHG
    39   47 B M  S <  S+     0   0    7 2243   67  EQQA SKSSSSSSSERSQSSSRHAERSES SS  SKRAERS  QVSSEE AASSFSESAQ RQS AASSS
    40   48 B S  S >  S+     0   0   11 2247   63  WWWW VWWWWWWWWIWWWWWWWWWWWWWW WW  WWWWWWW  WWWWWW WWWWWWSVWW WWW WWWWW
    41   49 B P  T 3  S+     0   0    5 2251    4  PPPP PPPPPPPPPPPPPPPPPPPPPPPP PP  PPPPPPP  PPPPPP PPPPPPPPPP PPP PPPPP
    42   50 B W  T 3  S+     0   0    2 2253   18  WWWW YWWWWWWWWWWWWWWWWWWWWWWW WW  WWWWWWW  WWWWWW WWWWWWWYWW WWW WWWWW
    43   51 B Q  E <   -J   59   0C   2 2256   32  QQQM QQQQQQQQQQQQQQQQQQIQQQQQ QQ  QQQVQQQ  QLQQQQ QQQQQQQQVQ QQQ QQQQQ
    44   52 B V  E     -JK  58  91C   0 2257   34  VVVV VVAVVVVIVVGVVVVVGVVVVVVV VV  VVVVVGV  VVVVVV VVVVVVVVVV VVV AAIIV
    45   53 B M  E     -JK  57  90C   0 2256   51  SSSS SSGSSSSSSASSSSSSSSSSSSSS SS  SSSSSSS  SSSSSS RRSSSSVSSS SSS SSSSS
    46   54 B L  E     -JK  56  89C   0 2257   14  IIVL LIILLLLLLLLLILLLLLLILLIL LL  LLLLILL  ILLLIL LMLLLLVLLI LIL LLLLL
    47   55 B F  E     -JK  54  88C   0 2256   82  QTRq NryQQQQQQmrQTQQQrRQQRQQQ Qq  QQHqQrQ  IQQQQh HLqqQQlNqT HTQ HHQQQ
    48   56 B R  E   > -JK  53  87C  76 1547   74  RY.f .yhMyyyy..w.Y.y.wFiRY.R. .r  ..LyRw.  Yi..Rr ilyy...VyH FY. IIyyY
    49   57 B K  T > 5S+     0   0   41  951   80  ...n .g..ggge.s.D.DnD..g..D.D D.  D..D..D  .nDD.. vv...D..G. ..D ..dd.
    50   58 B S  T 3 5S+     0   0   72 1192   73  ..ES .S.ESSSGKD.K.SGK..S..T.Q K.  ST.H..S  .HKK.. SI...G..R. ..K ..GG.
    51   59 B P  T 3 5S-     0   0   69 2030   82  NENR GGRRSSSEDt.TESQT.GINDTNS TN  SSDTN.S  NNTTN. GG..TR..VE DET NNVVD
    52   60 B Q  T < 5 +     0   0   62 2193   78  GGGR GNYYYYYWGeDGGGWGDQLGGGGG GG  GNHLGDG  NLGGG. GG..SGgGLG HGG GGWWG
    53   61 B E  E   < -J   48   0C  77 2221   95  SIEY YYQGYYYRRGSFVFYFSTASTFSF FF  FRNASSF  DFFFSL AT..SFNYVV NVF GGRRV
    54   62 B L  E     +J   47   0C  17 2246   57  HHHH HHHHHHHHHVHHHHHHHHHHHHHH HH  HHFHHHH  HHHHHH AAHHHHFHHH FHH HHHHH
    55   63 B L  E     -     0   0C  17 2261   70  FVVA FTFVTTTTIFVFVFTFVIIFLFFF FF  FIIIFVF  VVFFFL LLFFFFHFVV IVF SSTTQ
    56   64 B b  E     -J   46   0C   1 2264    1  CCCC CCCCCCCCCCCCCCCCCCCCCCCC CC  CCCCCCC  CCCCCC CCCCCCCCCC CCC CCCCC
    57   65 B G  E     +J   45   0C   2 2264    3  GGGG GGGGGGGGGGGGGGGGGGGGGGGG GG  GGGGGGG  GGGGGG GGGGGGGGGG GGG GGGGG
    58   66 B A  E     -J   44   0C   0 2264   13  GGGG GGGAGGGGGGAGGGGGAGGGGGGG GG  GGGGGAG  GGGGGG GGGGGGGGGG GGG GGGGG
    59   67 B S  E     -JL  43  67C   0 2264   40  SSSS STATTTTTSSSSSSSSSSSSSSSS SS  SSSTSSS  SSSSSS SSSSSSVSTS SSS TTSSS
    60   68 B L  E     + L   0  66C   0 2264   10  LLLL LLLLLLLLLLLLLLLLLLLLLILL LL  LLLLLLL  LLLLLI LLLLLLLLLL LLL LLLLI
    61   69 B I        -     0   0   23 2264   15  IVIL IIIVIIIIIILIVIIILIVILIII II  IIVVILI  VVIIVI IIIIIIIIVV VVI IIIII
    62   70 B S  S    S-     0   0   32 2264   62  SSAN SNNASSSSNSSSSSASSAKTSSTT SS  SASRASS  SRSSTS NNNNNSNSRS SSS NNAAS
    63   71 B D  S    S+     0   0   61 2210   68  EDES SKDNNNNNKEHEEQNEHEEAGEDQ PT  QRDEEHQ  EDEEEN SSNNNQRSEE EEE NNAAN
    64   72 B R  S    S+     0   0   80 2263   73  QQDH TDRRQQQQELRDQSSDRKRRDDQN DN  SRRRRRS  ERDDRQ QQQQQYNTSQ RQD QQNNR
    65   73 B W  E     - M   0 132C  12 2264   12  WWWW WYYWWWWWWWWWWWWWWWWWWWWW WW  WWWWWWW  WWWWWW WWWWWWWWWW WWW WWWWW
    66   74 B V  E     -LM  60 131C   0 2262   11  VVVV VVILVVVVVVAVVVVVAIVVVVVV VV  VVIVVAV  VVVVVV IIVVVVVVVV IVV IIVVI
    67   75 B L  E     +LM  59 130C   0 2263   23  LVLL VLVILLLLMILVLVLVLLILLVLI VV  VLLLLLV  LLVVLL LLLLLVLVLL LLV LLMMV
    68   76 B T  E     - M   0 129C   0 2263   28  TSTT STTSTTTTSTTTSTTTTTTTTTTT TT  TTTTTTT  STTTTT SSTTTTTSTS TST TTTTS
    69   77 B A    >   -     0   0    0 2262    2  AAAA AAAAAAAAAAAAAAAAAAAAAAAA AA  AAAAAAA  AAAAAA AAAAAAAAAA AAA AAAAA
    70   78 B A  G >> S+     0   0    0 2263    6  AAAA ANAAAAAAAAAAAAAAAAAAAAAA AA  AAAAAAA  AAAAAA AAAAAAAAAA AAA AAAAA
    71   79 B H  G 34 S+     0   0   10 2264    3  HHHH HHHHHHHHHHHHHHHHHHHHHHHH HH  HHHHHHH  HHHHHH HHHHHHHHHH HHH HHHHH
    72   80 B b  G <4 S+     0   0    0 2264    1  CCCC CCCCCCCCCCCCCCCCCCCCCCCC CC  CCCCCCC  CCCCCC CCCCCCCCCC CCC CCCCC
    73   81 B L  T <4 S+     0   0    1 2264   68  FFFF YFVFIIIIFLFGFNIGFLIFFGFN GQ  NIITFFN  FTGGFV FFFFFRLYTF IFG FFIIF
    74   82 B L  E  <  +P   81   0D  46 2264   89  PPSD KDWQGGGSSVEVPVSVEPKSPVSV VV  VSQKPEV  PKVVPT SSPPPVEQKP QPV QQNKP
    75   83 B Y  E > > -P   80   0D  49 2249   82  DRQN SPSDSSSLSPIRSSSRIADNEKNS TS  SSPDNES  SQKKNS SRSSSSNSDS PSR RRSYK
    76   84 B P  G > 5S+     0   0   52 2249   88  TEdK RLRSNNNTVtyTEPSTyTSTRKTP TP  PHTATeP  ETTTTL TYRRRpNRAE TET TTKER
    77   85 B P  G 3 5S+     0   0   75  844   90  S.sK .I.DRRRQS.s.....sW...T.. SG  .....s.  .....E SISSS..... ... .S...
    78   86 B W  G < 5S-     0   0  166  852   93  D.AK .G.ADDDGT.G.....GT...D.. DS  .....G.  .....N TNAAQ..... ... .T...
    79   87 B D  T < 5 +     0   0  152  869   93  T.YV .K.IYYYGS.W.....WI...L.. VH  .....W.  .....P AVSSL..... ... .S...
    80   88 B K  E   < +P   75   0D  51  904   83  S.KY .P.KRRRSG.M.....MF...V.. VS  .....T.  .....N GCGGC..... ... .N..Y
    81   89 B N  E     +P   74   0D 110  936   80  L.VD .D.YVVVLW.V.....VT...I.. VV  .....I.  .....I VLVVV..... ... .V..S
    82   90 B F        -     0   0   28 1017   94  YHLW .P.SYYYSQ.Q.....QY...A.. AV  .....Q.  .....W VFNNI..... ... .I..F
    83   91 B T    >>  -     0   0   70 1164   86  WYLR .TLDLLLNV.F.H...FT...G.. GL  .....F.  .....R VSAAF....H .H. .V..L
    84   92 B E  G >4 S+     0   0   35 1455   85  VKGL .ESAGGGNS.G.HG..GVRS.ESG EG  G...SGG  H...SI YTVVA....H .H. SY.GN
    85   93 B N  G 34 S+     0   0  127 1677   87  LETv .YTRKKKKLeQ.KR..QWNENFER FE  R.WSEQR  nR..EY LsLLR...SK WK. tL.SR
    86   94 B D  G <4 S+     0   0   49 1292   82  ...g .E..HHHE...SE.RS..PMR.T. .Y  ..TDT..  kDSSTA .s..Cs..DE SES n..S.
    87   95 B L  E <<  +K   48   0C   0 1493   89  .QIA .ITANNNY.D.DAHTD..FSV.FH .D  H.TPS.H  DPDDSG .G..MH..PE TAD V..K.
    88   96 B L  E     -KN  47 108C   3 2025   51  LyFq iVvwLLLR.fLVyFyVLLmll.lL .L  FlfllLF  ylVVlI .v..CYlily fyV I.ffw
    89   97 B V  E     -KN  46 107C   0 1516   29  .v.i v.va...V.v.VvVvV..avv.vV ..  Vvvav.V  vaVVv. .v...Vvvav vvV V.vvv
    90   98 B R  E     -KN  45 106C   0 1577   87  .K.E R.HY...A.R.VKVGV..VLF.LV ..  VKWVL.V  RVVVL. .Y...IRRVK WKV Y.FFL
    91   99 B I  E     +KN  44 105C   0 1674   49  .L.Y LVLL...L.VTALLLAT.ILA.LL ..  LLLILTL  LVAAL. .L...LLLIL LLA L.VVL
    92  100 B G  S    S+     0   0    7 1756   23  GG.G GGGG...GGGSGGGGGS.GGG.GG ..  GGGGGSG  GGGGG. .G...GGGGG GGG G.GGG
    93  101 B K        +     0   0   13 1789   76  AA.R ENSM...KREMEAEREM.TAA.AE ..  EDSTAME  ATEEA. .E...EDETA SAE R.KKS
    94  102 B H        +     0   0   36 1883   76  RH.N HHHR...HQHPFHYHFP.NRV.RY ..  HTINRPH  HNFFRL .TGG.HYHNH IHF RGHHI
    95  103 B S  B     -Q  181   0E  21 1965   75  QQSK NRAL...SNDSDEDNDSGNQADQD D.  DNKNQSD  QNDDQR GQLLTDENNQ KQD FRNNS
    96  104 B R  S    S+     0   0   16 2018   82  LLYP IERMNNNLLVFQLRLQFSILRQLR Q.  LVVILFL  LLQQLQ ERQQYRLIIL VLQ QRLLN
    97  105 B T  S    S+     0   0   31 2112   87  VDPV ADLTTTTVQSWGDSYGWIYVTGVS G.  SHGHVWS  NHGGVS TKSSVQLAHD GDG QFVVK
    98  106 B R  S    S-     0   0   85 2151   87  RSER VTATNNNQGQSSSSVSSHMKSSNS SS  SHDGQSS  SKSSRE EGLLAYRVGS DSS QQEEP
    99  107 B Y        -     0   0   21 2204   90  PYSE NITGNNNTAALDYNADLANPPDPN DS  NRSHPLN  YSDDPI IPQQFNKNRY SYD PQDDV
   100  108 B E    >>  -     0   0   22 2250   66  GNSP EDDNEEEENEQESAEEQDYGHEGA EN  ASSHGQA  THEEGN NNGGQTEEHS RSE NQEEN
   101  109 B R  T 34 S+     0   0  143 2252   78  PNEL GQDNAAAEPGAEEESEADPPAEPE EA  EKKPPAE  ESEEPE NSSSDEGGPE KEE EPAAA
   102  110 B N  T 34 S+     0   0  133 2255   82  HDPQ THTGGGGSNSYNDPGNYSYHVNHP DE  PTSYHYP  DYDDHD SVNNHQTTHD SDN NNAAN
   103  111 B I  T <4 S+     0   0   58 2257   77  ATGE EQEASSSDEEYIALSIYSTAQIAI VP  LAVTAYL  NTIIAT PSPPLIEETA VAI EESSV
   104  112 B E     <  -     0   0    0 2258   77  QVER QEAALLLVVQTQKQLQTQKVLQIQ QV  QLKKVTQ  EKQQMP NRNNNQVQKK KKQ VNKKA
   105  113 B K  E     -N   91   0C  69 2257   91  YVLY FSVTAAAFSDRVFVAVRGKYGVYV VQ  VVYKYRV  VKVVYF STRRVVMFKV YVV SEAAE
   106  114 B I  E     -N   90   0C  11 2259   71  ARRV IFYRIIIMIHYLSLVLYLIAVLAR LV  LVYIAYL  RILLAF VVVVSKLIIS YSL RVVVV
   107  115 B S  E     -N   89   0C  12 2260   84  RTTQ SYKPSSSGNEFKTSSKFQKWQKRS KR  SPVKRFS  TKKKRK SSSSQNKDKT VTK SSLLK
   108  116 B M  E     -N   88   0C  58 2260   71  VVVK SVVIPPPTVVVILIVIVyIVAIVI IS  IVSIVVI  VVIIVV kRrrTIVSIL SLI VrPPT
   109  117 B L  E     +O  133   0C   6  452   51  .... .................v...... .I  .......  ...... v.iiV..... ... .v...
   110  118 B E  E    S+     0   0C  92 1908   74  RAS. AADRAAAAAASAKSSASSKK.GKS AS  SR.KRSS  AKAAKE S.KKTAAVKK .KA SSEE.
   111  119 B K  E     -O  132   0C  92 2029   65  RHQ. KEERKKKNSENKDRKKNKAR.QRK KK  QDKARNQ  EAKKRE Q.TTTRKKAD KDK EEKK.
