Complet list of 2jbo hssp fileClick here to see the 3D structure Complete list of 2jbo.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      2JBO
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-05-21
HEADER     TRANSFERASE                             09-DEC-06   2JBO
COMPND     MOL_ID: 1; MOLECULE: MAP KINASE-ACTIVATED PROTEIN KINASE 2; CHAIN: A; 
SOURCE     MOL_ID: 1; ORGANISM_SCIENTIFIC: HOMO SAPIENS; ORGANISM_COMMON: HUMAN; 
AUTHOR     R.C.HILLIG,U.EBERSPAECHER,F.MONTECLARO,M.HUBER,D.NGUYEN,A.MENGEL, B.MU
DBREF      2JBO A   39    40  PDB    2JBO     2JBO            39     40
DBREF      2JBO A   41   364  UNP    P49137   MAPK2_HUMAN     41    364
SEQLENGTH   295
NCHAIN        1 chain(s) in 2JBO data set
NALIGN       80
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : K7D549_PANTR        0.97  0.97    1  296   44  346  303    1    8  400  K7D549     Mitogen-activated protein kinase-activated protein kinase 2 OS=Pan troglodytes GN=MAPKAPK2 PE=2 SV=1
    2 : G1NVK0_MYOLU        0.96  0.96   51  296    1  253  253    1    8  307  G1NVK0     Uncharacterized protein OS=Myotis lucifugus GN=MAPKAPK2 PE=4 SV=1
    3 : M3YEZ1_MUSPF        0.96  0.96   47  296    9  265  257    1    8  319  M3YEZ1     Uncharacterized protein OS=Mustela putorius furo GN=MAPKAPK2 PE=4 SV=1
    4 : Q3U2P8_MOUSE        0.95  0.97    1  296   30  332  303    1    8  386  Q3U2P8     Putative uncharacterized protein OS=Mus musculus GN=Mapkapk2 PE=2 SV=1
    5 : F7CJE0_XENTR        0.86  0.93    2  296   22  323  302    1    8  374  F7CJE0     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=mapkapk2 PE=4 SV=1
    6 : Q28FG8_XENTR        0.86  0.94    2  296   27  328  302    1    8  379  Q28FG8     Mitogen-activated protein kinase-activated protein kinase 2 OS=Xenopus tropicalis GN=mapkapk2 PE=2 SV=1
    7 : Q5XGX7_XENLA        0.86  0.93    2  296   22  323  302    1    8  374  Q5XGX7     LOC495118 protein OS=Xenopus laevis GN=LOC495118 PE=2 SV=1
    8 : V9KX94_CALMI        0.84  0.92    1  296    7  309  303    1    8  361  V9KX94     MAP kinase-activated protein kinase 2-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
    9 : U3JCS7_FICAL        0.79  0.86   20  296   29  307  286    3   17  361  U3JCS7     Uncharacterized protein (Fragment) OS=Ficedula albicollis GN=MAPKAPK2 PE=3 SV=1
   10 : M3ZHV6_XIPMA        0.77  0.85   13  295   56  345  290    1    8  407  M3ZHV6     Uncharacterized protein OS=Xiphophorus maculatus GN=MAPKAPK3 (1 of 2) PE=4 SV=1
   11 : E1BT35_CHICK        0.76  0.87    9  296   34  328  295    1    8  387  E1BT35     Uncharacterized protein OS=Gallus gallus GN=MAPKAPK3 PE=4 SV=1
   12 : G3SZA0_LOXAF        0.76  0.87   13  296   38  327  290    1    7  384  G3SZA0     Uncharacterized protein OS=Loxodonta africana GN=MAPKAPK3 PE=4 SV=1
   13 : A8K4K4_HUMAN        0.75  0.87   15  296   38  325  288    1    7  382  A8K4K4     cDNA FLJ78027, highly similar to Homo sapiens mitogen-activated protein kinase-activated protein kinase 3, mRNA OS=Homo sapiens PE=2 SV=1
   14 : H2TNR7_TAKRU        0.75  0.87    9  296   24  318  295    1    8  375  H2TNR7     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066672 PE=4 SV=1