   112  120 B I  E     -O  131   0C  20 2160   45  VIFI VIVIIIIIIKIVIAIVIIIVVVVI VA  AIIIVIA  IIVVVI IIVVVAAIII IIV IIIII
   113  121 B Y  E     -O  130   0C  66 2224   50  EIIV IICLVVVVIHYFIIVFYIIEIFEI FI  IVVIEYI  IIFFEI IIIIIIFIII VIF IIVVV
   114  122 B I  E     -O  129   0C  52 2228   82  SSKI RTILVVVVLMLKPTVKLIVSYRST KT  TIIVSLT  TLKKSV VVVVVTKRIP IPK NNVVY
   115  123 B H    >   -     0   0   25 2247   20  NHHH HHHHHHHHHHSNHHHNSHHNHNNY NH  HHHHNSH  YHNNNH HHHHHHHHHH HHN HHHHH
   116  124 B P  T 3  S+     0   0  106 2258   50  PSPE PSPPEEEEPHPPPPKPPPPPGPPP PP  PRPPPPP  PPPPPS EPPPPPPPPP PPP PPEES
   117  125 B R  T 3  S+     0   0  162 2261   76  LSSK NDHQNNNKQLHKSSDKHNDLGKQG KS  SYKNLRS  TDKKLQ NNNNNYNSNS KSK NNKKS
   118  126 B Y    <   -     0   0   15 2261   15  YYYY YYYYWWWWYYYFYWWFYFFYYFYW FW  WFHFYYW  YFFFYY YYYYYYYYFY YYF YYWWY
   119  127 B N  B > > +R  125   0F  41 2262   68  qRSn srnddddnNdLsLNnsLkDqlnqN nN  NMQIqLN  QIssqk NdNNNNNsIL QLs NNnnl
   120  128 B W  T 3 5 +     0   0   62 1485   76  m..v ylsfffffM..l..nl.rLmrfm. f.  ...Lm..  ..ffmr .l....RwL. ..l ..ffv
   121  129 B R  T 3 5S+     0   0  192 1311   77  AEAT ..K.....GaG.QSQ.G..Ap.AP .P  PSD.AGP  AV..A. K.SSSA...Q DQ. SS..a
   122  130 B E  T < 5S-     0   0  101 1657   80  SEDE ..PT....GkN.ETI.N.EST.SN .T  TSTESNT  EK..S. Q.GGENE.EE TE. QQVVN
   123  131 B N  T   5S-     0   0    4 2142   69  SGEG STNSRRRFRaSTGTSTSTSSiTST TT  TgTSSST  GTTTS. TTTTTNTNSG TGT TTAAi
   124  132 B L    > < +     0   0   25 1817   69  .SH. LM..IIIIFY.VSMEV..Y.eI.I VL  Mi.Y..M  SYVV.I QQQQSFVLYS .SV QQFFd
   125  133 B D  B 3   +R  119   0F   7 2115   65  .Qs. DDMDRRRRNDPRQNGRP.V.nT.N RN  NE.V.PN  EVRR.G DDNNDNDDVQ .QR DDGGn
   126  134 B R  T 3  S-     0   0   43 2196   57  AGgN NNRYNNNNNNYNGNNNYANAnNAN NN  NNANAYN  GNNNAY NNNNNNNNNG AGN NNNNr
   127  135 B D    <   +     0   0    0 2261    0  DDDD DDDDDDDDDDDDDDDDDDDDDDDD DD  DDDDDDD  DDDDDD DDDDDDDDDD DDD DDDDD
   128  136 B I        +     0   0    0 2264   11  LIII IIIIIIIIIIIIIVIIIIIVIIVL IL  VIVIVIV  IIIIVI VIIIIIIIII VII IIIII
   129  137 B A  E     -MO  68 114C   0 2263   48  AAAA MTAAAAAASAATAMATAAAAATAT TT  TAAAAAT  AATTAA SSAAATAMAA AAT CCAAA
   130  138 B L  E     -MO  67 113C   0 2264    6  LLLL LLVLLLLLLLLLLLLLLLLLLLLL LL  LLLLLLL  LLLLLL LLLLLLLLLL LLL LLLLV
   131  139 B M  E     -MO  66 112C   0 2264   30  VVVL ILVLIIIILLVLLLLLVLFVVIVV LL  LALFVVL  VFLLVM LVLLLLLIFL LLL LLIIL
   132  140 B K  E     -MO  65 111C  19 2264   49  ERQK KKKEKKKKRKKKQKKKKKREHKQK KK  KLKHEKK  RYKKEK KEQQQKRKHQ KQK KKKKA
   133  141 B L  E     - O   0 109C   0 2264    8  LLLI LLLLLLLLLLLLLLLLLLLLLLLL LL  LLLLLLL  LLLLLL LMLLLLLLLL LLL LLLLL
   134  142 B K  S    S+     0   0  111 2264   73  ASAT STRSSSSESASASAAASYKESAES AA  AHSKESA  QKAAEA TTSSSSVSKS SSA SSSST
   135  143 B K  S    S-     0   0  171 2264   76  ESSP KSEATTTSSKATRSNTASKDSTAS TS  SFSKEAS  RKTTEE SSSSSSTTKS STT TTEEQ
   136  144 B P        -     0   0   73 2264   40  PPSP PSRPPPPPPPPPPPPPPRAASPPP PP  PPQAPPP  PAPPPP PPPPPPPPAP QPP PPPPP
   137  145 B V        -     0   0   11 2220   48  VVVV AVVVVVVVVVVAVAVAVVVVLVVV AV  AVVVVVA  IVAAVM VVVVVAAAVV VIA VVVVL
   138  146 B A        -     0   0   75 2253   81  TSSA TTNFNNNTQVTRTQSRTTRTPQTQ QQ  QNTRSTQ  SRRRTN TTTTNQPSRN TTR SSTTT
   139  147 B F        +     0   0   87 2257   43  FFFC LFFFFFFFFLYFFYLFYFYFLFFF FY  YYFYFYY  FYFFFF FFFFFLFLYF FFF FFLLF
   140  148 B S        -     0   0   40 2259   60  TSSG NNTNSSSSTSSSSTTSSTNTTSTT ST  TSTNTTT  TNSSTT NNNNTTNNNS TSS TTSSN
   141  149 B D  S    S+     0   0   81 2262   69  NRDD SDTDNNNDNNKQRTDQKSDDEDDS KA  TTSDNNT  RNQQDD DDNNNASSDR SRQ DDDDE
   142  150 B Y  S    S+     0   0   81 2252   87  YYYF YYTLSSSSYRYTYRKTYLYYYTHR TR  RHAYYHR  YYTTYL YYYYYRYYYY AYT YYQQY
   143  151 B I        +     0   0    0 2256   24  IIII VIIVIIIIIRIVIIIVIIIIIVII VI  IIIIIII  IIVVIQ IIIIIVIVII IIV IIVVI
   144  152 B H        -     0   0    4 2256   79  LKLG KQSQMMMMRRQSRSQSQLRIQSLS SS  SQLQLQS  RQSSLQ SSTTTSASQR LRS RRQQQ
   145  153 B P        -     0   0    9 2256   44  PPPP TPPPAAAAPPPAPPLAPPPPPPPP AP  PPPPPPP  PPAAPP PPPPPPPTPP PPA PPLLP
   146  154 B V        -     0   0    1 2260   37  VIVG VAVVAAAAVIIVIVAVIIIVVVVI VV  VVIIVIV  IIVVVI VVVVVVIVII IIV IIGGV
   147  155 B a  B     -c  242   0B   3 2260   46  CCCC SCCCCCCCCCCCCCCCCCCCCCCC CC  CCCCCCC  CCCCCC CCCCCCCSCC CCC CCCCC
   148  156 B L        -     0   0   32 2260    9  VLLL LLLVLLLLLLLLLLLLLLLLLLIL LL  LLLLLLL  LLLLML LLLLLLLLLL LLL LLLLL
   149  157 B P        -     0   0    0 2259   30  PPPP PPPPPPPPAGQPPAPPQPPPPPPA PA  APPPPQA  PPPPPP AAPPSAPPPP PPP AAPPP
   150  158 B D     >  -     0   0   51 2255   78  DAKH SSNANNNSALASASPSATFDANDS SS  SENFDAS  AFSSDS EASSASgSFA NAS AAAAT
   151  159 B R  H  > S+     0   0  148 1806   76  SAPF .LNPSSSAS..AASAA.I.PASP. AS  S.I.P.S  A.AAPK QKTTTSmS.A VAA TTAAH
   152  160 B E  H  > S+     0   0  122 1873   75  SNGK .NASGGGGD..DNNGD.K.SGAED SN  N.T.S.N  N.DDSE GGGGNSAC.N TND GGGGG
   153  161 B T  H  > S+     0   0   10 2003   82  VADA .YEHDDDFSKSDAETDSEDVQEVN DE  EQKDVSE  ADDDVD SSSSSSEADA KAD SSTTQ
   154  162 B A  H  X S+     0   0    7 2020   84  VSPG .GETIIILVDTDSAIDTHVVADKN DA  AAQVITA  STDDIT NNTTTSRAVS QSD TTLLR
   155  163 B A  H  < S+     0   0   70 2078   68  FFLP .ALFLLLLFFFFFLLFFLFFLFFF FL  LFLFFFL  FFFFFN FFFFFIVAFF LFF YYLLL
   156  164 B S  H  < S+     0   0   36 2215   78  EPGP SGPTAAAPNtEPPTPPETQKVPEP SY  TMAQEET  PQPPEI PPYYYPLGQP APP AASSI
   157  165 B L  H  < S+     0   0    1  515   98  .... C........n........N..... ..  ...I...  .K.... ........I. ... ..NN.
   158  166 B L     <  +     0   0   34  711   82  ...K A........LF.....F.L..... ..  .V.L.F.  .L...F ......H.L. ... ..LL.
   159  167 B Q  S >  S-     0   0   87  836   93  ...I S...NNN..SE.....EIN..... ..  .QID.Q.  .N...Y ......L.D. I.. ..QQ.
   160  168 B A  T 3  S+     0   0   51 2039   74  TNPP ATATRRRNNrNANENANPQADAAQ AD  EAPGTNE  NEAATT GASSSSNTGN PNA AAPPD
   161  169 B G  T 3  S+     0   0   42 1713   37  GGG. G.GG...NGsRGGGNGR.NGGGGD GG  GD.NGRG  GNGGG. GGGGGGG.NG .GG GG..G
   162  170 B Y    <   -     0   0   46 1826   85  TLTQ S.STAAAETSTTLLYTTATMKSMY AL  LTATMTL  LTTTT. TTVVVTT.TL ALT SS..Q
   163  171 B K  E     -D  188   0B  33 2112   87  NHQT TDKSPPPAGTDLHTPLDSKNVNNT LK  TKFKNDT  KALLSE TTKKNKTSKH FHL NN..M
   164  172 B G  E     -D  187   0B   0 2154   45  CCCC CTLCCCCCSSCCCCCCCCCCCCCC CC  CCCCCCC  CCCCCC VATTTCTCCC CCC VVCCG
   165  173 B R  E     -DE 186 232B   3 2164   80  WTWY LWYYYYYYWLWATVYAWWFSTVWV VV  VWWFWWV  TFAAWW WWWWWVVLFT WTA WWYYT
   166  174 B V  E     -DE 185 231B   0 2189   33  VVVV IIVVVVVVVVVTVTVTVVIVVTVT TT  TVVIVVT  VITTVV VVVVVTVIIV VVT IIIII
   167  175 B T  E     +D  184   0B   0 2202   48  TTTT STTTTTTTTSTTTTTTTTSTTTTT TT  TTTSTTT  TSTTTT TTTTTTTSST TTT TTTTT
   168  176 B G  E     -D  183   0B   1 2202    0  GGGG GGGGGGGGGGGGGGGGGGGGGGGG GG  GGGGGGG  GGGGGG GGGGGGGGGG GGG GGGGG
   169  177 B W  S    S+     0   0    1 2202    1  WWWW WWWWWWWWWWWWWWWWWWWWWWWW WW  WWWWWWW  WWWWWW FFWWWWWWWW WWW WWWWW
   170  178 B G  S    S-     0   0    0 2198    1  GGGG GGGGGGGGGGGGGGGGGGGGGGGG GG  GGGGGGG  GGGGGG GGGGGGGGGG GGG GGGGG
   171  179 B N        -     0   0   33 2021   77  SHDY NN VRRRRANYKHRRKYERSNLSR KR  RKKRSNR  HRKKS  TTDDTRKNRH KHK TTRRN
   172  180 B L  S    S+     0   0   55 1822   62  PVII T  LLLLLVLITVLLTITTPTTPT TL  LVVTSIL  VTTTP  LLIIITDTTV VVT IILLV
   173  181 B K  S    S-     0   0  147 1551   78  SAAK S  M    RRKKASQKKTQSQKSS K   SNKKSKS  AKKKS  SSGGRGDSKA KAK NN   
   174  182 B E              0   0   49 1397   62  EPTE S  E    ETE PGT EKEE HEG     GEEEEEG  PE  E  SSNNSQSAEP EP  TT   
   175  183 B T              0   0  181 1202   57   SN  S  D    GTD S N DTE  T        TNE D   SE     GGGGGTGSES  S  GG   
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                                  TP        P      P                    
   178  186 C Q        -     0   0   64  328   73      S                        P  HS        N      P          T         
   179  187 C P        -     0   0    8  503   39      S                        P  SA       PP      A          P   P     
   180  188 C S  S    S+     0   0   81  526   81      D                        Y  DS       DR      D          D   V     
   181  189 C V  B    S-Q   95   0E  21  534   82      T                        N  VH       KV      V          K   T     
   182  190 C L        -     0   0    5  625    5      L                        L  LL       LL      V          L   L     
   183  191 C Q  E     -BD  34 168B   9  629   50      Q                        Q  QQ       QQ      M          Q   Q     
   184  192 C V  E     +BD  33 167B   6  628   86      D                        E  YV       QK      E          Q   C     
   185  193 C V  E     - D   0 166B  15  634   49      T                        A  VL       AL      A          A   A     
   186  194 C N  E     + D   0 165B   7  634   77      V                        K  KQ       AA      Q          T   N     
   187  195 C L  E     - D   0 164B   0  638   34      V                        V  LL       LV      V          L   I     
   188  196 C P  E     - D   0 163B  12  639   46      P                        S  PP       PP      P          P   S     
   189  197 C I  E     -F  210   0B   9  640   33      L                        V  VV       LI      L          L   I     
   190  198 C V  E     -F  209   0B  10  641   39      L                        V  VL       LI      L          L   L     
   191  199 C E    >>  -     0   0   75  641   66      S                        D  LD       SD      S          S   E     
   192  200 C R  H 3> S+     0   0   86  640   78      T                        V  SN       NT      Q          N   N     
   193  201 C P  H 3> S+     0   0   77  641   74      H                        K  YS       AP      E          A   K     
   194  202 C V  H <4 S+     0   0   41  641   84      L                        T  EF       QR      T          E   L     
   195  203 C c  H >< S+     0   0    5  645    1      C                        C  SC       CC      C          C   C     
   196  204 C K  H >< S+     0   0   91  645   74      N                        S  RQ       RN      R          K   H     
   197  205 C D  T 3< S+     0   0  141  645   80      S                        Q  SK       KL      G          K   W     
   198  206 C S  T <  S+     0   0   15  645   87      S                        A  GA       FL      A          F   A     
   199  207 C T    <   -     0   0   25  645   71      C                        Y  NY       WY      L          W   Y     
   200  208 C R  S    S+     0   0  249  645   89      m                        n  Ys       Gs      g          g   P     
   201  209 C I  S    S-     0   0   56  565   53      g                        g  Sk       Sg      d          .   G     
   202  210 C R        -     0   0  123  556   82      A                        l  .q       Kk      L          k   H     
   203  211 C I        -     0   0   12  633   24      L                        I  VV       IA      L          I   I     
   204  212 C T    >   -     0   0   12  638   73      T                        Q  TI       TI      T          T   S     
   205  213 C D  T 3  S+     0   0   82  642   69      H                        P  ED       EK      S          D   D     
   206  214 C N  T 3  S+     0   0   11  645   72      R                        D  Nd       Md      A          V   S     
   207  215 C M  E <   - G   0 263B   9  637   30      M                        M  Mv       .m      M          M   M     
   208  216 C F  E     - G   0 262B  19  643   34      L                        L  FM       IL      F          I   L     
   209  217 C c  E     -FG 190 261B   0  643    1      C                        C  CC       CC      C          C   C     
   210  218 C A  E     +FG 189 260B   0  643   10      A                        A  AA       AA      A          A   A     
   211  219 C G        -     0   0    4  643   18      G                        R  GG       GG      G          G   G     
   212  220 C Y        -     0   0   31  452   71      Y                        .  YF       .F      Y          .   L     
   213  221 C K     >  -     0   0   67  484   87      L                        .  YK       .A      L          .   W     
   214  222 C P  T >4 S+     0   0   63  534   70      D                        .  EK       AE      S          A   E     
   215  223 C D  T 34 S+     0   0  132  572   39      G                        G  GG       SG      G          S   G     
   216  224 C E  T 34 S-     0   0   83  609   46      R                        P  GG       GK      G          G   G     
   217  225 C G    <<  +     0   0   49  117   85      .                        .  ..       ..      .          .   .     
   218  226 C K        -     0   0  124  137   84      .                        .  ..       ..      .          .   .     
   219  227 C R        +     0   0   81  180   80      .                        .  ..       ..      .          .   .     
   220  228 C G        +     0   0    3  583   68      A                        G  KK       VK      I          V   R     
   221  229 C D  B     -A   30   0A  12  624   16      D                        D  DD       SD      D          S   G     
   222  230 C A        +     0   0    9  640   48      A                        A  TA       SA      S          S   S     
   223  231 C d    >>  -     0   0   13  644    1      C                        C  CC       CC      C          C   C     
   224  232 C E  T 34 S+     0   0   95  644   57      Q                        Q  LQ       KK      Q          M   Q     
   225  233 C G  T 34 S+     0   0   20  645    8      G                        D  GG       GG      G          G   G     
   226  234 C D  T X4  +     0   0    0  645    0      D                        D  DD       ED      D          D   D     
   227  235 C S  T 3< S+     0   0   16  645    6      S                        S  SS       SS      S          S   S     
   228  236 C G  T 3  S+     0   0    0  645    1      G                        G  GG       GG      G          G   G     
   229  237 C G    <   -     0   0    0  645    4      G                        G  GG       GG      G          G   G     
   230  238 C P  E     - H   0 246B   0  645    7      P                        P  AP       PP      P          P   P     
   231  239 C F  E     -EH 166 245B   0  644   24      L                        L  YL       LL      L          L   L     
   232  240 C V  E     -EH 165 243B   2  643   42      V                        V  IM       VV      A          V   V     
   233  241 C M  E     - H   0 242B   0  643   64      C                        C  IQ       CC      C          C   C     
   234  242 C K  E     - H   0 241B  11  644   80      P                        Q  QP       QL      E          Q   N     
   235  243 C S     >  -     0   0    1  642   84      S                        V  Dd       KV      D          K   G     
   236  244 C P  T  4 S+     0   0   47  109   82      .                        .  .p       ..      P          .   .     
   237  245 C F  T  4 S+     0   0  145  304   83      G                        A  AT       .G      A          .   T     
   238  246 C N  T  4 S-     0   0   63  501   60      D                        .  nt       DR      S          D   .     
   239  247 C N     <  +     0   0   85  373   58      .                        G  mt       R.      H          G   .     
   240  248 C R        -     0   0   59  432   80      M                        T  HY       AS      H          A   .     
   241  249 C W  E     - H   0 234B   1  442   42      W                        W  WF       WW      F          W   .     
   242  250 C Y  E     -cH 147 233B  19  521   85      H                        Q  VY       TL      V          T   .     