   15 : K7GCY8_PELSI        0.75  0.87   11  296   36  328  293    1    8  387  K7GCY8     Uncharacterized protein OS=Pelodiscus sinensis GN=MAPKAPK3 PE=4 SV=1
   16 : MAPK3_RAT           0.74  0.87   13  296   38  327  290    1    7  384  Q66H84     MAP kinase-activated protein kinase 3 OS=Rattus norvegicus GN=Mapkapk3 PE=2 SV=1
   17 : Q0IHG8_XENLA        0.74  0.87   12  275   27  297  271    1    8  302  Q0IHG8     Mapkapk3 protein OS=Xenopus laevis GN=mapkapk3 PE=2 SV=1
   18 : A7BJ43_DANRE        0.72  0.88    5  295   33  330  298    1    8  397  A7BJ43     Ser/Thr protein kinase OS=Danio rerio GN=mapkapk2b PE=2 SV=1
   19 : T1IP72_STRMM        0.69  0.83   10  295   87  378  292    1    7  463  T1IP72     Uncharacterized protein OS=Strigamia maritima PE=4 SV=1
   20 : W5JW45_ANODA        0.69  0.84   12  295   26  316  291    1    8  367  W5JW45     Map kinase-activated protein kinase (Mapkapk) OS=Anopheles darlingi GN=AND_000430 PE=4 SV=1
   21 : G3MT13_9ACAR        0.67  0.82    9  295   81  374  294    1    8  422  G3MT13     Putative uncharacterized protein OS=Amblyomma maculatum PE=2 SV=1
   22 : V5GG78_ANOGL        0.66  0.81    4  295    4  302  299    1    8  353  V5GG78     MAP kinase-activated protein kinase 2 OS=Anoplophora glabripennis GN=MAPK2 PE=4 SV=1
   23 : W8BAR5_CERCA        0.66  0.84   12  295   18  308  291    1    8  363  W8BAR5     MAP kinase-activated protein kinase 2 OS=Ceratitis capitata GN=MAPK2 PE=2 SV=1
   24 : B4NDG1_DROWI        0.64  0.83    5  295    4  301  298    1    8  364  B4NDG1     GK10232 OS=Drosophila willistoni GN=Dwil\GK10232 PE=4 SV=1
   25 : E9HC87_DAPPU        0.64  0.80   12  295   20  310  291    1    8  365  E9HC87     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_309371 PE=4 SV=1
   26 : B3NSW5_DROER        0.63  0.82    5  295    4  301  298    1    8  357  B3NSW5     GG18472 OS=Drosophila erecta GN=Dere\GG18472 PE=4 SV=1
   27 : B4JNI1_DROGR        0.63  0.83    5  295    4  301  298    1    8  354  B4JNI1     GH24824 OS=Drosophila grimshawi GN=Dgri\GH24824 PE=4 SV=1
   28 : H2L6Y6_ORYLA        0.62  0.78   10  296   49  346  298    2   12  408  H2L6Y6     Uncharacterized protein OS=Oryzias latipes GN=MAPKAPK3 (1 of 2) PE=4 SV=1
   29 : S4A9B8_CAPO3        0.53  0.71    9  293   39  332  296    3   14  375  S4A9B8     Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_08994 PE=4 SV=1
   30 : K9K4H0_HORSE        0.45  0.65   27  283    2  286  287    5   33  445  K9K4H0     MAP kinase-activated protein kinase 5-like protein (Fragment) OS=Equus caballus PE=2 SV=1
   31 : H0Z8B9_TAEGU        0.44  0.65   12  283   12  312  303    6   34  473  H0Z8B9     Uncharacterized protein OS=Taeniopygia guttata GN=MAPKAPK5 PE=4 SV=1
   32 : H2Q6W5_PANTR        0.44  0.65   12  283   12  312  303    6   34  473  H2Q6W5     Uncharacterized protein OS=Pan troglodytes GN=MAPKAPK5 PE=4 SV=1
   33 : K7ANM9_PANTR        0.44  0.65   12  283   12  312  303    6   34  471  K7ANM9     Mitogen-activated protein kinase-activated protein kinase 5 OS=Pan troglodytes GN=MAPKAPK5 PE=2 SV=1
   34 : K9IST6_DESRO        0.44  0.65   12  283   31  331  303    6   34  490  K9IST6     Putative map kinase-activated protein kinase 5 (Fragment) OS=Desmodus rotundus PE=2 SV=1