   243  251 C Q  E     + H   0 232B   0  638   57      L                        Q  VQ       LQ      L          L   L     
   244  252 C M  E     +     0   0B   0  642   82      V                        A  QT       MA      Y          V   A     
   245  253 C G  E     -IH 264 231B   0  645    0      G                        G  GG       GG      G          G   G     
   246  254 C I  E     -IH 263 230B   0  645   23      V                        V  LV       IV      I          I   V     
   247  255 C V  E     +I  262   0B   5  643   28      V                        V  VV       VI      T          V   V     
   248  256 C S  E     -     0   0B   6  644    5      S                        S  SS       SS      S          S   S     
   249  257 C W  E     +I  261   0B  35  642   16      W                        W  WF       WW      W          W   G     
   250  258 C G        -     0   0   36  645    5      G                        G  aG       GG      G          G   g     
   251  259 C E  S    S-     0   0   61  627   89      R                        E  pR       SE      D          S   e     
   252  260 C G  S    S-     0   0   21  637   41      G                        G  eK       gG      G          d   P     
   253  261 C d  S    S-     0   0   12  642    1      C                        C  cC       cC      C          c   C     
   254  262 C D  S    S+     0   0   28  643   37      A                        G  GA       SA      G          S   S     
   255  263 C R    >   -     0   0  128  645   82      E                        R  SE       TR      E          T   R     
   256  264 C D  T 3  S+     0   0   93  645   73      P                        P  KA       SR      R          S   P     
   257  265 C G  T 3  S+     0   0   29  629   69      N                        D  QG       SN      G          S   R     
   258  266 C K    <   -     0   0   90  639   88      R                        R  VY       PR      K          P   R     
   259  267 C Y        -     0   0   14  641   48      P                        P  YP       GP      P          G   P     
   260  268 C G  E     -G  210   0B   3  618   10      G                        G  GG       .G      G          .   A     
   261  269 C F  E     -GI 209 249B   3  639   18      V                        V  VI       VV      V          V   V     
   262  270 C Y  E     -GI 208 247B   2  644    4      Y                        Y  YY       YY      Y          Y   Y     
   263  271 C T  E     -GI 207 246B   2  644   35      A                        A  TT       TI      T          A   T     
   264  272 C H  E  >  - I   0 245B  31  644   59      K                        R  KR       HR      R          R   S     
   265  273 C V  T >4 S+     0   0    0  643   15      V                        V  VV       VV      V          V   V     
   266  274 C F  G >4 S+     0   0   39  642   74      A                        T  AT       TT      T          T   C     
   267  275 C R  G 34 S+     0   0  132  642   86      E                        A  NH       KS      A          K   H     
   268  276 C L  G  S+     0   0   57  641   79      L                        V  VV       IH      R          I   L     
   270  278 C K  H  > S+     0   0  164  641   65      D                        N  KP       PA      D          P   D     
   271  279 C W  H  > S+     0   0   37  641    0      W                        W  WW       RW      W          W   W     
   272  280 C I  H  X S+     0   0    1  641   10      I                        I  LL       VI      L          V   I     
   273  281 C Q  H >X S+     0   0   79  605   76      H                        H  DQ       QH                 Q   Q     
   274  282 C K  H >X S+     0   0  135  595   73      D                        H  DK       EH                 Q   E     
   275  283 C V  H 3< S+     0   0   15  570   82      T                        H  KN       II                 I   I     
   276  284 C I  H << S+     0   0   49  556   45      V                        I  LM       LI                 L   M     
   277  285 C D  H <<        0   0  114  506   74      R                        P  K        AP                 A   E     
   278  286 C Q     <        0   0  142  322   66                               E  S         E                     N     
## ALIGNMENTS  981 - 1050
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  IIVVIIIIIIIIIIIIIVVVII  IIIIIIIV  IV  IIII IIIII IIIIMIII  II  IIIIIII
    30   38 B V  B     +A  221   0A  13 2209   20  VVIIVVVVVVVVIIIIVVVVVVTTVVVVVVVV  VV  IVVV VVIVV VVVVVVVV  VV  TVVVIVM
    31   39 B E  S    S+     0   0  131 2214   31  GGNNGGGGGGGGGGGGGGNASSNNGGGSGGGH  GN  GGGK GGGGG GNGNGGGG  GG  GGGGGNG
    32   40 B G        -     0   0   30 2221    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GG  GGGG GGGGG GGGGGGGG  GG  GGGGGGG
    33   41 B S  E     -B  184   0B  74 2221   88  QQLLSDDDDDDDQQQQTYEENNTTVVVYYNTG  YE  MEEK QQQEQ EEFEQQQQ  TS  SSTVTEH
    34   42 B D  E     -B  183   0B  99 2227   62  VVIIDLLLLLLLNNNNDEDDEEDDQQQEETDP  ED  NSDD DDDAV DNNDDDDD  AE  SDDDDDD
    35   43 B A        -     0   0    5 2227   45  AACCAVVVVVVVAAAAACVAAAAAAAAACATC  CV  AAAA SSAAA AAAAAAAA  AA  AASAAAA
    36   44 B E    >   -     0   0   41 2228   84  PPPPSIIIIIIIAAAAAPNRRRTTSSSRPQQL  RK  QPTV SSTAP PVEVMAAA  QR  DKQLQVA
    37   45 B I  T 3  S+     0   0   90 2237   79  EEKKPPPPPPPPPPPPVRPPPPAAAAAPVPIK  KP  RDRP LLPPD PPEPDGGG  IA  ANAPIPS
    38   46 B G  T 3  S+     0   0   11 2241   60  GGGGGGGGGGGGGGGGENHHHHGGGGGHSGED  NH  GGGG GGGGG GGGGGGGG  GN  GGGGGGG
    39   47 B M  S <  S+     0   0    7 2243   67  SSHHSEEEEEEENNNNDSSSSSAAEEESSNSS  SS  QAAE RRNSS HSKSEHHH  AS  QSQAASK
    40   48 B S  S >  S+     0   0   11 2247   63  WWCCWIIIIIIIWWWWWVWWWWWWWWWWKWWH  VW  WWWF WWWWW WWWWWWWW  WW  WWWWWWW
    41   49 B P  T 3  S+     0   0    5 2251    4  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP  PP  PPPP PPPPP PPPPPPPP  PP  PPPPPPP
    42   50 B W  T 3  S+     0   0    2 2253   18  WWWWWWWWWWWWWWWWWYWWWWWWWWWWFWWF  YW  WWWW WWWWW WWWWWWWW  WW  WWWWWWW
    43   51 B Q  E <   -J   59   0C   2 2256   32  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ  QQ  QQQQ QQLQQ QQQQQQQQ  VM  QQQLIQQ
    44   52 B V  E     -JK  58  91C   0 2257   34  AAAAVVVVVVVVAAAAVVIVVVAAGGGVVVVA  VI  VVII VVAAV VVVVVAAA  VA  VVVVVVV
    45   53 B M  E     -JK  57  90C   0 2256   51  SSMMSAAAAAAASSSSSSSSSSSSLLLSSSSA  SS  NSSS SSFSS SSSSSSSS  SS  SSSSSSG
    46   54 B L  E     -JK  56  89C   0 2257   14  LLLLLLLLLLLLLLLLLLLLLLLLFFFLLLLL  LL  LILL LLILL VLVLILLL  LL  ILLILLL
    47   55 B F  E     -JK  54  88C   0 2256   82  HHSSnMMmMMMMNNNNQNQqQqhhlllqNqQY  NQ  NYQQ RRtYQ qQrQQRRR  QE  TRNQqQw
    48   56 B R  E   > -JK  53  87C  76 1547   74  VV..f..r....RRRR..y.riffiiir.yYT  .y  F.YL YYf.. f.r.RFFF  iY  HDFiy.w
    49   57 B K  T > 5S+     0   0   41  951   80  ..................nssa..llls..N.  .n  .... ..... .D.D....  g.  ...rGDs
    50   58 B S  T 3 5S+     0   0   72 1192   73  ..EE............Q.GGKV..GGGK..E.  .G  .E.. ...NT .G.K....  R.  ...TKKS
    51   59 B P  T 3 5S-     0   0   69 2030   82  SSNN.qqsqqqqEEEEGSERHWVVAAAKAKQS  SE  DDKN DD.SS .S.TNSSS  IN  EGLGITQ
    52   60 B Q  T < 5 +     0   0   62 2193   78  GGNNGgggggggGGGGGGWWFRDDRRRFG..G  GW  GSGQ GGNGG GGEGGGGG  LG  GSNPLGW
    53   61 B E  E   < -J   48   0C  77 2221   95  GGIIVEEEEEEEGGGGQYRRIHGGIIIVYT.H  YR  HGKR TTQSS GFEFSNNN  AM  VKNRAFI
    54   62 B L  E     +J   47   0C  17 2246   57  HHYYSVVVVVVVQQQQHHHHHLHHPPPHHHHL  HH  HHHH HHFFH HHHHHHHH  HH  HHHHHHF
    55   63 B L  E     -     0   0C  17 2261   70  RRTTHFFFFFFFFFFFVFTVVVVVIIIVFLTL  FT  VVAV LLQAF FFVFFVVV  IV  VIVSVFS
    56   64 B b  E     -J   46   0C   1 2264    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CC  CCCC CCCCC CCCCCCCC  CC  CCCCCCC
    57   65 B G  E     +J   45   0C   2 2264    3  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GG  GGGG GGGGG GGGGGGGG  GG  GGGGGGG
    58   66 B A  E     -J   44   0C   0 2264   13  GGAAGGGGGGGGGGGGGGGGGGGGAAAGGGGG  GG  AGGG GGGGG GGGGGGGG  GG  GGGGGGG
    59   67 B S  E     -JL  43  67C   0 2264   40  SSIISSSSSSSSSSSSSSTTTTTTTTTTSTIV  ST  TSTS SSSSS SSSSSSSS  SS  SSSSSSS
    60   68 B L  E     + L   0  66C   0 2264   10  LLIILIIIIIIILLLLLLLLLLLLLLLILIIL  LL  LLLL LLLLL LLLLLLLL  LL  LLLLLLL
    61   69 B I        -     0   0   23 2264   15  IILLILLLLLLLIIIIVIIIIIIIIIIIIIII  II  IIII LLIII IIIIIIII  VV  VIIIVII
    62   70 B S  S    S-     0   0   32 2264   62  NNSSTSSSSSSSSSSSSSSSHHTTSSSHNTND  SS  AASS SSSTN NNASTSSS  KS  SAASRSH
    63   71 B D  S    S+     0   0   61 2210   68  NNEEKEEEEEEESSSSPSESKKNNQQQKEPPP  SD  PSPE GGDDS KQAEEEEE  ND  EEPADEP
    64   72 B R  S    S+     0   0   80 2263   73  RRQQDRRRRRRREEEERQQENNQQKKKNNYRQ  SQ  QQDD DDQQQ EYQNRSSS  NR  QSQRRDQ
    65   73 B W  E     - M   0 132C  12 2264   12  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW  WW  WWWW WWWWW WWWWWWWW  WY  WWWWWWW
    66   74 B V  E     -LM  60 131C   0 2262   11  VVVVVVVVVVVVVVVVVVVVVVIIVVVIVIIV  VV  LVIV VVVVV VVVVVVVV  VV  VVVVVVV
    67   75 B L  E     +LM  59 130C   0 2263   23  LLLLLIIIIIIILLLLILLLLLLLLLLIVVVL  VL  VLLI LLLLL MVLVLLLL  LI  LVILLVL
    68   76 B T  E     - M   0 129C   0 2263   28  SSTTTTTTTTTTTTTTTSTTTTTTTTTTSTTT  ST  TSTT TTTTT STTTTTTT  TT  SATTTTT
    69   77 B A    >   -     0   0    0 2262    2  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA  AA  AAAA AAAAA AAAAAAAA  AA  AAAAAAA
    70   78 B A  G >> S+     0   0    0 2263    6  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA  AA  AAAA AAAAA AAAAAAAA  AA  AAAAAAA
    71   79 B H  G 34 S+     0   0   10 2264    3  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  HH  HHHH HHSHH HHHHHHHH  HH  HHHHHHH
    72   80 B b  G <4 S+     0   0    0 2264    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CC  CCCC CCCCC CCCCCCCC  CC  CCCCCCC
    73   81 B L  T <4 S+     0   0    1 2264   68  FFVVILLLLLLLIIIIFYIIFFLLTTTFYVFK  YI  FFFF FFVSF FNIGFIII  TV  FFFFTGI
    74   82 B L  E  <  +P   81   0D  46 2264   89  QQWWDLLLLLLLTTTTAKSDQQQQVVVQMEPK  KS  PQPY PPTTK FVLVSKKK  KE  PKPKKVL
    75   83 B Y  E > > -P   80   0D  49 2249   82  GGRRQEEEEEEEGGGGGSSDKKIIGGGKSDS.  SS  PKSQ EEPPT SSSKNSSS  DG  S.PADRG
    76   84 B P  G > 5S+     0   0   52 2249   88  VVKKSEEIEEEEDKKKKRGEGGHHIIIGpkE.  RG  VENF RRLDN fPHTTSLL  TA  E.EKSTR
    77   85 B P  G 3 5S+     0   0   75  844   90  ....G.......PSSS...HKKIITTT..k..  ..  .... ....D ...S....  ..  ......N
    78   86 B W  G < 5S-     0   0  166  852   93  ....S.......SDDD...GAASSHHH..Q..  ..  .... ....T ...D....  ..  ......P
    79   87 B D  T < 5 +     0   0  152  869   93  ....N.......APPP...HEERRTTT..W..  ..  .... ....S ...L....  ..  ......V
    80   88 B K  E   < +P   75   0D  51  904   83  ....P.......ISSS...RDDAASSS..R..  ..  ...R ....G ...V....  ..  ...R..T
    81   89 B N  E     +P   74   0D 110  936   80  ....K.......TAAA...VAAWWLLL..V..  ..  ..VD ....V ...V....  ..  ...R..R
    82   90 B F        -     0   0   28 1017   94  ....E.......VIII...LGGVVQQQK.Y..  ..  ..ML ....T ...A....  ..  .K.L..H
    83   91 B T    >>  -     0   0   70 1164   86  ....E.......FTTT...LSSVVIIIA.S..  ..  N.FS ..S.V ...G..RR  .M  HDNL..I
    84   92 B E  G >4 S+     0   0   35 1455   85  ....S.......LVVV...GWWYYDDDE.G..  ..  PNSQ ..Q.T .G.ES.SS  RA  HKPPR.K
    85   93 B N  G 34 S+     0   0  127 1677   87  rrPPrKK.KKKKGFFF...KRRLLFFFd.I.P  ..  IEDY NNe.L .R.FEWWW  Dt  KSIQD.V
    86   94 B D  G <4 S+     0   0   49 1292   82  ssAA.VVNVVVV....K.RHIIGGGGGar..N  .R  DK.Q RRgE. ..W.TVVV  Ps  EAA.PSQ
    87   95 B L  E <<  +K   48   0C   0 1493   89  DDHH.SSNSSSS....E.EIVVRRVVVNV..L  .Q  RE.V VVDP. .HQ.SSSS  LR  EYD.LHL
    88   96 B L  E     -KN  47 108C   3 2025   51  vvll.fflffff.LLLlvyLLLQQLLLwVLyQ  iy  yLyL llti. .Fy.lfff  mw  yMywmLG
    89   97 B V  E     -KN  46 107C   0 1516   29  vvvv.iipiiii.GGGwvv........vV.kV  vv  v.v. vvvv. vAv.vvvv  av  vVvvaV.
    90   98 B R  E     -KN  45 106C   0 1577   87  YYTT.RRSRRRRRRRRRRA........IR.VI  RA  TLN. FFFK. FVK.LWWW  VR  KNTVVV.
    91   99 B I  E     +KN  44 105C   0 1674   49  LLVV.VVAVVVVIIIIVLM........LI.IL  LL  LLLL AALL. LLM.LLLL  IL  LLLILA.
    92  100 B G  S    S+     0   0    7 1756   23  GGGG.GGGGGGGNNNNVGG.GG.....GG.AG  GG  GGGG GGGGG GGG.GGGG  GG  GGGGGG.
    93  101 B K        +     0   0   13 1789   76  RREE.EEEEEEEQQQQSEK.KK.....KE.GK  EK  AANV AAVQR LED.ASSS  TK  AEAATE.
    94  102 B H        +     0   0   36 1883   76  QQHH.HHHHHHHAAAAGHH.HH.....HH.IH  HH  FYYT VVQNQ QYR.RNNN  NH  HYYSNF.
    95  103 B S  B     -Q  181   0E  21 1965   75  SSDD.TTTTTTTGGGGRNN.QQ..DDDRN.SN  NN  QQQQ AANTT SDHDQKKK  ND  QQQQND.
    96  104 B R  S    S+     0   0   16 2018   82  QQRR.LLLLLLLPPPPTIL.LL..YYYLI.IL  IL  LLLL RRLQL LRLQLVVV  IR  LLLLIQR
    97  105 B T  S    S+     0   0   31 2112   87  QQEE.SSSSSSSNNNNYAVGKKSSAAANFKLR  AV  KSLS TTTNQ QSSGLQQQ  NS  DLSSHGV
    98  106 B R  S    S-     0   0   85 2151   87  GGII.IIIIIIIPPPPMVEARRQQAAARSRSQ  VE  NNKN SSGGG GSTSQNNN  VR  SNNQGSR
    99  107 B Y        -     0   0   21 2204   90  SSFF.QQQQQQQNNNNGNTNSSNNNNNSSSST  NT  PPPP PPPSS ANQDPSSS  HT  YPPLRDL
   100  108 B E    >>  -     0   0   22 2250   66  NNEE.EEEEEEEEEEETEEEEEGGEEEEEESE  EE  SSEG HHFNN NTKEGQQQ  HE  SSGGHAA
   101  109 B R  T 34 S+     0   0  143 2252   78  PPKK.GGGGGGGVVVVLGDESSAAAAASGMNT  GD  DPPP AAPPP PETEPGGG  PS  EEAPPEH
   102  110 B N  T 34 S+     0   0  133 2255   82  NNTT.TTTTTTTSSSSGTGAVVNNSSSTTNGF  TA  DNNQ VVTNN NPSNHGGG  HT  DSDEPDQ
   103  111 B I  T <4 S+     0   0   58 2257   77  EEEE.EEEEEEERRRRGEASEEKKAAAEEIVQ  EA  LMAA QQVEA KVLVAKKK  SE  AVIATTG
   104  112 B E     <  -     0   0    0 2258   77  TTQQ.QQQQQQQSSSSSQAQRRYYKKKKQWPR  QA  VKQC LLVVV VQVQVEEE  KQ  KRKQKQS
   105  113 B K  E     -N   91   0C  69 2257   91  VVHH.NNNNNNNVVVVYWFSIIEEAAAMFKVQ  FF  EMWC GGGTF SVIVYYYY  KN  VSVVIVV
   106  114 B I  E     -N   90   0C  11 2259   71  LLRR.YYYYYYYIIIIVIMRFFVVFFFYIGAI  IM  KLVL VVRRL RLPIAYYY  IL  SSVRILQ
   107  115 B S  E     -N   89   0C  12 2260   84  GGRR.DDDDDDDQQQQDDGSPPKKAAARQNKS  NG  LQKG QQTTT NSIKHVVV  KF  TSLSKKV
   108  116 B M  E     -N   88   0C  58 2260   71  VVVV.VVVVVVVAAAARATTVVrrVVVVAFVV  ST  IILV AAVVV VIQIVSSS  VV  LIVIVIA
   109  117 B L  E     +O  133   0C   6  452   51  ....i.................vv.....V..  ..  .... ..... ........  ..  .......
   110  118 B E  E    S+     0   0C  92 1908   74  TTIIKLLLLLLL.....AAAKKSSEEEKQA..  AA  QQSQ ..NAT AS.AR...  KR  K.AKKA.
   111  119 B K  E     -O  132   0C  92 2029   65  QQKKQEEEEEEE.....KDLRREEKKKRKK.D  KD  EQKQ ..KDK KKNKRRRR  AR  DKEQAKR
   112  120 B I  E     -O  131   0C  20 2160   45  IIVVAQQQQQQQ....ILIIIIIIIIIIAI.R  VI  VVVV VVITI IAIVVIII  II  INAVIVI
   113  121 B Y  E     -O  130   0C  66 2224   50  IILLVHHHHHHHTTTTIIIIYYIIIIIYIIYT  II  LIII IIIII IIIFEVVV  II  IIIVIFI
   114  122 B I  E     -O  129   0C  52 2228   82  NNIICLLLLLLLCCCCLKVARRIIDDDRRATI  TV  KPTI YYCCP LTVKSIII  IS  PYKQIKR
   115  123 B H    >   -     0   0   25 2247   20  HHHHHHHHHHHHHHHHNHHHHHHHHHHHHHNV  HH  HHHH HHHHH HHHNNHHH  HH  HIFHHNH
   116  124 B P  T 3  S+     0   0  106 2258   50  PPPPPPPPPPPPPPPPGPEEEEPPEEEEPKGH  PE  PPKP GGPPP PPPPPPPP  PG  PHPEPPP
   117  125 B R  T 3  S+     0   0  162 2261   76  DDGGRLLLLLLLSSSSEHSDSSQQAAARRGLP  RG  EDAM GGDDN NSKKLKKK  GS  SPNRDKK
   118  126 B Y    <   -     0   0   15 2261   15  YYYYYYYYYYYYYYYYYYWYFFYYYYYFYYYR  YW  YYYY YYYYY YWFFYHHH  FY  YSYYFFY
   119  127 B N  B > > +R  125   0F  41 2262   68  DDNNDnnnnnnnddddDnnnrRNNNNNRsndY  nn  tkaa llsNn DNrsqNNN  NS  LYTeDns
   120  128 B W  T 3 5 +     0   0   62 1485   76  ..KKFiiiiiiiffff.yflty.....yy.iN  yf  .y.h rrl.k ...lm...  L.  .T.rLfi
   121  129 B R  T 3 5S+     0   0  192 1311   77  SSTT............P..sHtDDNNNh.k.P  ..  dDdT ppTN. SPa.ATTT  .S  QDDM..G
   122  130 B E  T < 5S-     0   0  101 1657   80  NNSSL...........E..RSHTTIIIL.TRE  ..  EGGT TTHS. VTA.STTT  ES  ELEEE.V
   123  131 B N  T   5S-     0   0    4 2142   69  TTSSTsssssssTTTTRN.NEsTTNNNnNKNT  N.  GSTS iiKTT TTtTSTTT  TK  GGGRSTS
   124  132 B L    > < +     0   0   25 1817   69  II..IyyyyyyyNNNNNLi.LlLLLLLlL..H  Li  S... ee.YS .LiV....  FI  SSS.FVG
   125  133 B D  B 3   +R  119   0F   7 2115   65  NNDDDDDDDDDDDDDDDDR.DDDDLLLDDHDD  DR  KMS. nn.EN nNNR....  VS  QSG.VNG
   126  134 B R  T 3  S-     0   0   43 2196   57  NNKKNHHHHHHHNNNNYNN.YYNNNNNYNKNN  NN  GGGG nnNNN nN.NAAAA  NN  GGGNNNA
   127  135 B D    <   +     0   0    0 2261    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD  DD  DDDD DDDDD DDDDDDDD  DD  DDDDDDD
   128  136 B I        +     0   0    0 2264   11  IILLIIIIIIIIVVVVIIIIIIIIIIIIIIII  II  IIII IIIII ILIIVIII  II  IILIVIV
   129  137 B A  E     -MO  68 114C   0 2263   48  SSAACAAAAAAACCCCAMAAAAAASSSAMAAM  MA  AAAA AACCC ATATAAAA  AA  AAAAATA
   130  138 B L  E     -MO  67 113C   0 2264    6  LLMMLLLLLLLLLLLLLLLLLLLLLLLLLLLM  LL  LLLL LLLLL LLLLLLLL  LL  LLLLLLL
   131  139 B M  E     -MO  66 112C   0 2264   30  LLLLLIIIIIIILLLLMIIIVVVVIIIVIMIV  II  VVAV VVLLL LLLLVLLL  FM  LVVLFLL
   132  140 B K  E     -MO  65 111C  19 2264   49  QQKKQYYYYYYYKKKKRKKKKKKKKKKKKKKH  KK  KKQQ HHKKQ RKRKEKKK  HE  QEKEHKK
   133  141 B L  E     - O   0 109C   0 2264    8  LLLLLLLLLLLLLLLLLLLLAALLLLLPLLLL  LL  LLLL LLLLL LLLLLLLL  LL  LLLLLLL
   134  142 B K  S    S+     0   0  111 2264   73  AAHHSKKKKKKKSSSSSSESAAHHAAAVSEKK  SE  KAKS SSSSS SALAESSS  KS  SGKSKAK
   135  143 B K  S    S-     0   0  171 2264   76  EERRASSSSSSSAAAASRSSTTSSGGGERSLN  SS  ESHR SSTAS SSYTASSS  KS  STEQKTA
   136  144 B P        -     0   0   73 2264   40  TTPPPPPPPPPPPPPPPPPPDDPPVVVEPPPP  PP  PPPK SSPPA PPPPPRRR  AT  PPPPKPP
   137  145 B V        -     0   0   11 2220   48  VVVVVIIIIIIIVVVVIAVVIIVVVVVIVLLV  AV  VVIV LLVVV VAVAVVVV  VA  VVVIVAV
   138  146 B A        -     0   0   75 2253   81  SSKKNAAAAAAANNNNTTTNNNTTTTTQETTK  RT  SNHQ PPNNT RRNRATTT  RT  NSSVKRR
   139  147 B F        +     0   0   87 2257   43  FFLLFFFFFFFFFFFFVLFAPPFFYYYSMFFF  LF  YFFY LLFFF FYFFFFFF  YI  FFYCYFP
   140  148 B S        -     0   0   40 2259   60  TTGGTSSSSSSSTTTTGNSSSSSSTTTSNSSS  DS  TTTS TTTTT TTTSTTTT  NN  SSSNNSS
   141  149 B D  S    S+     0   0   81 2262   69  TTLLDAAAAAAANNNNASDDNNDDDDDRQDDK  SD  RDEY EEDDS DTSQNPPP  ED  RRRDEQK
   142  150 B Y  S    S+     0   0   81 2252   87  YYYYNTTTTTTTYYYYSYTTFFHHYYYFRTSK  YT  TYSL YYYYY YYTTYLLL  YY  YVTYYTR
   143  151 B I        +     0   0    0 2256   24  IIVVIVVVVVVVIIIIHVIVIIIIIIIIVIII  AI  IIII IIIII IIIVIIII  IV  IIIAIVV
   144  152 B H        -     0   0    4 2256   79  QQVVYRRRRRRRYYYYRQMTRRRRIIIHRRK   RM  RLLL QQRQS RSHSLLLL  QS  RFRQQSR
   145  153 B P        -     0   0    9 2256   44  PPPPPPPPPPPPPPPPPTAAYYPPPPPYPPP   TA  PPPP PPPPP PPPAPPPP  PP  PPPLPAW
   146  154 B V        -     0   0    1 2260   37  VVIIVIIIIIIIVVVVVVAAAAIIAAAAIVA   VA  IIAI VVIVV VVIVVIII  IV  IVIAIVI
   147  155 B a  B     -c  242   0B   3 2260   46  CCCCCCCCCCCCCCCCCACCCCCCCCCCSCC   SC  CCCC CCCCC CCCCCCCC  CC  CCCCCCR
   148  156 B L        -     0   0   32 2260    9  LLLLLIIIIIIILLLLMLLLLLLLLLLLLLL   LL  LLLL LLLLL LLVLVLLL  LV  LLLLLLL
   149  157 B P        -     0   0    0 2259   30  AAPPAGGGGGGGAAAASPPPPPAAPPPPPPP   PP  PPPP PPAAA AAPPPPPP  PA  PPPPPPP
   150  158 B D     >  -     0   0   51 2255   78  AAAAAPPPPPPPAAAAPSADRRSSTTTKRNN   SA  ADDD AAASA ASSDDnnn  FE  AASDFDP
   151  159 B R  H  > S+     0   0  148 1806   76  PPQQA.......AAAA.R.QKKNNAAARS..   ..  SAAA AAEAS SS.APrrr  D.  ASAADEA
   152  160 B E  H  > S+     0   0  122 1873   75  EENND.......NNNN.C.GQQSSDDDEC..   ..  TSMS GGNGN GN.NSPPP  I.  NSSRVAS
   153  161 B T  H  > S+     0   0   10 2003   82  SSSSRRRRRRRRSSSSKPALTTSSIIINA..   .A  VTVL QQSSS SEEDVLLL  F.  AVVTFDS
   154  162 B A  H  X S+     0   0    7 2020   84  TTTTAAAAAAAATTTTAVDIGGQQSSSPP..   .N  DQKK AATTT VALDVTTT  Q.  S SEQDA
   155  163 B A  H  < S+     0   0   70 2078   68  FFIIFFFFFFFFVVVVFAFLLLFFAAALAFY   .F  FFFF LLFFF FLFFFLLL  KL  F FVNFF
   156  164 B S  H  < S+     0   0   36 2215   78  HHssHtttttttYYYYGDVPSSYYGGGRGgk   SV  PPSP VVYNY NPHPEPPP  LD  P PSLPP
   157  165 B L  H  < S+     0   0    1  515   98  ..tt.fffffff.................qt   C.  .... ..... ........  ..  . .K...
   158  166 B L     <  +     0   0   34  711   82  ..LL.LLLLLLLTT..L.L..........FL   AL  .... ..... ..V.....  .V  . .L...
   159  167 B Q  S >  S-     0   0   87  836   93  ..AA.IIIIIIIRR..P.P..........LV   GP  .... ..... ..Q.....  DA  . .VD..
   160  168 B A  T 3  S+     0   0   51 2039   74  TTNNNkkkkkkkTTTTAEHHPPNNEEEPTPA   AH  RSSP DDANS DQSAK...  QA  N SHQAP
   161  169 B G  T 3  S+     0   0   42 1713   37  GGIIGyyyyyyy..RRG.NGGGPP...G.DG   GN  GDGG GGGGG GGGGD...  NG  G G.NGG
   162  170 B Y    <   -     0   0   46 1826   85  TTRRTSSSSSSS..TTS.EAHHAA...H.TS   TE  MSTK KKTTV TLTTMAAA  TT  L M.TTT
   163  171 B K  E     -D  188   0B  33 2112   87  DDQQSPPPPPPPRRRRSNSPYYSSLLLSMTR   SS  KYFV VVNSN DTTQNSSS  KN  H K.KLR
   164  172 B G  E     -D  187   0B   0 2154   45  SSSSSAAAAAAASSSSMCCCCCCCCCCCCCL   CC  CCCC CCTSS SCCCCCCC  CC  C CCCCC
   165  173 B R  E     -DE 186 232B   3 2164   80  WWTTWRRRRRRRWWWWVMYYWWWWWWWWQWW   LY  TWWW TTWWW WVWVWWWW  FI  T TYFAW
   166  174 B V  E     -DE 185 231B   0 2189   33  VVVVVVVVVVVVIIIIVVVVVVVVIIIVVIV   IV  VVVV VVVVV VTVTVVVV  IT  V VIITV
   167  175 B T  E     +D  184   0B   0 2202   48  TTSSTSSSSSSSTTTTTSTTTTTTTTTTSST   ST  TTTT TTTTT TTTTTTTT  ST  T TSGTT
   168  176 B G  E     -D  183   0B   1 2202    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GG  GGGG GGGGG GGGGGGGG  GG  G GGGGG
   169  177 B W  S    S+     0   0    1 2202    1  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW   WW  WWWW WWFFW WWWWWWWW  WW  W WWWWW
   170  178 B G  S    S-     0   0    0 2198    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GG  GGGG GGGGG GGGGGGGG  GG  G GGGGG
   171  179 B N        -     0   0   33 2021   77  NNRRARRRRRRRKKKKYNRRVVKKSSSDDSY   NR  NKAN NN AS ARKKSKKK  RD  H HVR  
   172  180 B L  S    S+     0   0   55 1822   62  IILLNTTTTTTT AAALTLLTT     T TT   TL  IITL TT LT VLTTPTTT  TT  V VTT  
   173  181 B K  S    S-     0   0  147 1551   78    SSSRRRRRRR DDDES SRR     R RK   S    NSR QQ SK KSKKSEEE  EQ  A  QK  
   174  182 B E              0   0   49 1397   62      N        NNNEA TGG     G EE   S    E H    SE EGQ EEEE  EG  P  EE  
   175  183 B T              0   0  181 1202   57      G        GGGNN DGG     G GN   S    N S    DN G E  EEE  ET  S  TE  
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                                  T   A     E                  TT       
   178  186 C Q        -     0   0   64  328   73                                  S   DP    A     T            PP       
   179  187 C P        -     0   0    8  503   39                                  P   RP    S     S         P  SS       
   180  188 C S  S    S+     0   0   81  526   81                                  S   NY    D     D         R  NN       
   181  189 C V  B    S-Q   95   0E  21  534   82                                  I   KN    V     V         K  RR       
   182  190 C L        -     0   0    5  625    5                                  LL  LL    L     L         L  LL       
   183  191 C Q  E     -BD  34 168B   9  629   50                                  QK  QR    L     L         Q  KK       
   184  192 C V  E     +BD  33 167B   6  628   86                                  VK  CE    D     S         E  EE       
   185  193 C V  E     - D   0 166B  15  634   49                                  AT  LV    V     V         V  VV       
   186  194 C N  E     + D   0 165B   7  634   77                                  PE  EQ    T     N         T  NN       
   187  195 C L  E     - D   0 164B   0  638   34                                  LV  IV    I     V        MV  II       
   188  196 C P  E     - D   0 163B  12  639   46                                  PN  PT    Y     T        PP  TT       
   189  197 C I  E     -F  210   0B   9  640   33                                  VL  II    T     V        VI  II       
   190  198 C V  E     -F  209   0B  10  641   39                                  VI  LL    V     V        WL  VV       
   191  199 C E    >>  -     0   0   75  641   66                                  ES  SN    N     S        RS  DD       
   192  200 C R  H 3> S+     0   0   86  640   78                                  HH  KN    R     R        NS  RR       
   193  201 C P  H 3> S+     0   0   77  641   74                                  SK  KT    Q     Q        ED  GG       
   194  202 C V  H <4 S+     0   0   41  641   84                                  IL  DR    L     T        DE  TT       
   195  203 C c  H >< S+     0   0    5  645    1                                  CC  CC    C     C        CC  CC       
   196  204 C K  H >< S+     0   0   91  645   74                                  SQ  QN    A     N        DR  NN       
   197  205 C D  T 3< S+     0   0  141  645   80                                  TS  NY    D     S        RN  DD       
   198  206 C S  T <  S+     0   0   15  645   87                                  PP  SL    R     R        AQ  KK       
   199  207 C T    <   -     0   0   25  645   71                                  ES  YF    Y     D        YS  DD       
   200  208 C R  S    S+     0   0  249  645   89                                  wy  Pe    s     y        Fd  hh       
   201  209 C I  S    S-     0   0   56  565   53                                  gk  Gs    g     s        Qk  dd       
   202  210 C R        -     0   0  123  556   82                                  SH  Mr    i     v        Pq  kk       
   203  211 C I        -     0   0   12  633   24                                  LI  IM    I     I        II  VV       
   204  212 C T    >   -     0   0   12  638   73                                  AT  TI    T     T        TN  TT       
   205  213 C D  T 3  S+     0   0   82  642   69                                  RD  NQ    E     S        DD  AA       
   206  214 C N  T 3  S+     0   0   11  645   72                                  nN  Sd    N     D        TR  NN       
   207  215 C M  E <   - G   0 263B   9  637   30                                  m.  Mm    M     M        .V  MM       
   208  216 C F  E     - G   0 262B  19  643   34                                  V.  FF    I     I        .L  LL       
   209  217 C c  E     -FG 190 261B   0  643    1                                  C.  CC    C     C        .C  CC       
   210  218 C A  E     +FG 189 260B   0  643   10                                  AM  AA    A     A        .A  AA       
   211  219 C G        -     0   0    4  643   18                                  GL  GG    g     G        .G  GG       
   212  220 C Y        -     0   0   31  452   71                                  .C  YA    l     .        FF  ..       
   213  221 C K     >  -     0   0   67  484   87                                  .A  LE    D     S        LP  DD       
   214  222 C P  T >4 S+     0   0   63  534   70                                  .G  ED    V     N        CE  KK       
   215  223 C D  T 34 S+     0   0  132  572   39                                  GS  GG    G     G        AG  NN       
   216  224 C E  T 34 S-     0   0   83  609   46                                  DP  GS    G     E        gG  GG       
   217  225 C G    <<  +     0   0   49  117   85                                  .D  ..    .     .        r.  ..       
   218  226 C K        -     0   0  124  137   84                                  GW  ..    .     K        G.  ..       
   219  227 C R        +     0   0   81  180   80                                  VT  ..    .     K        G.  ..       
   220  228 C G        +     0   0    3  583   68                                  LT  KV    K     A        VK  NN       
   221  229 C D  B     -A   30   0A  12  624   16                                  SD  DD    D     D        DD  DD       
   222  230 C A        +     0   0    9  640   48                                  GS  ST    A     T        AS  AA       
   223  231 C d    >>  -     0   0   13  644    1                                  CC  CC    C     C        CC  CC       
   224  232 C E  T 34 S+     0   0   95  644   57                                  QK  QK    Q     Q        QQ  EE       
   225  233 C G  T 34 S+     0   0   20  645    8                                  GG  GG    G     G        GG  GG       
   226  234 C D  T X4  +     0   0    0  645    0                                  DD  DD    D     D        DD  DD       
   227  235 C S  T 3< S+     0   0   16  645    6                                  SS  SS    S     S        SS  SS       
   228  236 C G  T 3  S+     0   0    0  645    1                                  GG  GG    G     G        GG  GG       
   229  237 C G    <   -     0   0    0  645    4                                  GG  GG    G     G        GG  GG       
   230  238 C P  E     - H   0 246B   0  645    7                                  PP  PP    P     P        PP  PP       
   231  239 C F  E     -EH 166 245B   0  644   24                                  LL  VL    L     F        LM  LL       
   232  240 C V  E     -EH 165 243B   2  643   42                                  NV  VV    Y     V        MH  II       
   233  241 C M  E     - H   0 242B   0  643   64                                  CC  CC    F     C        LI  CC       
   234  242 C K  E     - H   0 241B  11  644   80                                  FE  ND    H     D        QT  NN       
   235  243 C S     >  -     0   0    1  642   84                                  TA  NK    N     G        AD  NN       
   236  244 C P  T  4 S+     0   0   47  109   82                                  ..  ..    .     .        .P  ..       
   237  245 C F  T  4 S+     0   0  145  304   83                                  ..  ..    V     V        .V  ..       
   238  246 C N  T  4 S-     0   0   63  501   60                                  DS  QD    .     .        NT  KK       
   239  247 C N     <  +     0   0   85  373   58                                  GG  .G    .     .        GD  ..       
   240  248 C R        -     0   0   59  432   80                                  AR  .L    .     .        RK  ..       
   241  249 C W  E     - H   0 234B   1  442   42                                  WM  .W    .     .        WY  ..       
   242  250 C Y  E     -cH 147 233B  19  521   85                                  RF  .Y    .     .        TV  ..       