   35 : L8I7D7_9CETA        0.44  0.65   12  283   11  311  303    6   34  472  L8I7D7     MAP kinase-activated protein kinase 5 OS=Bos mutus GN=M91_16527 PE=4 SV=1
   36 : U3C3H1_CALJA        0.44  0.65   12  283   12  312  303    6   34  471  U3C3H1     MAP kinase-activated protein kinase 5 isoform 1 OS=Callithrix jacchus GN=MAPKAPK5 PE=2 SV=1
   37 : F1MH23_BOVIN        0.43  0.65   14  283    2  302  303    7   36  461  F1MH23     Uncharacterized protein (Fragment) OS=Bos taurus GN=MAPKAPK5 PE=4 SV=1
   38 : U6D7N3_NEOVI        0.43  0.65   14  281    2  298  299    6   34  393  U6D7N3     MAP kinase-activated protein kinase 5 (Fragment) OS=Neovison vison GN=MAPK5 PE=2 SV=1
   39 : F6Q767_HORSE        0.42  0.63   11  283    5  308  306    7   36  467  F6Q767     Uncharacterized protein OS=Equus caballus GN=MAPKAPK5 PE=4 SV=1
   40 : H3DH07_TETNG        0.42  0.64   16  295   16  324  311    6   34  471  H3DH07     Uncharacterized protein OS=Tetraodon nigroviridis PE=4 SV=1
   41 : V9KUM9_CALMI        0.42  0.62   16  295   15  323  311    6   34  473  V9KUM9     MAP kinase-activated protein kinase 5 OS=Callorhynchus milii PE=2 SV=1
   42 : F7DYT7_XENTR        0.40  0.62   12  295   12  325  316    7   35  491  F7DYT7     Uncharacterized protein OS=Xenopus tropicalis GN=mapkapk5 PE=4 SV=1
   43 : B3RID6_TRIAD        0.38  0.58   20  284   17  281  273    7   17  340  B3RID6     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_49758 PE=4 SV=1
   44 : I1G9F9_AMPQE        0.36  0.60   21  276   15  275  268    7   20  337  I1G9F9     Uncharacterized protein OS=Amphimedon queenslandica GN=LOC100635387 PE=4 SV=1
   45 : W2Q2T2_PHYPN        0.36  0.59   18  276   51  312  270    8   20  370  W2Q2T2     CAMK/CAMK1 protein kinase OS=Phytophthora parasitica (strain INRA-310) GN=PPTG_12673 PE=4 SV=1
   46 : W2WRR5_PHYPR        0.36  0.59   18  276   51  312  270    8   20  370  W2WRR5     CAMK/CAMK1 protein kinase OS=Phytophthora parasitica CJ01A1 GN=F441_11817 PE=4 SV=1
   47 : B5YP80_THAPS        0.35  0.60   27  275    1  260  266    7   24  267  B5YP80     Predicted protein (Fragment) OS=Thalassiosira pseudonana GN=THAPS_14242 PE=4 SV=1
   48 : E5S318_TRISP        0.35  0.58    1  280    2  282  290    9   20  374  E5S318     Calcium/calmodulin-dependent protein kinase type 1 OS=Trichinella spiralis GN=Tsp_03226 PE=4 SV=1
   49 : H3C7T9_TETNG        0.35  0.60   30  291    1  261  270    6   18  273  H3C7T9     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
   50 : L1IPI4_GUITH        0.35  0.56   26  271    1  243  257    8   26  293  L1IPI4     Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_158530 PE=4 SV=1
   51 : C4LZF9_ENTHI        0.34  0.55   19  277    7  266  273    9   28  272  C4LZF9     Protein kinase, putative OS=Entamoeba histolytica GN=EHI_137980 PE=4 SV=1
   52 : H0WUS1_OTOGA        0.34  0.58    9  286    4  283  288    8   19  346  H0WUS1     Uncharacterized protein OS=Otolemur garnettii GN=PNCK PE=4 SV=1
   53 : MYLKD_DICDI         0.34  0.56   19  285    5  274  282    8   28  313  Q54CY9     Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1
   54 : T0RX91_9STRA        0.34  0.57   20  277   36  296  268    6   18  347  T0RX91     CAMK protein kinase OS=Saprolegnia diclina VS20 GN=SDRG_05448 PE=4 SV=1
   55 : W5NPS2_SHEEP        0.34  0.54   20  276   42  297  270    8   28  333  W5NPS2     Uncharacterized protein (Fragment) OS=Ovis aries GN=CAMK4 PE=4 SV=1
   56 : E5GCJ3_CUCME        0.33  0.55   18  291   29  305  286   10   22  337  E5GCJ3     Calcium-dependent protein kinase OS=Cucumis melo subsp. melo PE=4 SV=1
   57 : E7KU52_YEASL        0.33  0.53   20  276   47  310  272   11   24  323  E7KU52     Cmk2p OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=QA23_4364 PE=4 SV=1
   58 : F0WZ59_9STRA        0.33  0.54   20  296   79  358  290    9   24  378  F0WZ59     Predicted protein putative OS=Albugo laibachii Nc14 GN=AlNc14C412G11465 PE=4 SV=1
   59 : F7BGL7_ORNAN        0.33  0.59   20  275    2  259  269   10   25  328  F7BGL7     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PSKH2 PE=4 SV=1
   60 : H2MFV8_ORYLA        0.33  0.56   20  275   31  285  269    8   28  324  H2MFV8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101155594 PE=4 SV=1
   61 : J9FDP5_WUCBA        0.33  0.55   16  282   18  287  278    8   20  309  J9FDP5     CAMK/CAMK2 protein kinase (Fragment) OS=Wuchereria bancrofti GN=WUBG_03597 PE=4 SV=1
   62 : U6D133_NEOVI        0.33  0.56   12  286    7  281  283    6   17  322  U6D133     Calcium/calmodulin-dependent protein kinase type 1B (Fragment) OS=Neovison vison GN=KCC1B PE=2 SV=1
   63 : A5H7H3_NICAT        0.32  0.54   21  283    1  266  275   10   22  266  A5H7H3     Calcium-dependent protein kinase 8 (Fragment) OS=Nicotiana attenuata PE=2 SV=1
   64 : B5M4U7_PHYSO        0.32  0.56   20  285   13  281  279    7   24  327  B5M4U7     Calcium/calmodulin dependent protein kinase 3 OS=Phytophthora sojae PE=2 SV=1
   65 : B7GB81_PHATC        0.32  0.55   16  275    2  264  271    7   20  264  B7GB81     Predicted protein (Fragment) OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_16067 PE=4 SV=1
   66 : D0N2F0_PHYIT        0.32  0.57   20  283   59  330  279   10   23  360  D0N2F0     Calcium/calmodulin-dependent protein kinase, putative OS=Phytophthora infestans (strain T30-4) GN=PITG_04938 PE=4 SV=1
   67 : L1JES4_GUITH        0.32  0.56   20  275   14  278  273    8   26  294  L1JES4     Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_157702 PE=4 SV=1
   68 : S9PQ01_SCHOY        0.32  0.52   20  290   33  308  287    9   28  339  S9PQ01     CAMK/CAMK1 protein kinase Cmk1 OS=Schizosaccharomyces octosporus (strain yFS286) GN=SOCG_01530 PE=4 SV=1
   69 : W2Z2P3_PHYPR        0.32  0.56   20  285   13  281  280    9   26  327  W2Z2P3     CAMK/CAMK1 protein kinase OS=Phytophthora parasitica P10297 GN=F442_11590 PE=4 SV=1
   70 : H0YV66_TAEGU        0.31  0.56   12  277   17  284  280   11   27  294  H0YV66     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=MYLK4 PE=4 SV=1
   71 : L1JGS2_GUITH        0.31  0.50   20  275    1  265  271    9   22  265  L1JGS2     Uncharacterized protein (Fragment) OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_54533 PE=4 SV=1
   72 : Q4SXH2_TETNG        0.31  0.49   27  276    1  256  288   10   71  319  Q4SXH2     Chromosome undetermined SCAF12413, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00010860001 PE=4 SV=1