   243  251 C Q  E     + H   0 232B   0  638   57                                  VL  LQ    L     L        QL  YY       
   244  252 C M  E     +     0   0B   0  642   82                                  HF  QV    V     V        IA  SS       
   245  253 C G  E     -IH 264 231B   0  645    0                                  GG  GG    G     G        GG  GG       
   246  254 C I  E     -IH 263 230B   0  645   23                                  VI  VI    V     V        VV  II       
   247  255 C V  E     +I  262   0B   5  643   28                                  VV  VV    V     T        VV  TT       
   248  256 C S  E     -     0   0B   6  644    5                                  SS  SS    S     S        SS  SS       
   249  257 C W  E     +I  261   0B  35  642   16                                  YW  WW    W     F        FY  FF       
   250  258 C G        -     0   0   36  645    5                                  gG  GG    G     G        GG  GG       
   251  259 C E  S    S-     0   0   61  627   89                                  aV  YI    E     R        NY  II       
   252  260 C G  S    S-     0   0   21  637   41                                  gG  GD    G     G        KG  GG       
   253  261 C d  S    S-     0   0   12  642    1                                  cC  CC    C     C        CC  CC       
   254  262 C D  S    S+     0   0   28  643   37                                  NA  AG    A     G        GA  GG       
   255  263 C R    >   -     0   0  128  645   82                                  QG  EQ    N     I        EK  KK       
   256  264 C D  T 3  S+     0   0   93  645   73                                  YK  KP    N     I        PP  AA       
   257  265 C G  T 3  S+     0   0   29  629   69                                  KN  DN    T     K        GK  KK       
   258  266 C K    <   -     0   0   90  639   88                                  KK  HR    F     N        YY  YY       
   259  267 C Y        -     0   0   14  641   48                                  PP  PP    P     P        PP  PP       
   260  268 C G  E     -G  210   0B   3  618   10                                  TG  GG    G     G        GG  GG       
   261  269 C F  E     -GI 209 249B   3  639   18                                  VV  VV    V     V        VI  II       
   262  270 C Y  E     -GI 208 247B   2  644    4                                  FY  YY    S     Y        YY  YY       
   263  271 C T  E     -GI 207 246B   2  644   35                                  TT  AT    A     S        TA  TT       
   264  272 C H  E  >  - I   0 245B  31  644   59                                  RQ  KN    A     F        RR  AA       
   265  273 C V  T >4 S+     0   0    0  643   15                                  VV  VI    V     L        VV  LL       
   266  274 C F  G >4 S+     0   0   39  642   74                                  ST  CS    S     s        TS  tt       
   267  275 C R  G 34 S+     0   0  132  642   86                                  SN  KV    P     k        RR  kk       
   268  276 C L  G  S+     0   0   57  641   79                                  LN  IF    T     L        LL  LL       
   270  278 C K  H  > S+     0   0  164  641   65                                  DK  PH    Q     K        SS  DD       
   271  279 C W  H  > S+     0   0   37  641    0                                  WW  WW    W     W        WW  WW       
   272  280 C I  H  X S+     0   0    1  641   10                                  II  LI    I     I        LI  II       
   273  281 C Q  H >X S+     0   0   79  605   76                                   A  QR    V     K        QN  KK       
   274  282 C K  H >X S+     0   0  135  595   73                                   Q  QR    D     K        Q   KK       
   275  283 C V  H 3< S+     0   0   15  570   82                                      TV    T     T        N   II       
   276  284 C I  H << S+     0   0   49  556   45                                      MM          M        I   TT       
   277  285 C D  H <<        0   0  114  506   74                                      AS          Q        T   AA       
   278  286 C Q     <        0   0  142  322   66                                      SH          S                     
## ALIGNMENTS 1051 - 1120
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  III IIIIVI IIIIIIIIVII IVIIVMVVIIVIIIIII    IMVV  IIII V IL II  II III
    30   38 B V  B     +A  221   0A  13 2209   20  VTV VVVVVV VVTVIVVMVVV TVVVVVVVVVVVVVVVV    VVVV  IVVV V TV IV  IV VVV
    31   39 B E  S    S+     0   0  131 2214   31  NGN GNGGGG GGGNGGGGNGN GGGGGGGGGNGNGGGGG    NGGG  GGGG G GG NG  GN GGG
    32   40 B G        -     0   0   30 2221    1  GGG GGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGG    GGGG  GGGG G GG GG  GG GGG
    33   41 B S  E     -B  184   0B  74 2221   88  ESE TEQVVH QQSFSTQVEYE SVQQEEEETTSEYDYTS    EQRR  SYYY A VQ MA  EE TAQ
    34   42 B D  E     -B  183   0B  99 2227   62  NSD DNDDDD DDSPNPDDDEN SDDDEDEEDDDNEETDE    DDEE  QTTP D EA DP  PN DDS
    35   43 B A        -     0   0    5 2227   45  AAA TAAAVA AAAAAASAVCA AVASAAAASAVACACTA    AAAA  ACCC A AA AA  AA AAA
    36   44 B E    >   -     0   0   41 2228   84  VAV QVVRRQ LPVTTESEKRV DRTSRLRREARVEVPRN    VLDD  DEPE K VL SQ  EV RRQ
    37   45 B I  T 3  S+     0   0   90 2237   79  PAP IPEQQL EEAAFPLEPKL APKLPEPPEIPLPPKQV    PEPP  TEKE S PP RR  ES DQP
    38   46 B G  T 3  S+     0   0   11 2241   60  GGG EGGGNG GGGGGKGGHNG GNGGNGNNGENGHGHGH    GGGG  GNHN G NG GG  YG GGG
    39   47 B M  S <  S+     0   0    7 2243   67  SQS SSHSSA QRQQRERKSSS QSQRSESSENSSSSSAS  E SEEE  ASLS A SS SE  AS ASS
    40   48 B S  S >  S+     0   0   11 2247   63  WWW WWWWWW WWWFWFWWWVW WWNWWWWWWYWWQWVWW  W WWVV  WLVV W IW WW  WW WWW
    41   49 B P  T 3  S+     0   0    5 2251    4  PPP PPPPPP PPPPPPPPPPP PPPPPPPPPPPPPPPPP  P PPPP  PPPP P PP PP  PP PPP
    42   50 B W  T 3  S+     0   0    2 2253   18  WWW WWWWWW WWWYWHWWWYW WWWWWWWWWFWWWWYWW  W WWFF  WYYY W YW WW  WW WWW
    43   51 B Q  E <   -J   59   0C   2 2256   32  QQQ QQQQQQ QQQQQMQQQQQ QQQQQQQQQVQQQQQQM  Q QQFF  QQQQ I QQ QQ  QQ QQQ
    44   52 B V  E     -JK  58  91C   0 2257   34  VVV VVVVVV VVVVIAVVIVV VIAVVVVVIVAVAVVVV  E VVAA  VVVV V VA VV  VV VVA
    45   53 B M  E     -JK  57  90C   0 2256   51  SSS SSSSSS SSSFSRSSSSS SSISSSSSSSSSSMSSS  S SSSS  SSSS S AF SS  AS DSS
    46   54 B L  E     -JK  56  89C   0 2257   14  LIL LLVLLL LLILLLLVLLL ILVLLILLLLLLLFLLV  L LIVV  LLLL L LL LI  ML ILL
    47   55 B F  E     -JK  54  88C   0 2256   82  qTQ QqRQQQ WRTrhgRRQNQ TQWRQQQQERQQNrNEQ  H QQeE  QNHN K Fp QH  FQ QQR
    48   56 B R  E   > -JK  53  87C  76 1547   74  rY. YrVYyv I.YfrrYVy.. HyIYyRyyF.y..y.F.  N .Rse  v... h il ..  .. MYL
    49   57 B K  T > 5S+     0   0   41  951   80  ..D N...gg .T.ans..n.D .g..n.nn.GgD.W...  . D.nn  g... i v. T.  KD ...
    50   58 B S  T 3 5S+     0   0   72 1192   73  ..K E...IV TE.GSN..G.S .S..G.GG.ASS.AD.N  . K.MM  D.D. P S. SE  NT G..
    51   59 B P  T 3 5S-     0   0   69 2030   82  SDT QSGDSG EKEGNKDRESS ENPDKNKKESSSAGGNS  F TNFF  ISGS G V. SG  GT TDN
    52   60 B Q  T < 5 +     0   0   62 2193   78  GGG .GEGFF DEGGYTGHWGG GWGGWGWWGGFGGDIGQ  N GGKK  LGIG T GP RS  EG NGG
    53   61 B E  E   < -J   48   0C  77 2221   95  FTF .FNIYK GGVATKTMRYF VYRTYAYYGGYFYYSSV  R FSYY  MSSY R TG FQ  FF GVG
    54   62 B L  E     +J   47   0C  17 2246   57  HHH HHHHHH HHHLHWHHHHH HHRHHHHHFHHHHQHHH  L HHKK  HHHH H GH HH  VH HHH
    55   63 B L  E     -     0   0C  17 2261   70  FAF TFVQTL IIVAHLLVTFF VTYLTFTTLSTFFFQIQ  T FFKK  VFQF L FH IV  YF VQT
    56   64 B b  E     -J   46   0C   1 2264    1  CCC CCCCCC CCCCCCCCCCC CCCCCCCCCCCCCCCCC  C CCCC  CCCC C CC CC  CC CCC
    57   65 B G  E     +J   45   0C   2 2264    3  GGG GGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGG  G GGGG  GGGG G GG GG  GG GGG
    58   66 B A  E     -J   44   0C   0 2264   13  GGG GGGGGG GGGGAGGGGGG GGGGGGGGGGGGGGGGG  G GGGG  GGGG G GG GG  AG GGG
    59   67 B S  E     -JL  43  67C   0 2264   40  SSS ISSSTS SSSSSTSSTSS SSSSSSSSSSTSSTSSS  S SSVV  ASSS S SA SS  SS SST
    60   68 B L  E     + L   0  66C   0 2264   10  LLL ILLILL LLLLLLLLLLL LLLLLLLLLILLLLLIL  L LLLL  LLLL L LL LL  LL LIL
    61   69 B I        -     0   0   23 2264   15  IVI IIVIII IIVILILIIII VIILIIIILLIIVIIII  F IIII  VIII I II II  II III
    62   70 B S  S    S-     0   0   32 2264   62  SSS NSSSSD HHSSNSSNSSS SDSSAAAATNDSNSSSN  S STSS  RSSS N AD SS  DN SSN
    63   71 B D  S    S+     0   0   61 2210   68  QEE PQDNDE EEENE.GSDSQ EKSGNPNNDDKQEDDDN  D EENN  DEDD A PD EA  PQ RDS
    64   72 B R  S    S+     0   0   80 2263   73  SQD RSRRLY VVQENKDQQSS QQNDSTSSSRQSNEQQL  R DRRR  RQQQ E QR NS  WY ERQ
    65   73 B W  E     - M   0 132C  12 2264   12  WWW WWWWWS WWWWWrWWWWW WWLWWWWWWWWWWWWWW  W WWWW  WWWW W TH WW  WW WWW
    66   74 B V  E     -LM  60 131C   0 2262   11  VVV IVIVVV VVVVVvVVVVV VVVVVVVVVIVVVAVIV  V VVVV  VVVV V VV VV  VV VIV
    67   75 B L  E     +LM  59 130C   0 2263   23  VLV VVLVIL LLLLILLLLVV LLVLLLLLLLLVVVLLV  V VLLL  LVLV L LI VI  ML LVL
    68   76 B T  E     - M   0 129C   0 2263   28  TST TTTSTT TTSTTTTTTST STTTTTTTTTTTSSSTS  S TTTT  TSSS T TT TS  TT SST
    69   77 B A    >   -     0   0    0 2262    2  AAA AAAAAA AAAAAAAAAAA AAAAAAAAAAAAAAAAA  A AAAA  AAAA A AA AA  AA AAA
    70   78 B A  G >> S+     0   0    0 2263    6  AAA AAAAAA AAAAAAAAAAA AAAAAAAAAAAAAAATA  A AAAA  AAAA A AA AA  AA AAA
    71   79 B H  G 34 S+     0   0   10 2264    3  HHH HHHHHH HHHHHHHHHHH HHHHHHHHHHHHHHHHH  H HHHH  HHHH H HH HH  HH HHH
    72   80 B b  G <4 S+     0   0    0 2264    1  CCC CCCCCC CCCCCCCCCCC CCCCCCCCCCCCCCCCC  F CCCC  CCCC C CC CC  CC CCC
    73   81 B L  T <4 S+     0   0    1 2264   68  NFG FNIFIA FFFIVLFIIYN FILFIFIIFVINYFYIH  F GFKK  TYYY F VA NF  VR FFF
    74   82 B L  E  <  +P   81   0D  46 2264   89  VPV PVKPGR RRPTNYPYSKV PSEPSSSSDDSVKHKEV  K VSMM  KKKK D DV VE  DV PPG
    75   83 B Y  E > > -P   80   0D  49 2249   82  SRR SSMESG RRSGESESSSS SSVESTSSSYSSSNRHV  S RNSS  ETRS P EI KT  RT KES
    76   84 B P  G > 5S+     0   0   52 2249   88  PET EPSRRH SPEVVPRrGRP ESLRSSSSMTRPPYRPF  N TTWW  ARKR I AP PT  CA PRP
    77   85 B P  G 3 5S+     0   0   75  844   90  G.S .G..TM .......g... ..........T.SGL..  N .SFF  ..L. R .. G.  N. S..
    78   86 B W  G < 5S-     0   0  166  852   93  R.H .R..YD .......D... ..........Y.RNQ..  P .EGG  ..Q. K .. I.  L. D..
    79   87 B D  T < 5 +     0   0  152  869   93  H.V .H..RP .......R... ..........R.LIV..  N .TTT  ..V. F .. H.  C. V..
    80   88 B K  E   < +P   75   0D  51  904   83  V.V .V..VY .......S... ..........V.ENR..  I .SLL  ..R. G .. F.  K. S..
    81   89 B N  E     +P   74   0D 110  936   80  V.V .V..YY .......V... ..........L.VHL.Y  W .LRR  ..L. V .. A.  P. S..
    82   90 B F        -     0   0   28 1017   94  V.A .VW.LW .......Y... ........N.L.RYGDG  T .YVV  ..G. V .. F.  E. Y..
    83   91 B T    >>  -     0   0   70 1164   86  LHG .LI.GR LLH....R... H.......V.G.LTELG  V .QVV  ..E. Y V. F.  A. H.I
    84   92 B E  G >4 S+     0   0   35 1455   85  GVE .GP.KV NNH.P..Q..G H.D.....S.KGGAHPG  Y .VLL  ..H. V G. G.  YG L.T
    85   93 B N  G 34 S+     0   0  127 1677   87  EKF .EL.HV PSK.KNNN..R K.vN.D..K.HREVnSQ  L .LGG  R.n. V Pt LS  Er Y.P
    86   94 B D  G <4 S+     0   0   49 1292   82  .E. ...NDI ..E.SGRTR.. ERsRRIRR.T....d.N  G S.DD  D.h. . .r .S  .. M.S
    87   95 B L  E <<  +K   48   0C   0 1493   89  .D. ...RLG SSA.EAVSQ.H ETVVTSTT.PNH..VGE  L H.EE  P.V. . VN .D  .. G.Q
    88   96 B L  E     -KN  47 108C   3 2025   51  .y. y.ffTL ffyVlvlLyiF yyIlyiyyylLF.VLcI  H LLLL  liLi . Lm .l  .. Ryw
    89   97 B V  E     -KN  46 107C   0 1516   29  .v. k.vv.H vvv.ivv.vvV vvVvvvvvai.V...v.  . V...  av.v . Vv .v  Fv .vv
    90   98 B R  E     -KN  45 106C   0 1577   87  .K. V.RL.D KKKRRRF.ARV KFIFGLGGYQ.V...RV  . V...  VR.R . IH .F  RI .LY
    91   99 B I  E     +KN  44 105C   0 1674   49  .L. I.LL.T VVLFILA.LLL LLLALLLLLV.L...LA  . A...  ML.L I LL .L  AL YML
    92  100 B G  S    S+     0   0    7 1756   23  .G. A.GG.S GGGEGGG.GGG GGGGGGGGGG.G.G.GG  . GG..  GG.G G GG .G  GG QGG
    93  101 B K        +     0   0   13 1789   76  .A. G.SS.R GGAIEEA.KEE AKAARARRVR.E.A.AL  . EA..  TE.E A AS .R  SE LSV
    94  102 B H        +     0   0   36 1883   76  YH. IYII.P LLHPLLV.HHY HHYVHLHHYA.YHH.YH  . FR..  NH.Y T HH .H  TH NIT
    95  103 B S  B     -Q  181   0E  21 1965   75  DQD SDQY.E TTQMDDA.NND QSKANKNNQD.DHD.QR  T DQ..  DN.N Q RQ .Q  SD GYD
    96  104 B R  S    S+     0   0   16 2018   82  RLQ IRLN.R LLLGLFR.LIR LLIRLLLLLIPRIR.LK  Q QL..  LI.I L VR HQ  LR INT
    97  105 B T  S    S+     0   0   31 2112   87  SDH LSDK.H SSDTTAT.VAS DSSTYQYYSSLSGD.YS  N GV..  TK.E T RT NS  TG NTG
    98  106 B R  S    S-     0   0   85 2151   87  SSA SSQP.T LLSIISS.EVS SQGSVQVVDRSSLS.VE  D SK..  RV.V K DV RW  KS KPS
    99  107 B Y        -     0   0   21 2204   90  GYN SGTV.V LTYNFDP.TNN YENPAPAALTSNNV.KV  L DP..  SL.Q P LK FP  DS FIS
   100  108 B E    >>  -     0   0   22 2250   66  ATE SASNAK EESFKKH.EEA SEHHEGEEDEEAEDEND  S AG..  PEEE G ED DN  TA EHT
   101  109 B R  T 34 S+     0   0  143 2252   78  EPE NEQASS PPENGDA.DGE ENKASPSSNDSEGSGPS  A EP..  YGGG P PD NR  DE VKN
   102  110 B N  T 34 S+     0   0  133 2255   82  PEN GPSNES HHDNPDV.ATP DGEVGHGGAEGPTTGHS  S DHNN  HNGN G TS AG  VP SNT
   103  111 B I  T <4 S+     0   0   58 2257   77  LAI VLVVGV SSAPKAQVAEL ASEQSASSVSSLEQEEV  T TANN  SEEE A QE AE  TL SVV
   104  112 B E     <  -     0   0    0 2258   77  QEQ PQNVGR TTKERQLIAQQ KVLLLLLLLVQQQTQMQ  V QMEE  RQQQ Q VV PQ  QQ QVS
   105  113 B K  E     -N   91   0C  69 2257   91  VVV VVHESE LLVVLPGPFFV VATGAYAARYAVFTFTR  V VYTT  NFFF L RH VA  KI VIS
   106  114 B I  E     -N   90   0C  11 2259   71  LRL ALRVII VVSMVEVIMIL SIVVVVVVGAILIVIVI  A LAII  IIII R VI QR  LI KAK
   107  115 B S  E     -N   89   0C  12 2260   84  STK KSVKAF AATGQDQKGNS TGPQSPSSVISSGGDKE  R KRPP  RNDN R SA WR  QN SEV
   108  116 B M  E     -N   88   0C  58 2260   71  IVI VIFTiV VVLTTfATTSV LAVAVVVVKEPVALAVI  S IVVV  IAAS I TV rI  VI VVL
   109  117 B L  E     +O  133   0C   6  452   51  ... ....p. ...S.v..... .................  V ....  .... . .. i.  .. ...
   110  118 B E  E    S+     0   0C  92 1908   74  SAA .S..E. RRKT.Q..AAS KGK.SKSS..ASSGEDE  N AKEE  TAEA K SE IK  SA .K.
   111  119 B K  E     -O  132   0C  92 2029   65  KQK .KK.K. NNDT.K..DKR DKR.KRKKNDRRHKKIE  R KRKK  DKKK K SD KQ  KR .TQ
   112  120 B I  E     -O  131   0C  20 2160   45  AVV .AIII. IIIFVIVIIVA IIIVIVIIIVIAVVIII  I VVII  IIII L II VI  IA .VI
   113  121 B Y  E     -O  130   0C  66 2224   50  IIF YIIVI. FFIIVIIFIII IIIIVKVVTVIIIFIYI  L FEYY  IIII V YC IL  II VVI
   114  122 B I  E     -O  129   0C  52 2228   82  TSK TTTYV. VVPISEYVVTT PVVYVSVVVIVTRVRIV  I KSVV  IRRR R IV TT  VT VYR
   115  123 B H    >   -     0   0   25 2247   20  HHN NHHHH. HYHHHHHHHHH HHHHHHHHHHHHNHHNH  H NNHH  PHHH H HH RH  HN PHH
   116  124 B P  T 3  S+     0   0  106 2258   50  PSP GPPSPH PPPPPPGPEPP PEPGKPKKPPEPPEPSE  E PPSS  PPPP K PP PY  PP DSP
   117  125 B R  T 3  S+     0   0  162 2261   76  SSK LSQSNS TTSNSDGKGRS SARGDEDDDGNSNSDER  R KLDD  DKEK N KG DA  DT GSN
   118  126 B Y    <   -     0   0   15 2261   15  WYF YWTYWE YYYYFYYFWYW YWYYWYWWYYWWYYYFY  Y FYFF  FYYY Y WF WY  FY YYY
   119  127 B N  B > > +R  125   0F  41 2262   68  NHn dNQldF LLLNDNlsnnN LnNlnqnnMndNnDNnq  n nqNN  INNn N sl dR  dN SlD
   120  128 B W  T 3 5 +     0   0   62 1485   76  ..l i.RvyR WW..RYr.fy. .f.rnmnnY.y.w....  s fmRR  MR.w . lk y.  d. .v.
   121  129 B R  T 3 5S+     0   0  192 1311   77  PQ. .P.a.I AEQP..pt..S Q.KpQAQQEa.S.TKpt  . .A..  ..K. K .S .D  YS MaS
   122  130 B E  T < 5S-     0   0  101 1657   80  NE. RNTN.Q DDENS.TI..T E.STISIIGD.T.SDGS  . .SQQ  EDD. N .A .A  YQ PNS
   123  131 B N  T   5S-     0   0    4 2142   69  TGT NTTiNT AAGNTtiV.NT GTDiSSSSSSNTDTTTS  S TSTT  TTTT D .G NP  NN QiT
   124  132 B L    > < +     0   0   25 1817   69  LSV .L.dIF SSSLLleViLM SIIeK.KK.YIMLLV.F  H V.LL  FLLL K lR L.  FF Ad.