   73 : V4N6K9_THESL        0.31  0.52   14  286   53  359  312   11   45  385  V4N6K9     Uncharacterized protein OS=Thellungiella salsuginea GN=EUTSA_v10013170mg PE=4 SV=1
   74 : B3VT57_ORYSJ        0.30  0.52    9  282    9  282  289   13   31  329  B3VT57     CBL-interacting protein kinase 3 isoform 2 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1
   75 : F6SZJ9_MACMU        0.30  0.50   20  277   24  292  279   11   32  347  F6SZJ9     Uncharacterized protein OS=Macaca mulatta GN=CHEK2 PE=4 SV=1
   76 : F7CHQ8_MACMU        0.30  0.51   13  286    8  281  288   11   29  343  F7CHQ8     Uncharacterized protein OS=Macaca mulatta GN=PNCK PE=4 SV=1
   77 : G3GYU8_CRIGR        0.30  0.55   20  295   36  339  312   11   45  415  G3GYU8     MAP kinase-interacting serine/threonine-protein kinase 1 OS=Cricetulus griseus GN=I79_002927 PE=4 SV=1
   78 : K9KCP0_HORSE        0.30  0.51   20  277   33  301  279   11   32  356  K9KCP0     Serine/threonine-protein kinase Chk2-like protein (Fragment) OS=Equus caballus PE=2 SV=1
   79 : W0W0V2_ZYGBA        0.30  0.53    1  278   88  390  309   11   38  419  W0W0V2     Probable DUN1-Protein kinase OS=Zygosaccharomyces bailii ISA1307 GN=ZbDUN1 PE=4 SV=1
   80 : W2I641_PHYPR        0.30  0.51    9  276   41  289  279   12   42  345  W2I641     CAMK/CAMK1 protein kinase, variant 2 OS=Phytophthora parasitica GN=L914_17173 PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   44 A P              0   0  186    6   38  P  P   P                                       P                      
     2   45 A Q        +     0   0  152    9   53  Q  QQQQH                                       L                      
     3   46 A F        -     0   0  173    9  100  F  FTQQQ                                       F                      
     4   47 A H        +     0   0  159   10   83  H  HSQQP             D                         G                      
     5   48 A V        -     0   0   98   14   49  V  VLLLP         L   V L LL                    T                      
     6   49 A K        -     0   0  146   14   34  K  KKKKR         K   K Q QQ                    K                      
     7   50 A S        -     0   0   86   14   82  S  SSSSA         P   H N NN                    R                      
     8   51 A G        -     0   0   57   14   82  G  GTTTG         T   N Q QQ                    D                      
     9   52 A L        -     0   0   44   21   58  L  LLLLV  L  L   L  LR R RR L                  Q   L                  
    10   53 A Q        -     0   0  130   23   66  Q  QQQQQ  E  E   KQ HT Q QQET                  R   R                  
    11   54 A I  E     -a   80   0A  41   25   84  I  IIIIT  I  II  IP PP P PPFP         I        K   K                  
    12   55 A K  E     -a   81   0A  70   38   28  K  RKKKK  K  KK KKKKKKKKKKKRK KKKKKK  K  K     H   Q         Q       K
    13   56 A K        +     0   0  123   42   83  K  KKKKK RKK RKKRKSTSRTTTTTRL EEEEEE  E  D     Y   T         T       R
    14   57 A N  S    S-     0   0   61   45   81  N  NNNNN NHY HHYHKTTSTTTITSHN TTTTSTSTT  T     V   E         E       V
    15   58 A A    >   -     0   0   41   46   73  A  AAAAA AAAAAAAAVLAPPPPPPPAP SSSSSSSSS  S     N   D         D       G
    16   59 A I  G >> S+     0   0   12   50   26  I  IIIII VVVVVVVIIIIIILLILLVI IIIIIIIIIIII     I   I        FI  F    I
    17   60 A I  G 34 S+     0   0  105   50   82  I  TTTTT TTTTTTTTTTTTTVVTVVTE LLLLLLLLLLLL     R   N        SS  A    S
    18   61 A D  G <4 S+     0   0  101   53   40  D  DDDDD DDDDDDDDEDDQEENEDDEE EEEEEEEEEDDE  DD E   S   D    DS  N    N
    19   62 A D  T <4 S+     0   0   51   55   59  D  DDDDD DDDDDDDDEDDDDDDEDDDD EEEEEEEEEEEE  SS K  DVD  H    NV  M    Y
    20   63 A Y  E  <  -B   40   0A   6   72    0  Y  YYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYY YY Y  YYYYFYYYYYYY YYYFYYY
    21   64 A K  E     -B   39   0A 135   74   76  K  KKKKKKKKQQKKQKKRESEEEEEEKS NSSNNNNNNNANSKTT D  LEESELISDTEEDRTDDRRN
    22   65 A V  E     -B   38   0A  62   74   33  V  VVVVVVILLLVLLVLIIIIIIIVIII IIIIIIIIIIIIFYLL L  LILMVLFIILVILILVVTIV
    23   66 A T  E     -     0   0A  33   74   72  T  TTTTTTTSSSSSSSATSSTSSSSSTT nnnnnnnnnnnnKnGG R  KRHGEGGEKGKRGGKQGGGn
    24   67 A S  E    S+     0   0A 111   46   74  S  SNNNATSKKKSKKKGSNDKNDKDDSD tttttttttttt.k.. .  .......K.......T...d
    25   68 A Q  E     -     0   0A 108   74   65  Q  QQQQQQQRQQRRQQQNTHQKTNTTQV QQQQQQQQQQQQDEKK H  KEKKSKRTASEERRTEERRE
    26   69 A V  E     +B   36   0A  68   75   76  V  VVVVVVVVVVVVVVVVVVVVVVVVVT KKKKKKKKKKKKVLVV E MEKEAEKTEVEEKEVKLTVVI
    27   70 A L  E     -     0   0A  72   78   13  L  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLIILL VILILLLLIILLLLILLILIL
    28   71 A G  E     -B   35   0A  29   78    7  G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGRGGGGG
    29   72 A L  E     +B   34   0A 141   78   93  L  LLLLLLLLLLLLLLILLLLLLLLLLVAAAAAAAAAAAAATKSSVA RKSKERQAHRRKSREKRRGEG
    30   73 A G  E >   -B   33   0A  47   79    4  G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    31   74 A I  T 3  S+     0   0  174   79   79  I  IIIIIIIIVVIVVIIIIIIIIIIIIVIIIIIIIIIIIIIAASSHAASAAANAQSSNAAAENSHSSNR
    32   75 A N  T 3  S-     0   0   79   79   86  N  NNNNNNNNNNNNNNNNNNNNNSNNNHSSSSSSSSSSSSSFFYYHFFFFFFFTFFFYTFFFFYYFYFF
    33   76 A G  E <   +B   30   0A  31   79   34  G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGgGGGGgSSSSGsSGSSSSSGGGSSSSGSAAASSG
    34   77 A K  E     -B   29   0A 131   78   81  K  KKKKKKKKKKKKKKKKKKKKKKKKKKPPPPPPPrPPPPvEEVVSvEQVEVVITVTRIVEVITTTVIQ
    35   78 A V  E     -BC  28  50A  28   79   16  V  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVSVVVVRVVVVVIVVVVVVVTVVVVVVTVVVVVVV
    36   79 A L  E     -BC  26  49A  33   79   87  L  LLLLLLLLLLLLLLWVVVVVVVVVLRRRRRRRRRRRRRTVIRRRLYFYVFKYYRRIYRMYKWCKKKH
    37   80 A Q  E     + C   0  48A  19   79   82  Q  REEEEEEEEEEEEEEEQQEQQEQQERVVVVVVVVVVVVPLKEEQAMQELLQRLQVRRRLLEERLEEK
    38   81 A I  E     -BC  22  47A   0   79   56  I  IIIICICCCCCCCCICCCCCCCCCCCCCCCCCCCCCCCCAASSCEVVAAVCCCAGVCCACCCGCACC
    39   82 A F  E     -BC  21  46A  49   79   91  F  FFFFFFYFFFFFYYFYMHFASFTTYVVMVVVVVVVVVMIEEVVVSKRIQTTKTRTEEVQTTQRTVTE
    40   83 A N  E  >  -B   20   0A  22   79   71  N  DSSSSSCHHHNNHRQNSDNNNSHNCHKKKKKKKKKKKKKNEHHDKEKKEEHQHKDQEQEENHCDHNE