   125  133 B D  B 3   +R  119   0F   7 2115   65  NQR DN.nRE SSQNEYnKRDN QRSnG.GGSIRNDDDSD  D N.EE  VDDD S RT Ne  DN Gnn
   126  134 B R  T 3  S-     0   0   43 2196   57  NGN NNArNN GGGNYNnNNNN GNAnNANNGDNNSNNGH  Y NANN  NNNN N NA Nd  NN Rrn
   127  135 B D    <   +     0   0    0 2261    0  DDD DDDDDD DDDDDDDDDDD DDDDDDDDDDDDDDDDD  D DDDD  DDDD D DD DD  DD DDD
   128  136 B I        +     0   0    0 2264   11  LII ILIIII IIIILIIIIIV IIIIIVIIIIIVIIIII  I IVII  IIII I II VI  II VII
   129  137 B A  E     -MO  68 114C   0 2263   48  TAT ATAAAA AAAGAAAAAMT AAAAAAAAAAATMAMAM  A TAAA  AMMM A AA AA  AT AAA
   130  138 B L  E     -MO  67 113C   0 2264    6  LLL LLLVLL LLLLLLLLLLL LLLLLLLLLLLLLLLLL  L LLLL  LLLL L LV LL  LL LVL
   131  139 B M  E     -MO  66 112C   0 2264   30  LLL ILLLIF VLLIILVLIIL LIIVLVLLILILIIILL  M LVLL  FIII L II LV  FL VLM
   132  140 B K  E     -MO  65 111C  19 2264   49  KRK KKKAKK QRQRRQHKKKK QKEHKEKKEKKKKKKKK  E KELL  RKKK Q RK KE  KK QAK
   133  141 B L  E     - O   0 109C   0 2264    8  LLL LLLLLL LLLLLLLLLLL LLLLLLLLLLLLLLLLL  L LLLL  LLLL L LL LL  ML LLL
   134  142 B K  S    S+     0   0  111 2264   73  ASA KAVAAY DDSAHDSQESA SETSAQAAERSASSKSA  S AEKK  KSKS S PR SL  RS STN
   135  143 B K  S    S-     0   0  171 2264   76  AST LASQSK TTRTKRSHSSS STQSNVNNEKTSKSSSQ  E TAEE  RSSS K SQ GS  ET TKS
   136  144 B P        -     0   0   73 2264   40  PPP PPRPPS PPPPPASPPPP PANSPPPPPPPPPPPPP  L PPPP  APPP P PK PP  pP PPS
   137  145 B V        -     0   0   11 2220   48  AVA LAVLVV ..IVVVLVVAA VVVLVVVVILVAAVAIV  V AVVV  VAAA V VV VV  lA VLV
   138  146 B A        -     0   0   75 2253   81  QTR TQTTQN LLTSTSPNTRQ NTPPSTSSVVTQTSIKE  S RTQQ  RVVV E VN QQ  TQ SQS
   139  147 B F        +     0   0   87 2257   43  YFF FYFFLY RQFFLFLFFLY FIFLLFLLFFFYLMLFF  F FFYY  YILI C LF LF  EM WFF
   140  148 B S        -     0   0   40 2259   60  TSS STTNSN PPSSQNTTSDT SGTTTTTTTTTTNSNTS  I STSS  NNNN N NT NT  DT TNN
   141  149 B D  S    S+     0   0   81 2262   69  KRE DKSEAD SSRQAVETDST RDKEDKDDPDDTSNSED  D QDRR  DASA A NE AD  YN DDN
   142  150 B Y  S    S+     0   0   81 2252   87  RYT SRSYSY QQYNNYYNTYR YTSYKYKKSQKRYYQYF  Y TYNN  YRQR Y AT YY  RR RYY
   143  151 B I        +     0   0    0 2256   24  IIV IIIIII FFIIVKIIIAI IIIIIIIIIVIIVVVIV  I VIII  IVVV T II II  VV III
   144  152 B H        -     0   0    4 2256   79  SRS KSLQTQ TSRQIHQYMRS RTLQQLQQQQSSQNSLS  Q SLQQ  QSSS Q QR SQ  NS QQQ
   145  153 B P        -     0   0    9 2256   44  PPP PPPPPP PPPPPPPPATP PPPPLPLPPPPPPSTPP  L APPP  PTTT V IP PP  TP PPP
   146  154 B V        -     0   0    1 2260   37  VIV AVIVAI VVIIIAVVAVV IAVVAVAAVVAVVVVIV  V VVII  IIVI A VV VV  IV VVV
   147  155 B a  B     -c  242   0B   3 2260   46  CCC CCCCCC CCCACCCCCSC CCCCCCCCCRCCACSCC  C CCCC  CSSS C SC RC  CC CCC
   148  156 B L        -     0   0   32 2260    9  VLL LVLLLL LLLLLLLILLL LLVLLLLLLLLLLLLLL  L LVLL  LLLL V LL LL  LL LLL
   149  157 B P        -     0   0    0 2259   30  APP PAPPPP PPPPPPPPPPA PPPPPPPPPPPAPPPPP  P PPRR  PPPP A AP AP  PA PPA
   150  158 B D     >  -     0   0   51 2255   78  SAA NSRAT  AQASDfASASS AESAPDPPSKDSTTRAG  P DDEE  FTRT D gE SA  TS DTD
   151  159 B R  H  > S+     0   0  148 1806   76  SAA .SI.S  AAAASdA.A.S AAAAAPAAQRSSRASSP  R EPPP  ..SA P tN S.  G. S.T
   152  160 B E  H  > S+     0   0  122 1873   75  NNT .NT.G  QQNDNGG.N.N NGSGGSGGDFGNCACPS  F ASGG  ..CC T SG T.  D. E.S
   153  161 B T  H  > S+     0   0   10 2003   82  EAD .EK.E  TAAREQQEF.E AYAQTVTTVFSEATAVN  Q DVEE  G.AV T NQ EA  M. L.S
   154  162 B A  H  X S+     0   0    7 2020   84  ASE .AQ.I  PPSTDGASV.A SVVAIVIIPEIAPPSTE  K DVDD  V.SA S SK VT  N. Q.S
   155  163 B A  H  < S+     0   0   70 2078   68  LFF YLLYL  LLFGLSLFL.L FLFLLFLLLILLATTFF  F FFDD  FTTA L FV LY  D. FYF
   156  164 B S  H  < S+     0   0   36 2215   78  PPP kPKgP  TTPEIEVPPST PPPVPKPPPDPTGGNST  P PESS  QPDG S ET PR  ES NgY
   157  165 B L  H  < S+     0   0    1  515   98  ... t..r.  ...T.N...C. .................  . ....  K... D .. ..  .S .r.
   158  166 B L     <  +     0   0   34  711   82  ... L..L.  ...F.F.V.A. .........V.......  . ..FF  LP.. L .. .F  FP .L.
   159  167 B Q  S >  S-     0   0   87  836   93  ... V.IV.  ...L.I.K.G. .........Q.......  Y ..YY  DA.. Q .. .A  VA .V.
   160  168 B A  T 3  S+     0   0   51 2039   74  ANP AAPDD  PPND.ADAHAE NHPDNSNNMEHETT.SE  P ATGG  QA.T N .S QC  IA GDN
   161  169 B G  T 3  S+     0   0   42 1713   37  GGG GG.GQ  GGG.G.GGNGG GNGGNGNNGSNG...GG  G GG..  NG.. . GG GD  GG GGG
   162  170 B Y    <   -     0   0   46 1826   85  LLL SLAQA  TTLAR.KTETL LAQKYMYYTNSL..ATM  K TMRR  TTA. . HS SR  QT TQT
   163  171 B K  E     -D  188   0B  33 2112   87  KQL RKSMP  VVHQT.VKSST HPSVPNPPMLPTMEQER  S LNHH  AEQQ . EE KL  DR QIS
   164  172 B G  E     -D  187   0B   0 2154   45  CCC LCCGC  CCCAA.CCCCC CCCCCCCCCVCCCCCCC  C CCGG  CCCC C AI CC  AC CGC
   165  173 B R  E     -DE 186 232B   3 2164   80  ATA WAWTY  WWTVY.TWYLV TYVTYWYYWTYVRVLWY  F AWTT  FLLL W RY VW  IV YTW
   166  174 B V  E     -DE 185 231B   0 2189   33  TVT VTVVV  VVVVV.VVVIT VVVVVVVVVLVTVVVIT  I TVVV  IIVI V VV TV  VT VVV
   167  175 B T  E     +D  184   0B   0 2202   48  TTT TTTTT  TTTSTITTTST TTTTTTTTTVTTTTSTT  S TTAA  SSSS A ST TT  TT TTT
   168  176 B G  E     -D  183   0B   1 2202    0  GGG GGGGG  GGGGGGGGGGG GGGGGGGGGGGGGGGGG  G GGGG  GGGG G GG GG  GG GGG
   169  177 B W  S    S+     0   0    1 2202    1  WWW WWWWW  WWWFWWWWWWW WWWWWWWWWWWWWWWWW  W WWWW  WWWW W WW WW  WW WWW
   170  178 B G  S    S-     0   0    0 2198    1  GGG GGGGG  GGGGGGGGGGG GGGGGGGGGGGGGGGGG  G GGGG  GGGG G GG GG  GG GGG
   171  179 B N        -     0   0   33 2021   77  RHK YRNNR  AAHRGQNKRNR HRDNRSRRNRRRNDNQN  K  SRR  RNNN    F RQ  TK DND
   172  180 B L  S    S+     0   0   55 1822   62  LVT TLVVL  TTVTL TLLTL VLITLPLLI LL   TT  L  PLL  TT T    T  V  LT VVT
   173  181 B K  S    S-     0   0  147 1551   78  SAK KSK    QHASH QV SS A EQQSQQK  S   GR  F  SGG  R  A    K  A   G QEV
   174  182 B E              0   0   49 1397   62  GPH EGD    EEPDE  P SG P   TETTE  G   SQ  E  EDD  E  S    D  Q   T E E
   175  183 B T              0   0  181 1202   57   SN N D      SAA  G S  S   N NNN      ES  G   SS  E  S    G  D   T G G
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66     P      P                                     T          D      P   
   178  186 C Q        -     0   0   64  328   73     A      P                                     A     S    T      A   
   179  187 C P        -     0   0    8  503   39     P      P           P                  P P    PP    P    P  SP  S   
   180  188 C S  S    S+     0   0   81  526   81     Y      R           S                  D E    TT    D    C  NN  N   
   181  189 C V  B    S-Q   95   0E  21  534   82     L      T           D                  K K    IQ    I    K  DQ  E   
   182  190 C L        -     0   0    5  625    5     L      L           L                 LL L    LL    L L  L  LL  L   
   183  191 C Q  E     -BD  34 168B   9  629   50     Q      Q           M                 KM Q    QK    Q R  Q  QY  R   
   184  192 C V  E     +BD  33 167B   6  628   86     E      E           C                 KA Q    EY    E G  Q  QQ  E   
   185  193 C V  E     - D   0 166B  15  634   49     V      V           V                 IV A    VI    A A  T  AV  A   
   186  194 C N  E     + D   0 165B   7  634   77     Q      Q           D                 ED A    ED    M M  A  VN  K   
   187  195 C L  E     - D   0 164B   0  638   34     V      V           V                 VV L    VL    V L  L  VV  V   
   188  196 C P  E     - D   0 163B  12  639   46     G      S           K                 PP P    DK    N P  P  GP  T   
   189  197 C I  E     -F  210   0B   9  640   33     I      L           L                 VV L    II    L I  L  LI  L   
   190  198 C V  E     -F  209   0B  10  641   39     I      I           I                 VI L    VV    I A  L  IV  I   
   191  199 C E    >>  -     0   0   75  641   66     N      D           S                 ES S    DG    D P  S  PS  N   
   192  200 C R  H 3> S+     0   0   86  640   78     T      V           P                 RT N    ER    L L  N  DQ  R   
   193  201 C P  H 3> S+     0   0   77  641   74     T      Q           Q                 RT A    KT    K E  Q  EE  S   
   194  202 C V  H <4 S+     0   0   41  641   84     M      T           D                 KT E    AQ    L K  Q  YA  I   
   195  203 C c  H >< S+     0   0    5  645    1     C      C           C                 CC C    CC    C C  C  CC  C   
   196  204 C K  H >< S+     0   0   91  645   74     N      N           T                 EN K    AS    N R  S  GE  N   
   197  205 C D  T 3< S+     0   0  141  645   80     Y      D           K                 KA K    SS    S E  E  SA  S   
   198  206 C S  T <  S+     0   0   15  645   87     L      L           V                 DG F    SA    S V  F  AA  R   
   199  207 C T    <   -     0   0   25  645   71     Y      Y           Y                 LS W    ET    R K  W  YY  V   
   200  208 C R  S    S+     0   0  249  645   89     t      s           K                 ra g    yy    w g  g  GG  v   
   201  209 C I  S    S-     0   0   56  565   53     d      p           D                 gg .    gg    g d  .  S.  g   
   202  210 C R        -     0   0  123  556   82     .      p           .                 eq k    ee    A y  k  ..  Q   
   203  211 C I        -     0   0   12  633   24     I      I           L                 LI I    II    I V  I  FS  I   
   204  212 C T    >   -     0   0   12  638   73     W      K           L                 HT T    KK    K F  T  KR  T   
   205  213 C D  T 3  S+     0   0   82  642   69     G      D           E                 SA D    KA    T T  D  AS  D   
   206  214 C N  T 3  S+     0   0   11  645   72     D      D           n                 SN V    TT    H n  S  nI  T   
   207  215 C M  E <   - G   0 263B   9  637   30     M      M           m                 FM M    MM    N m  M  mD  M   
   208  216 C F  E     - G   0 262B  19  643   34     V      V           L                 MV V    II    L I  I  IE  I   
   209  217 C c  E     -FG 190 261B   0  643    1     C      C           C                 CC C    CC    C C  C  CT  C   
   210  218 C A  E     +FG 189 260B   0  643   10     A      A           A                 AA A    AA    A A  A  AM  A   
   211  219 C G        -     0   0    4  643   18     G      G           G                 GG G    YA    G G  G  GI  G   
   212  220 C Y        -     0   0   31  452   71     D      Y           .                 .F A    ..    Y .  .  YC  K   
   213  221 C K     >  -     0   0   67  484   87     S      P           I                 .M S    ..    M .  .  QA  L   
   214  222 C P  T >4 S+     0   0   63  534   70     Q      E           P                 .A G    .A    Q .  A  AG  E   
   215  223 C D  T 34 S+     0   0  132  572   39     G      G           D                 GG V    .A    G G  A  GL  G   
   216  224 C E  T 34 S-     0   0   83  609   46     G      G           S                 EG S    .G    G E  G  GK  G   
   217  225 C G    <<  +     0   0   49  117   85     .      .           .                 .. .    S.    . .  .  .E  .   
   218  226 C K        -     0   0  124  137   84     .      .           .                 P. .    V.    . K  .  .G  .   
   219  227 C R        +     0   0   81  180   80     .      .           K                 G. .    N.    . G  .  .G  .   
   220  228 C G        +     0   0    3  583   68     K      K           K                 KK .    KK    I V  S  VK  V   
   221  229 C D  B     -A   30   0A  12  624   16     D      D           N                 DD .    DD    D D  S  DD  D   
   222  230 C A        +     0   0    9  640   48     S      S           A                 TS S    AS    T S  S  TS  A   
   223  231 C d    >>  -     0   0   13  644    1     C      C           C                 CC C    CC    C C  C  CC  C   
   224  232 C E  T 34 S+     0   0   95  644   57     F      Q           N                 KQ M    QQ    Q E  M  NQ  Q   
   225  233 C G  T 34 S+     0   0   20  645    8     G      G           G                 GG G    GG    G G  G  GG  G   
   226  234 C D  T X4  +     0   0    0  645    0     D      D           D                 DD D    DD    D D  D  DD  D   
   227  235 C S  T 3< S+     0   0   16  645    6     S      S           S                 GS S    SS    S S  S  SS  S   
   228  236 C G  T 3  S+     0   0    0  645    1     G      G           G                 GG G    GG    G G  G  GG  G   
   229  237 C G    <   -     0   0    0  645    4     G      G           G                 SG G    GG    G G  G  GG  G   
   230  238 C P  E     - H   0 246B   0  645    7     P      P           P                 PP P    PP    P A  P  PP  P   
   231  239 C F  E     -EH 166 245B   0  644   24     L      L           L                 LM L    LL    L F  L  LM  L   
   232  240 C V  E     -EH 165 243B   2  643   42     A      V           V                 VV V    VV    V A  V  MV  V   
   233  241 C M  E     - H   0 242B   0  643   64     C      C           C                 CC C    SS    C V  C  CV  T   
   234  242 C K  E     - H   0 241B  11  644   80     E      S           R                 PG Q    GS    K R  Q  EK  Q   
   235  243 C S     >  -     0   0    1  642   84     K      e           G                 IG K    NG    D v  N  GN  E   
   236  244 C P  T  4 S+     0   0   47  109   82     .      .           .                 E. .    ..    . n  .  ..  .   
   237  245 C F  T  4 S+     0   0  145  304   83     .      .           .                 T. .    ..    N E  .  A.  .   