    41   84 A K  T  4 S+     0   0  116   79   49  K  KKKKKKKKRRKKRRKKKKRRRLRRKRKKKKNKKKKKKKSKKKKRTKKKRKKKRLRKKKRVRLRVIRK
    42   85 A R  T  4 S+     0   0  223   79   77  R  RKKKKKKERRKVRDKVKAAKRKLRKVSSSSSSSSSSSSKQEKKSRKDSGKAGASSAQRGDAERFEKA
    43   86 A T  T  4 S-     0   0   80   79   39  T  TSSTTSTTTTSTSTSTTKTTTNSTTSTSTTTTTTTTSTATTSSTQSTTSTTTTTTTTTSTTTTTTST
    44   87 A Q     <  +     0   0  124   79   70  Q  QGGGGGGGGGSEGGGGGGKKKKKRGMQQQQQQQQQQQGCKKKKGGGSNAKGQGNGKQGSGGKDKKGG
    45   88 A E        -     0   0  116   79   63  E  QEEDDEEQQQEQQQRGESEQKKQHAREEEEEEEEEEEEAERHHQLKAEHKKKDEQQKMHDDERQEEL
    46   89 A K  E     +C   39   0A  59   79   77  K  KKKKKKKKKKKKKKHKKKKKNKNNKSRRRRRRRRRRRRVKGKKQLLIELQPPLDTPPELKRTAQLRK
    47   90 A F  E     -C   38   0A  30   80   47  F FFFFFFFCCCCCCCCFFYFFYYYYYCYFFFFFFFFFFLFFFVFFFVFYVVWFYYVVFYFVYYFVFYFL
    48   91 A A  E     -CD  37  95A  10   80    4  A GAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
    49   92 A L  E     -CD  36  94A   7   80   43  L LLMMMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLQIIIIIIMLVLMVLCIIIVALCVVILAVA
    50   93 A K  E     -CD  35  93A  32   80    8  K QKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    51   94 A M  E     + D   0  92A  45   81   61  MMMMMMMMMILLLILLIMVVVIVVVVVIVIIIIIIIIIIIIVCICCSCCVVCICVSITLVICSCVKVICI
    52   95 A L  E     - D   0  91A   5   81   26  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLIIIILIVLIIIILILIILIIIIIVVIII
    53   96 A Q  E     - D   0  90A 100   81   96  QQQQQQQQQYYYYYYYYRRHRVLLRLLYDFLLLFFLFFFILFDDKKRDKEDPDKKPLLEKNPSNQKSNNK
    54   97 A D        +     0   0   22   81   58  DDDDDDDDDDDDDDDDDDDDDDDDDEDDDDDDDDDDDDDDDSKKRRKKKKTKKKKKKKTKTKKKRRKKKA
    55   98 A C  S  > S-     0   0   51   81   83  CCCCCCCCCTNSSCSSSNSNNSNNNNNTRRRRRRRRRRRRRKRKssSkKsAkKtTrkfSTkKkakfDkaq
    56   99 A P  H  > S+     0   0   95   73   76  PPPPAAPPPPPPPPPPPPTAVVPEPEEPPPPPPPPPPPPPPEASllEv.v.lSl.lli..lAllltDvlp
    57  100 A K  H >> S+     0   0  157   73   54  KKKKKKKKKKKKKKKKKKKKKKKKKKKKRKKKKKKKKKKKKKVLSSHK.R.RSK.LQS..SLRNQDPENK
    58  101 A A  H 3> S+     0   0   10   75   62  AAAAAAAAAAAAAAAAAGAAAAAAAAAASAAAAAAAAAAAASKKTTSGQKKGSK.CGQ..SRTPPPAKPQ
    59  102 A R  H 3X S+     0   0   88   76   55  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRGGEESKKRSKKK.KNPR.RGAKKKFKKK
    60  103 A R  H < S+     0   0   46   81   82  WWWWWWWWWWWWWWWWICWWWWWWWWWWWMMMMMMMMMMMLMNNFFRNNKGIIRRWYFTRRNRQNSHEQI
    67  110 A R  H >< S+     0   0   87   81   78  RRRRRRRRRRRQQRRQRRRRRRRRRRRRRMMMMMMMMMMMMLEEEEEEEAEAEETreRsTEErEEEEIEN
    68  111 A A  H >< S+     0   0    0   76   75  AAAAAAAAAVAAAVAAAAAAAAAVAVAVCCCCCCCCCCCCCCIIVVVIIE.VIMEil.lEAIvIVIVTI.
    69  112 A S  T << S+     0   0    2   77   74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSCAAAAAAAAAAAVAADSSMNARILMEIQS.SIRAEEATDIE.
    70  113 A Q  T <  S+     0   0   56   79   83  PQQQQQQGQGGGGGGGGSNGNGGGSEGGGTTTTTTTTTTDGAIVIILVVKKRKIGIIIVGIVIIIAALIV
    71  114 A C  S X  S-     0   0    6   79   97  CCCCCCCCCGCGGRCGGCCCCCCCHCCGHHHHHHHHHHHHHHLLLLLLLVISKLVMLLLVCLMLMLMKLM
    72  115 A P  T 3  S+     0   0   92   79   79  PPPPSSSTAPPPPPPPPPKRRRRKQRKPPSPPPPPPPPSPSPQKQQDSRLLCVRLHQRRLRRKKQRMRKN