   238  246 C N  T  4 S-     0   0   63  501   60     R      .           T                 e. D    K.    n e  G  DQ  N   
   239  247 C N     <  +     0   0   85  373   58     G      g           .                 d. G    ..    d l  N  GS  S   
   240  248 C R        -     0   0   59  432   80     V      F           .                 R. T    ..    Y K  I  RG  L   
   241  249 C W  E     - H   0 234B   1  442   42     W      W           .                 Y. W    ..    F F  W  WW  W   
   242  250 C Y  E     -cH 147 233B  19  521   85     I      F           .                 ML T    .L    W Y  K  HT  Y   
   243  251 C Q  E     + H   0 232B   0  638   57     Q      L           L                 QL L    LL    L V  L  LL  L   
   244  252 C M  E     +     0   0B   0  642   82     V      I           Q                 SH V    VV    V A  V  VV  V   
   245  253 C G  E     -IH 264 231B   0  645    0     G      G           G                 GG G    GG    G G  G  GG  G   
   246  254 C I  E     -IH 263 230B   0  645   23     I      I           L                 IV I    VV    V L  I  IV  D   
   247  255 C V  E     +I  262   0B   5  643   28     V      V           V                 VV V    VV    T V  V  TV  T   
   248  256 C S  E     -     0   0B   6  644    5     S      S           S                 AS S    SS    S S  S  SS  S   
   249  257 C W  E     +I  261   0B  35  642   16     W      W           W                 WW W    WW    W W  W  FW  W   
   250  258 C G        -     0   0   36  645    5     G      G           g                 GG G    GG    G G  G  GG  G   
   251  259 C E  S    S-     0   0   61  627   89     S      A           f                 IY S    RY    T .  S  DY  Q   
   252  260 C G  S    S-     0   0   21  637   41     G      G           P                 GG g    GG    G .  s  GG  G   
   253  261 C d  S    S-     0   0   12  642    1     C      C           C                 CC c    CC    C .  c  CC  C   
   254  262 C D  S    S+     0   0   28  643   37     G      G           G                 GA S    AA    A P  S  AA  A   
   255  263 C R    >   -     0   0  128  645   82     R      L           Q                 EQ T    KY    R Q  I  RA  V   
   256  264 C D  T 3  S+     0   0   93  645   73     P      P           P                 NP S    AA    M C  T  PE  R   
   257  265 C G  T 3  S+     0   0   29  629   69     N      N           N                 GN T    GN    R G  T  ND  N   
   258  266 C K    <   -     0   0   90  639   88     R      R           D                 TK P    YY    R T  P  KY  K   
   259  267 C Y        -     0   0   14  641   48     P      P           P                 PP A    PP    P Y  A  PY  P   
   260  268 C G  E     -G  210   0B   3  618   10     G      G           G                 GG .    GG    G G  .  GG  G   
   261  269 C F  E     -GI 209 249B   3  639   18     V      V           V                 VV V    VV    V I  V  VV  V   
   262  270 C Y  E     -GI 208 247B   2  644    4     Y      Y           Y                 YY Y    YY    Y Y  Y  YY  Y   
   263  271 C T  E     -GI 207 246B   2  644   35     T      T           T                 VA A    AA    T T  G  TS  G   
   264  272 C H  E  >  - I   0 245B  31  644   59     N      R           Q                 DR R    DD    S R  R  RD  N   
   265  273 C V  T >4 S+     0   0    0  643   15     V      V           V                 VV V    VV    T V  V  VV  V   
   266  274 C F  G >4 S+     0   0   39  642   74     S      S           C                 SA T    AA    Q Q  S  SS  T   
   267  275 C R  G 34 S+     0   0  132  642   86     R      A           K                 NS E    TA    H N  V  QY  F   
   268  276 C L  G  S+     0   0   57  641   79     F      S           T                 RR M    RR    Y I  R  IN  L   
   270  278 C K  H  > S+     0   0  164  641   65     N      D           K                 TS P    SS    E D  A  DP  G   
   271  279 C W  H  > S+     0   0   37  641    0     W      W           W                 WW W    WW    W W  W  FW  W   
   272  280 C I  H  X S+     0   0    1  641   10     I      I           I                 II V    VV    I I  A  II  I   
   273  281 C Q  H >X S+     0   0   79  605   76     R      Q           N                 DD E    E       T  D  NQ  S   
   274  282 C K  H >X S+     0   0  135  595   73     M      Q           D                 DQ E    K       K  K  SD  E   
   275  283 C V  H 3< S+     0   0   15  570   82     L      Q           T                 KT I    T       T  I  VT  Q   
   276  284 C I  H << S+     0   0   49  556   45     V      L           I                 IM L    A       I  M  VM  M   
   277  285 C D  H <<        0   0  114  506   74     A      P           K                 AA A    K       Q  A  GA  Q   
   278  286 C Q     <        0   0  142  322   66     R      S           K                    N    E       E  N  Q   K   
## ALIGNMENTS 1121 - 1190
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    7 A A              0   0  126   81   38                                                                        
     2    8 A D    >   +     0   0   69   86   15                                                                        
     3    9 A a  T 3   +     0   0   24   96    0                                                                        
     4   10 A G  T 3  S+     0   0    0   96    0                                                                        
     5   11 A L    <   -     0   0   36   96   65                                                                        
     6   12 A R    > > -     0   0    0   96    0                                                                        
     7   13 A P  T 3 5S+     0   0   15   96    0                                                                        
     8   14 A L  T 3 5S+     0   0   34   96    1                                                                        
     9   15 A F  T X >S+     0   0   14   96    0                                                                        
    10   16 A E  G > 5S+     0   0   27   96    0                                                                        
    11   17 A K  G 3 > S+     0   0   41   95   61                                                                        
    19   25 A E  H 3> S+     0   0    3   96    0                                                                        
    20   26 A R  H 3> S+     0   0  124   96   65                                                                        
    21   27 A E  H <> S+     0   0   37   96    4                                                                        
    22   28 A L  H  < S+     0   0    0   96    0                                                                        
    23   29 A L  H >< S+     0   0   40   96   12                                                                        
    24   30 A E  H >< S+     0   0  122   96   34                                                                        
    25   31 A S  T 3< S+     0   0   13   96    0                                                                        
    26   32 A Y  T <         0   0   26   96    0                                                                        
    27   33 A I    <         0   0  194   71   23                                                                        
    28      ! !              0   0    0   0     0  
    29   37 B I              0   0    0 2185   10  IIIVIIMIIIVII I IIIVVIIIVVVIIIIIIIV II III   VVIII IIIII IIII  IVMIII 
    30   38 B V  B     +A  221   0A  13 2209   20  VVVVVIVVVVVVV V VVMIIVVVVVVVVVTVVVV IV VVT   VVVVV IVVVV VVVV  VVLVVV 
    31   39 B E  S    S+     0   0  131 2214   31  GGGGGGGGGGNGG G GGGGNGGGNNNNGGSGGGG GG GGN   NGGGG GGGNG NGNN  GGGNGG 
    32   40 B G        -     0   0   30 2221    1  GGGGGGGGGGGGG G GGGGGGGGGGGGGGGGGGG GG GGG   GGGGG GGGGG GGGG  GGGGGG 
    33   41 B S  E     -B  184   0B  74 2221   88  EQEEEKQVVYEYY K TTAKVRTYVVVEVQYHKRV YY TQN   VKYYY RTREY DKEE  EQEEVS 
    34   42 B D  E     -B  183   0B  99 2227   62  SSDDDNNDNTEIE V TANDDEAQDDDDKVNSDDD EE PQK   DPEEE PDDEE DVEE  REEDES 
    35   43 B A        -     0   0    5 2227   45  AAAASSATACACC T AAAAAAACAAAAAATTATV CC AVA   AACCC AATAC AAAA  SAAAAV 
    36   44 B E    >   -     0   0   41 2228   84  LLGRSLLRTERET E QKEITKKKKKKVQLYGNSR KK ERS   KVKQK AGSVE TVNN  ETRITN 
    37   45 B I  T 3  S+     0   0   90 2237   79  SEEPLREQHEPEP H QHHPAAQAPPPPASPFPLP PA PSV   PLPAA RPLPA PPPP  PPPPPI 
    38   46 B G  T 3  S+     0   0   11 2241   60  GGGHGGGGGNHNY G GGGGHGNHHHHGGGGGGGN HY KNG   HGYHY GHGHH HGHH  NNNGHE 
    39   47 B M  S <  S+     0   0    7 2243   67  YYISKGESASSSS A GDEAAASSSSSSDAQTERS SS EKQ   SASSS RERSS SASS  GTSSSN 
    40   48 B S  S >  S+     0   0   11 2247   63  WWWWWWWWWVWVQ W WWWWWWWRWWWWCWFHFWW QQ FYF   WWQQQ WFWWQ WWWW  RWWWWF 
    41   49 B P  T 3  S+     0   0    5 2251    4  PPPPPPPPPPPPA P PPPPPPPPPPPPPPPPPPP PP PPP   PPPPP PPPPP PPPP  PPPPPG 
    42   50 B W  T 3  S+     0   0    2 2253   18  WWWWWWWWWYWYHWW WWWWWWWWWWWWYWWWHWW WH PWY   WWHHH WWWWW WWWW  FWWWHW 
    43   51 B Q  E <   -J   59   0C   2 2256   32  QQQQQQQQMQQQQNQ QQQQQLQQQQQQQMHQQQQ QQ MTQ   QIQQQ QQQQQ QMQQ  QQQQQQ 
    44   52 B V  E     -JK  58  91C   0 2257   34  AAVIVVVVVVVVVKV AAVIIAAVIIIVIVVAAVI AV AAV   IAVVV VAVVA IVVV  VVVVAV 
    45   53 B M  E     -JK  57  90C   0 2256   51  SSFSSSSSSSSSSAQ QQSASAQSSSSSSSAAVSS YS RQG   SASSS ASSSS SFSS  ASSSAS 
    46   54 B L  E     -JK  56  89C   0 2257   14  LLLLLLILLLLLLKI LLMLLILILLLLLILLLLL LL LLL   LLLLL VLLLL LLLL  LLLLLL 
    47   55 B F  E     -JK  54  88C   0 2256   82  HQKQRRQQqNQNNkG RRkkrYRNQQQQQqFiGRQ VN gvS   QGNNN lrRqN QHQQ  yqQQFf 
    48   56 B R  E   > -JK  53  87C  76 1547   74  RLmyYlRYy.y..hY ...rmV.Iyyy..fh.wYy .. r.l   yf... rfYyI .R..  rly.Ir 
    49   57 B K  T > 5S+     0   0   41  951   80  ..tn.s....g.... TTs.k.T.dddD.nrtk.g .. rrs   dr... ..... T.TT  tsnD.. 
    50   58 B S  T 3 5S+     0   0   72 1192   73  ..DN.S....S...K STS.G.T.GGGS.STKE.S .. NYA   GN... ..... SKSS  TGGK.. 
    51   59 B P  T 3 5S-     0   0   69 2030   82  NRGNDhND.ASSS.T TSS.DKS.EEETSRVKQDN DS NYL   QpSSS R.DT. TGTT  GRQTD. 
    52   60 B Q  T < 5 +     0   0   62 2193   78  GGRWGgGG.GFGG.M GGLGDGGGWWWGSRT.YGW NG TAS   WpGGG RSGGG GYGG  EWWGDM 
    53   61 B E  E   < -J   48   0C  77 2221   95  ASNYSRSVGYYYY.G YFPNYSFYRRRFSYE.DAY KY NRS   RLYYY ESAFY WGWW  LRYFMG 
    54   62 B L  E     +J   47   0C  17 2246   57  HHGHHLHHHHHHH.H PPHFHFHHHHHHHHYLFHH FH WLA   HWHHH PPHHH HHHH  GHHHYH 
    55   63 B L  E     -     0   0C  17 2261   70  TSSTLLFQFFTFFFI YYIIFRYYTTTFFAASSLT SF FFW   TKFFF FVLFF YLYY  FNTFFF 
    56   64 B b  E     -J   46   0C   1 2264    1  CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCC CC CCC   CCCCC CCCCC CCCC  CCCCCC 
    57   65 B G  E     +J   45   0C   2 2264    3  GGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG GG GGG   GGGGG GGGGG GGGG  GGGGGG 
    58   66 B A  E     -J   44   0C   0 2264   13  GGGGGAGGGGGGGAG GGGGGGSGGGGGGGGGGGG GG GGG   GGGGG GAGGA GGGG  GGGGGG 
    59   67 B S  E     -JL  43  67C   0 2264   40  TSSTSTSSSSSSSTS TSNSSASSSSSSSTSASSS SS TSS   SSSSS TTSSS STSS  ASSSSS 
    60   68 B L  E     + L   0  66C   0 2264   10  LLLLILLILLILLLI LLVLLLLLLLLLILLLLLL LL LLL   LLLLL LILLL ILLL  LLLLLI 
    61   69 B I        -     0   0   23 2264   15  IIIIILIIIIIIVIV IIIVIIIIIIIILLIVILI IV III   IIVVV VLLII VILL  LVIIII 
    62   70 B S  S    S-     0   0   32 2264   62  NNSASSTSNSASNTN HASSDAHNAAASDNSSSSD NN SNS   ASNSN SNSNN NSNN  SAASSS 
    63   71 B D  S    S+     0   0   61 2210   68  TNDSNSDDNDEEENS PPPSSRPDAAAEESRNDGK NE .DS   A.EEE ADGED NSEE  PNNESD 
    64   72 B R  S    S+     0   0   80 2263   73  QQVNRCRRQQNQNRQ EQWTEDQQNNNDYHSRRDQ RN HRT   NSNSN GRDNQ EREE  ENSDEE 
    65   73 B W  E     - M   0 132C  12 2264   12  WWWWWWWWWWWWWWW WWWWWWWWWWWWWWYWFWW WW rYW   WrWWW WWWWW WWWW  WWWWWW 
    66   74 B V  E     -LM  60 131C   0 2262   11  VVVVIVVIVVVVVLI VIVVVVIIVVVVIVVVVVV VV vVV   VvVVV VVVVI VVVV  VVVVVV 
    67   75 B L  E     +LM  59 130C   0 2263   23  LLLLVLLVLVMVVIV LLLVLVLVMMMVLLLVLLL VV LLL   MLVVV LVLVI VLVV  ILLVLL 
    68   76 B T  E     - M   0 129C   0 2263   28  TSTTTTTSTSTSSTT TTTTTTTSTTTTTTTTTTT SS TTT   TTSSS TTTTS TTTT  TTTTTT 
    69   77 B A    >   -     0   0    0 2262    2  AAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAA AA AAA   AAAAA AAAAA AAAA  AAAAAA 
    70   78 B A  G >> S+     0   0    0 2263    6  AAAAAAAAAAAGAAA TTAAAATAAAAAAAAAAAA AA AAA   AAAAA AAAAA AAAA  AAAAAA 
    71   79 B H  G 34 S+     0   0   10 2264    3  HHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHH HH HHH   HHHHH HHHHH HHHH  HHHHHH 
    72   80 B b  G <4 S+     0   0    0 2264    1  CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCC CC CCC   CCCCC CCCCC CCCC  CCCCCC 
    73   81 B L  T <4 S+     0   0    1 2264   68  FFLIFFFFIYIYYVV LVVVVFVWIIIGVFTVLFI TY LVT   IAYYY VIFNW DLDD  LLIGMV 
    74   82 B L  E  <  +P   81   0D  46 2264   89  RADSPKSPVKSKKYT KEQAAYEQNNNVNSKAKPS FK YYD   NEKTK RRPVI PTPP  FSSVDF 
    75   83 B Y  E > > -P   80   0D  49 2249   82  SGSSERNEDSSSSGT GRDRGYQNTTTTGHSTRES SS SGG   TISSS RYEKN TGSS  HNSKGD 
    76   84 B P  G > 5S+     0   0   52 2249   88  ISLSRYTRQRGARTK EKESIDTPKKQTQRETGRS RR ENI   KNRRR RRRtP IRII  NYSTAL 
    77   85 B P  G 3 5S+     0   0   75  844   90  .........I.I.MP TQRSRGSY....SN....R N. ...   ...V. ..... STS.  G..S.F 
    78   86 B W  G < 5S-     0   0  166  852   93  .........Q.N.MP AAANNKAT....AK....T K. ...   ...E. ..... SAG.  X..D.S 
    79   87 B D  T < 5 +     0   0  152  869   93  .........V.S.PG SSSPPISQ....KFD...Y L. ...   ...V. ..... DDD.  E..V.P 
    80   88 B K  E   < +P   75   0D  51  904   83  .........R.K.SA RSNARVSL....KYN...R S. ...   ...R. ..... YEY.  V..V.K 
    81   89 B N  E     +P   74   0D 110  936   80  .........L.L.LS VIIQRPIA....LQY...V V. ...   ...L. ..... VIV.  N..V.Q 
    82   90 B F        -     0   0   28 1017   94  .SF......G.S.IR HVKYYSVI....SWV...F H. ...   ...G. ..... INI.  H..A.Y 
    83   91 B T    >>  -     0   0   70 1164   86  TVY.....TE.G.KY IILQSDIL....IRI...L L. ...   ...E. ..... LVL.  V..G.A 
    84   92 B E  G >4 S+     0   0   35 1455   85  HPP..gS.PY.R.VT RRTIVIRG....RLNP..G G. ...   ...H. ..... GYG.  QQ.E.V 
    85   93 B N  G 34 S+     0   0  127 1677   87  SST..rE.Sn.g.RM LLMIYLLD....NVPN.NK R. NR.   ...D. ..N.. ELES  At.F.R 
    86   94 B D  G <4 S+     0   0   49 1292   82  RSSNN.T.SdRe.LY ..GV.V.....SN.RS.RH .. GDQ   ..... .HR.. .G.G  Ir.... 
    87   95 B L  E <<  +K   48   0C   0 1493   89  IWSTRNS.IVNY.GA ..EG.R.....DT.RN.VS .. AQS   .E... .YV.. .K.D  LVG.G. 
    88   96 B L  E     -KN  47 108C   3 2025   51  LMVylylyILyhvKF ..WEVL..fffVLlllllL .v viv   llv.v lfl.f .H.Y  GLi.f. 
    89   97 B V  E     -KN  46 107C   0 1516   29  MVVvvvvvV.vvv.. ........vvvV.evvev. .v vvv   vvv.v vvvva ...V  ..v.v. 
    90   98 B R  E     -KN  45 106C   0 1577   87  YYYVFRLLY.LRR.. ........LFFV.VSRIF. .R RRY   FRR.R LLFII ...I  ..M.V. 
    91   99 B I  E     +KN  44 105C   0 1674   49  LLLLMVLML.VLM.. .G......VVVA.IMLVA. .L LLL   VIL.L AVAIL ...L  .LL.L. 
    92  100 B G  S    S+     0   0    7 1756   23  GGGGGGGGG.GGG.S GA..GGG.GGGG.YGGRG. .G GLG   GGG.G GGGGG ...G  AGG.G. 
    93  101 B K        +     0   0   13 1789   76  RWAKSDVSK.KEE.E AR..AEA.KKKE.GSELA. .E EQA   KDE.E EKAED ...E  HAQ.A. 
    94  102 B H        +     0   0   36 1883   76  LLYYIYLIW.HHHHH HR.HHHHHHHHF.NHWGV. HH LLT   HLH.H HNVHH H.HH  SHH.H. 
    95  103 B S  B     -Q  181   0E  21 1965   75  TKQNHHQYR.DNHIQ RRRNEDKHNNND.NNDVA. SN DDV   NNN.N SHADH NHDD  LSNDNV 
    96  104 B R  S    S+     0   0   16 2018   82  QLLLMTLNS.LIIRL RVLRLRRILLLQ.MRVNQ. LI FRR   LLIII LLQRI KEKK  YLLQIG 
    97  105 B T  S    S+     0   0   31 2112   87  VSDKSLATY.SERQY TAFNDTTWVVVG.ARRDAS QK AST   LVQYK HDASW GDGG  DSYGRS 
    98  106 B R  S    S-     0   0   85 2151   87  GLKESVRPV.VVVKQ KTNVGLSEEEELKLLDISQ TV SSS   ERVRV RRSSQ GTSS  RNVSQS 
    99  107 B Y        -     0   0   21 2204   90  SAASRPPIA.NLNIL GVVNTENNEEEQHKAQSPE NT DSP   ENTST RIPNH GSAA  YPADNL 
   100  108 B E    >>  -     0   0   22 2250   66  NSGEGEGHDEEEEED SGDETEIEEEETAPGEDHE EE QDE   EDEEE EEHAE TDGG  EGEEEH 
   101  109 B R  T 34 S+     0   0  143 2252   78  PTSPLEPKVGEGGKG GTGVQGGGAAAESPPEEGN NG DPV   PDGGG GSGEG EPEE  NASEAN 
   102  110 B N  T 34 S+     0   0  133 2255   82  NNHGVFHNNNGNTTS NETTVSTTGGGDGANRYLG TS DGS   AGSTS STLDT SMDD  GGGNSK 
   103  111 B I  T <4 S+     0   0   58 2257   77  EGQSQEAVSESEEEE EKEEEEEESSSTGQVLEQS GE AIH   SAEEE EEQIE IEII  RSSIQG 
   104  112 B E     <  -     0   0    0 2258   77  VVVASEVVIQQQQQQ QDQEEQQQKKKQEEQNNLV QQ EVT   QHQQQ QQLQQ QQQQ  RALQVG 
   105  113 B K  E     -N   91   0C  69 2257   91  SANAVEYTSFTFFSN DYVTKNDFAAAVKRQHFGA KF PRV   APFFF ESGVY SRRR  VAAVSF 
   106  114 B I  E     -N   90   0C  11 2259   71  RKRIQIAARIIIIYI FIILIVIMIIILIFHEVVI II EKA   IVIII VYVMM VFVV  VVVLII 
   107  115 B S  E     -N   89   0C  12 2260   84  SSTRTRRETNSNSDP RVPNSRKSVVVKQVSEEQG KS DVS   LQSDS RSQRS RTRR  NQSKTH 
   108  116 B M  E     -N   88   0C  58 2260   71  VVIAVVVVISAASAI VTVVIAVVPPPIVEVyiAA VS fVS   PiSSS VVAIV IAII  VVVISK 
   109  117 B L  E     +O  133   0C   6  452   51  ............... ...............iv.. .. v..   .i... ..... ....  .....I 
   110  118 B E  E    S+     0   0C  92 1908   74  QQAA.EKKRAQASEE I.EKSSSDEEEGA..EE.G ES Q..   EESSS SS.GD SKSS  NSSATA 
   111  119 B K  E     -O  132   0C  92 2029   65  QQDK.ERTHKKKRMG RKRKKNKAKKKKEK.RQ.K KR KRN   KSRRR RA.KA KKQQ  EKKQDK 
   112  120 B I  E     -O  131   0C  20 2160   45  IIVI.IVVIVIIVYI LVIVILVIIIIVIIYKAVI IV ITI   MKVVV TIVVI KIKK  LLIVFV 
   113  121 B Y  E     -O  130   0C  66 2224   50  FIVVVVEVIIIIIKV VIIIYVIYVVVFYVEEIVI II ITI   IIIII VIVFY IILL  VVVFFY 
   114  122 B I  E     -O  129   0C  52 2228   82  VVIVYTSYPRVRRIV TTSASLLWVVVKQIIVRYV PR EII   VIRRR LVYKW CLCC  IVVKTI 
   115  123 B H    >   -     0   0   25 2247   20  HHHHHHNHHHHHHHH HHHHHHHHHHHNHHHHHHH FH YHH   HHHHH HHHHH HHHH  HHHNHH 
   116  124 B P  T 3  S+     0   0  106 2258   50  PPSESRPSPPEPPPP PPAPEPPQEEEPEESPPGE PP PPS   EPPPP PPGPQ QEAA  PQKPEP 
   117  125 B R  T 3  S+     0   0  162 2261   76  GSKNGLQSSNKKNHS NSNQKLSSKKKKNRVSSGA KN GKG   KDNNN DKGRS QGQQ  DRDKND 
   118  126 B Y    <   -     0   0   15 2261   15  YYYWYYYYYYWYYYY YYYYYAYYWWWFYYTYHYW YY YYW   WYYYY YFYYY YFYY  YWWFWY 
   119  127 B N  B > > +R  125   0F  41 2262   68  dNTnqRqlsnnnnSN HHSnsNGDnnnsdnsSNln ns NDN   nisns DDlnN NDDD  EnnnnD 
   120  128 B W  T 3 5 +     0   0   62 1485   76  i.Iyi.mviwfrw.. RKYrl.KYffflmre.Yrf ry Y..   f.ywy ..ryY ....  .qqfw. 
   121  129 B R  T 3 5S+     0   0  192 1311   77  .PP.pPAa.....P. PP...KP......EWPKp. .. .PS   .g... PPp.. SLSS  PNV..E 
   122  130 B E  T < 5S-     0   0  101 1657   80  .TT.NhSNT.V..D. VKN..NVRVVV..EASRN. .. .TN   VV... EDN.Q NPNN  TVS..V 
   123  131 B N  T   5S-     0   0    4 2142   69  TTK.vnSiKIATNSD GTT..GTTAAATTRGDSsT PN tRT   ATNDN TSsTT TSTT  TGKT.S 
   124  132 B L    > < +     0   0   25 1817   69  .F.id..d.LLLIYL YYVLLLLLFFFVI.LF.eI HI lIL   L.ILI VVeIM IYII  FN.VlY 
   125  133 B D  B 3   +R  119   0F   7 2115   65  qNGWnD.nDDGDDDD ASDSTDADGGGRD.RRYnR ND YIK   GKDDD DDnND DRDD  TGGRTD 
   126  134 B R  T 3  S-     0   0   43 2196   57  nNYNnYArNNNNNSY NHYNSFHYNNNNNNNNNnN NN HNN   NHNNN MYnNH YNYY  NYNNNN 
   127  135 B D    <   +     0   0    0 2261    0  DDDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDD DD DDD   DDDDD DDDDD DDDD  DDDDDD 
   128  136 B I        +     0   0    0 2264   11  IVIIIIVIIIIIIII IIYIVVIIIIIIVIIIIII II IVI   IIIII LVIII IVII  IIIIIV 
   129  137 B A  E     -MO  68 114C   0 2263   48  TAAAAAAAAMALMAA AAAAAAAMAAATAAAAAAA MM AAS   AAMMM AAALM CACC  AAATAA 
   130  138 B L  E     -MO  67 113C   0 2264    6  LLLLVLLVLLLLLLL LLLLLLLLLLLLLLLLLLL LL LLL   LILLL LLLLL LLLL  LLLLLV 
   131  139 B M  E     -MO  66 112C   0 2264   30  LLVVIVVLLIIIIIL LLLIIILMIIILIVLVVVI II LLI   ILIII LIVIM LILL  VILLIL 
   132  140 B K  E     -MO  65 111C  19 2264   49  RKKKARESQKKKKRK KKKEKQKKKKKKKKEKKHK KK QRK   KKKKK RLHKK KKKK  KKKKKK 
   133  141 B L  E     - O   0 109C   0 2264    8  LLLLLLLLLLLLLLL LLLLLLLLLLLLLVLLMLL LL LLI   LLLLL LLLLL LLLL  LLLLLV 
   134  142 B K  S    S+     0   0  111 2264   73  SSDQSQETTSASSAR DDTASKEASSSAKTTDASE KS DEP   SVSSS RSSAA APAA  AAAAPE 
   135  143 B K  S    S-     0   0  171 2264   76  SSRTAGAKSSESKQQ RKRSKGKHEEETTPSRKST KK RSA   EEKKK SKSSH TRTT  NSNTSK 
   136  144 B P        -     0   0   73 2264   40  SSPPPpPPTPPPPPP PPPPAGSPSSSPpPSKPPA PP APV   PEPPP PpPPP PRPP  VPPPPr 
   137  145 B V        -     0   0   11 2220   48  VVVVLaVLVAVAAVI AVLAVVAVVVVAtVVVVLV VA VV.   VVAAA LfLAV AAVV  VVVAVr 
   138  146 B A        -     0   0   75 2253   81  SSPTTRTQQVTVTTT KLNKSKTTPPPQLSGVIPT TT KPA   TPTTT PAPQT VMQQ  QTSQSL 
   139  147 B F        +     0   0   87 2257   43  FFLIFLFFYLLILFF LYFLLLVVLLLFDCYFFLI FL FLF   LFLLL MKLML FLMM  LLLFLN 
   140  148 B S        -     0   0   40 2259   60  NTSSSSTTTNSNNTN DTTSSTNNTTTSQGSRSTG NN STS   SSNNN GYTNN SNSS  TSTSNG 
   141  149 B D  S    S+     0   0   81 2262   69  NSRDDSNDDADSQDA RKQSKANEDDDETSDQKED KT VGS   NETST ASEMK DEND  DKDESK 
   142  150 B Y  S    S+     0   0   81 2252   87  YYFTYHYYYRTRYYY YNYRHYNYHHHTNFYHTYT YY YNK   QYYYY FYYRF KITT  MNKTNS 
   143  151 B I        +     0   0    0 2256   24  IIIIIIIIIVIVVVV VIVVVVVVVVVVAIIIIII VV KMI   VVVVV VLIVV VAVV  VIIVIV 
   144  152 B H        -     0   0    4 2256   79  QQQMQLLQKAQSKKS NHQNNRHKQQQSKGQLRQT KQ HRQ   QYQRQ ARQSQ HNHH  NQQSKR 
   145  153 B P        -     0   0    9 2256   44  PPTPPPPPPTLATPQ FPPPTTTPLLLAPPPPPPP PP PPV   LPPPP PPPPP PLPP  TTLATT 
   146  154 B V        -     0   0    1 2260   37  VVVAVAVVIIGIVIV AVVVVVVVGGGVVAIVAVA IV AVA   AIVVV AVVVI VVVV  IAAVVV 
   147  155 B a  B     -c  242   0B   3 2260   46  CCPCCCCCCSCSACC CCCCCCCACCCCPCCCCCC RA CCK   CCAAA CCCCA CCCC  QCCCKK 
   148  156 B L        -     0   0   32 2260    9  LLLLLLVLLLVLLLL LLLLLLLLIIILLLLLLLL LL LLL   ILLLL LLLVL MLLL  LLLLLL 
   149  157 B P        -     0   0    0 2259   30  AAAPPPPPAPPPPPP PPPPPPPPPPPPPPNPWPP PP PPP   PPPPP PPPAP APAA  PPPPPV 
   150  158 B D     >  -     0   0   51 2255   78  DDEDARDTDRATSSQ DEDPSQFKPPPSARSPTAE KS fDA   AVTTS EYAEK NDAa  YPPNSD 
   151  159 B R  H  > S+     0   0  148 1806   76  SSPA..P.EAPA.AA QLSHGPNAAAAAQF.KEAA K. dVI   A..G. P.ATA SGSd  RAAVSE 
   152  160 B E  H  > S+     0   0  122 1873   75  SGSG..S.NCGP.AA VDDGLTGCEEEDGK.QSGG C. GNA   GE.C. G.GGC GNGD  NGGDDD 
   153  161 B T  H  > S+     0   0   10 2003   82  SSDV..V.SADP.SL PPFYS PPTTTEST.TQQY P. DHS   TD.A. D.QDP DMDA  ITTDVH 
   154  162 B A  H  X S+     0   0    7 2020   84  SSLI..V.NAVA.DL EEPKS ARVVVDDG.KKAV S. RNS   LN.S. TSANK DADS  SIIDAE 
   155  163 B A  H  < S+     0   0   70 2078   68  FFFLLWFYFPLA.YA PPALD PALLLFVPLLKLL V. SFY   LL.A. LFLFA AAAF  SLLFVV 
   156  164 B S  H  < S+     0   0   36 2215   78  YYTPskEgPGPGSAG KVGPE SGSSSPKPEVvVP GS EDS   PrSGS VEVPG SSSP  FPPPGD 
   157  165 B L  H  < S+     0   0    1  515   98  ....sr.r....CQ. ..... ..NNN.....s.. .C N..   NnC.C ..... ....  ....T. 
   158  166 B L     <  +     0   0   34  711   82  ....LP.L....AL. ..... ..LLL..TV.V.. .A F.T   LNA.A .N... F.F.  N...T. 
   159  167 B Q  S >  S-     0   0   87  836   93  ...NIQ.I....PQ. ....A ..YYY..VS.I.. .P I.Y   YFP.P .F... PRP.  F...V. 
   160  168 B A  T 3  S+     0   0   51 2039   74  TTSRDkSDRTNTAAT EDTAp D.PPPAVPG.ADH EA A.A   PEATA PTDGE AQAA  ARNPTD 
   161  169 B G  T 3  S+     0   0   42 1713   37  GGR.GaGGG.N.GN. GG.Gg C....GG.RG.GN .G .GG   .RG.G GSGG. GDGG  GNNG.G 
   162  170 B Y    <   -     0   0   46 1826   85  TTSAKHMQT.Y.TV. DK.SS TD...MDQDK.KA .T .KS   .YT.T ALKM. MGTT  AYYT.A 
   163  171 B K  E     -D  188   0B  33 2112   87  SSDPVNNVNQPEMSP RHLRK HM...LKSSM.IP KM .TT   .YMMM MPIKM RSRR  GVPV.Q 
   164  172 B G  E     -D  187   0B   0 2154   45  CCCCCCCGSCCSCGC CCCCC CCCCCCICGA.CC CC .AV   CPCCC ACCCC CCCC  GCCC.L 
   165  173 B R  E     -DE 186 232B   3 2164   80  WWWYMYWTWLYLKTY YWYFF WMYYYARWMT.TY LT .TV   YFTRT TITVV YVMM  TYYA.T 
   166  174 B V  E     -DE 185 231B   0 2189   33  VVVVVVVVVIIIVIV IVVII IVIIITVVVV.VV VV .VA   IVVVV IAVTV TTVV  VVVTPV 
   167  175 B T  E     +D  184   0B   0 2202   48  TTTTTTTTASSSSSS TTTTT TSTTTTSTVATTT SS IAS   TASSS LTTTS STSS  STTTTT 
   168  176 B G  E     -D  183   0B   1 2202    0  GGGGGGGGGGGGGGG GGGGG GGGGGGGGGGGGG GG GGG   GGGGG GGGGG GGGG  GGGGGG 
   169  177 B W  S    S+     0   0    1 2202    1  WYWWWWWWWWWWWWW WWWWW WWWWWWWWWWFWW WW WWW   WWWWW WWWWW WWWW  WWWWWW 
   170  178 B G  S    S-     0   0    0 2198    1  GGGGGGGGGGGGGGG GGGGG GGGGGGGGGGGGG GG GGG   GGGGG GGGGG GGGG  GGGGGG 
   171  179 B N        -     0   0   33 2021   77  YTRRNDSNDNRNNKR KRSKR HNRRRKY RR NR RN HLR   RSNNN K N N KDVL  ILRKRK 
   172  180 B L  S    S+     0   0   55 1822   62  TTVLITPVI L T I LL IM LILLLTL TT TL  T  VT   LLT T L T I T LL  ALLT L 
   173  181 B K  S    S-     0   0  147 1551   78  AAQ KGSE  S M G SS KV A    KQ ER Q   M  KS    AM M N Q   S RR  AQQK S 
   174  182 B E              0   0   49 1397   62  EEQ  PE   T S E SS HA S     E DH     S  ED    HS S       A SS  ETT  E 
   175  183 B T              0   0  181 1202   57  GGN  A    G S S  G PG G     G GG     S  GS     S S       S NN  GNN  S 
   176      ! !              0   0    0   0     0  
   177  185 C G              0   0   72  263   66                                     T      STT                G        
   178  186 C Q        -     0   0   64  328   73                                     G      TGG                D        
   179  187 C P        -     0   0    8  503   39                                     T  P   VTT           S    D       P
   180  188 C S  S    S+     0   0   81  526   81                                     S  S   ESS     T     N    HD      N
   181  189 C V  B    S-Q   95   0E  21  534   82                                     V  D   TVV     T     V    QR      K
   182  190 C L        -     0   0    5  625    5                 L                   L  L   LLL     L     L    LL      L
   183  191 C Q  E     -BD  34 168B   9  629   50                 L                   H  M   QHH     Q     K    KQ      Q
   184  192 C V  E     +BD  33 167B   6  628   86                 Q                   K  C   LKK     H     S    QE      T
   185  193 C V  E     - D   0 166B  15  634   49                 V                   A  V   IAA     V     A    AV      V
   186  194 C N  E     + D   0 165B   7  634   77                 T                   T  D   HTT     N     N    RS      D
   187  195 C L  E     - D   0 164B   0  638   34                 V                   V  V   LVV     S     V    VV      K
   188  196 C P  E     - D   0 163B  12  639   46                 P                   P  K   QPP     T     T    PY      P
   189  197 C I  E     -F  210   0B   9  640   33                 I                   I  L   TII     A     V    LT      I
   190  198 C V  E     -F  209   0B  10  641   39                 V                   I  I   VII     V     I    VI      V
   191  199 C E    >>  -     0   0   75  641   66                 S                   P  S   EPP     S     D    SY      P
   192  200 C R  H 3> S+     0   0   86  640   78                 N                   M  P   LMM     F     R    NQ      Y
   193  201 C P  H 3> S+     0   0   77  641   74                 E                   Q  Q   RQQ     A     R    DS      P
   194  202 C V  H <4 S+     0   0   41  641   84                 E                   N  D   KNN     T     K    DV      E
   195  203 C c  H >< S+     0   0    5  645    1                 C                   C  C   CCC     C     C    CC      C
   196  204 C K  H >< S+     0   0   91  645   74                 K                   R  T   RRR     A     N    NN      E
   197  205 C D  T 3< S+     0   0  141  645   80                 R                   K  K   KKK     R     S    AG      K
   198  206 C S  T <  S+     0   0   15  645   87                 A                   V  V   FVV     Q     P    AP      A
   199  207 C T    <   -     0   0   25  645   71                 S                   Y  Y   YYY     Y     E    ND      L
   200  208 C R  S    S+     0   0  249  645   89                 i                   y  K   Gyy     R     y    sa      g
   201  209 C I  S    S-     0   0   56  565   53                 t                   t  D   ett     g     n    dd      g
   202  210 C R        -     0   0  123  556   82                 .                   .  .   r..     n     p    el      p
   203  211 C I        -     0   0   12  633   24                 .                   I  L   III     I     I    IV      L
   204  212 C T    >   -     0   0   12  638   73                 Y                   T  L   TTT     D     I    TS      H
   205  213 C D  T 3  S+     0   0   82  642   69                 D                   K  E   LKK     R     N    EP      P
   206  214 C N  T 3  S+     0   0   11  645   72                 s                   N  n   SNN     d     y    FK      T
   207  215 C M  E <   - G   0 263B   9  637   30                 t                   M  m   MMM     m     m    ME      N
   208  216 C F  E     - G   0 262B  19  643   34                 F                   F  L   LFF     L     L    MF      L
   209  217 C c  E     -FG 190 261B   0  643    1                 C                   C  C   CCC     C     C    CC      C
   210  218 C A  E     +FG 189 260B   0  643   10                 A                   A  A   AAA     A     A    AA      T
   211  219 C G        -     0   0    4  643   18                 G                   G  G   AGG     G     G    GG      G
   212  220 C Y        -     0   0   31  452   71                 F                   H  .   .HH     T     .    FY      P
   213  221 C K     >  -     0   0   67  484   87                 R                   Q  I   .QQ     Q     .    QM      L
   214  222 C P  T >4 S+     0   0   63  534   70                 R                   K  P   .KK     D     S    EE      T
   215  223 C D  T 34 S+     0   0  132  572   39                 K                   G  D   .GG     N     V    GG      G
   216  224 C E  T 34 S-     0   0   83  609   46                 P                   H  S   GHH     E     G    GG      G
   217  225 C G    <<  +     0   0   49  117   85                 .                   .  .   ...     .     K    ..      .
   218  226 C K        -     0   0  124  137   84                 .                   .  .   N..     .     T    ..      .
   219  227 C R        +     0   0   81  180   80                 .                   .  K   R..     .     R    ..      .
   220  228 C G        +     0   0    3  583   68                 L                   I  K   GII     .     E    HR      V
   221  229 C D  B     -A   30   0A  12  624   16                 A                   D  N   DDD     G     D    DD      S
   222  230 C A        +     0   0    9  640   48                 P