    73  116 A H  T 3  S+     0   0   31   80   72  HHHHHHHHHHHHHHHHHRHNHHHHHHHHNNNNNNNNNNNNNNKKQQERREKRDKLHKSRLKRHDSRRIDQ
    74  117 A I  B <  S-f  162   0B   1   81   46  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIVVMMMLVIMVHLRLLFVRLVLLLVVSLL
    75  118 A V        -     0   0    1   81   76  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVEKKKNRKVVSPDLSSDSLQSPSMKSSNN
    76  119 A R        -     0   0  117   81   63  RRRHKKKRRRHRCRHRHENNNNNNNNNQDQQQQQQQQQQQQQhhhhhhhndhNhsehhhshhkhgqhghh
    77  120 A I  E     - E   0  95A   3   79   11  IIIIIIIIIIIIIIIIVIVIIVIIIIIIIIIIIIIIIIIIIIiiiiiiviiiIiiviiiiiiiiviciil
    78  121 A V  E     -     0   0A  56   79   32  VVVVIIIIMLLLLILLLEIIVIIIIIILIIIIIIIIIIILIIVVMMIVVVIVVVIVVIIIVVVIVVVLII
    79  122 A D  E     - E   0  94A  23   80   66  DDDDDDDDDSDDDSDDDDDDDDDDDDDSDEEEEEEEEEEEEDKQTTRRGTKAKKKQSKQQRATKQEHRKQ
    80  123 A V  E     -aE  11  93A   1   80   28  VVVVVVVVVLVVVLVVVVVVVVVVIVVLVVVVVVVVVVVVVVLLLLLLMLLLMLLIFLLLLLLLLLLLLL
    81  124 A Y  E     -aE  12  92A   1   80   71  YYYYYYYYAYYYHYYYYFYYYYYYYYYYYFYFFFFFFFFYYYIYEEVIEYYEHVKKKYIKHEKFLIHVCY
    82  125 A E  E     + E   0  91A  38   81   46  EEEEEEEELEEEEEEEEEEEEEEEEEEEEAAAAAAAAAAAAAEEEEDEEYDDEDEGDDEEDDDDDDGDDD
    83  126 A N  E     - E   0  90A  22   81   82  NNNNNNNNCNNNNNNNNNNNNNNNNNNNNnnnnnnnnnnnnnLIFFLTFAVVYVITWVVINVTVFVVYvA
    84  127 A L  E     + E   0  89A 130   50   93  LLLLLLLLSMMMMMIMIYTSVTTTITTMAeeeeeeeeeeeee........F..F.........Y....d.
    85  128 A Y  E >  S- E   0  88A 142   79   75  YYYYYYYYRHHHHYHHHYHYYYYYQYYYVSSSSSSSSSSSSSYFFFYFYFDHFDFYFCFFIHYDYFFFGF
    86  129 A A  T 3  S-     0   0   82   79   73  AAAAQQQQGQHHHHQHRQASGNGSGRSQNSSSSSSSSSSSSSDDVVEEEQGEENEEEEEEQEEGEEEEDE
    87  130 A G  T 3  S+     0   0   75   79   66  GGGGSSSSPGGNGGGGSGGGGNGGNGGGGPPPPPPPPPPPPPSDEEDDSTNSSETDSGITESDDETETGS
    88  131 A R  E <   - E   0  85A 116   79   72  RRRRRRRKQKKKKKKKKKNNNSNRTRRKSRRRRRRRRRRRRRKKPPEKRGDPTGPSKPRDEPDGETKVPK
    89  132 A K  E     - E   0  84A 105   79   80  KKKKKKKKGKRRRKRRRKKRRTKKKKKKKAAAAAAAAAAAAATSDDESTSGSDDTVDRDTASNPDRGNMN
    90  133 A C  E     -DE  53  83A   4   79   92  CCCCCCCCCCCCCCCCCCCCCCCCCCCCKRRRRRRRRRRRRRHRYYYNHSKHKMEFKHRDFHAMCEKNCD
    91  134 A L  E     -DE  52  82A   1   79   43  LLLLLLLLRLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLYYLYYLLLICIVFLVIHLVCFVFLFI
    92  135 A L  E     -DE  51  81A  12   78   57  LLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLLLLLLLLLLLLYYYYHYYCYYYYSHYHYAYYHFYHFY.V
    93  136 A I  E     -DE  50  80A   0   80   30  IIIIIIIILIIIIIIIILVVVVVVVVVILIIIIIIIIIIIIILLLLLLLLILLLLLIILLLLILILLLLL
    94  137 A V  E     +DE  49  79A   0   80   14  VVVVIIIVLVVVIIIVVVVVVVVVVVVVVVVVVVVVVVVVVVIVVVVVIVIAVVVVVIVVVAVVVVVIVV
    95  138 A M  E     -DE  48  77A  15   81   27  MMMMMMMMLMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMTTTMMMTMVMLMTTMLFMMMMLLTMM
    96  139 A E        -     0   0   41   81   12  EEEEEEEEQEEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEENDQDDEEEEEQEEEDEEEEEDEEE
    97  140 A C        -     0   0   17   81   82  CCCCCCCCICCCCCWCCCCCCCCCCCCCLMMMMMMMMMMMMMLLFFLLLFLLLLLLLLLLLLLYYLLLYY
    98  141 A L    >   +     0   0   23   81   55  LLLLLLLMLMMMMMYMMMMMMMMMMMMMMMMMMMMMMMMMMMVVVVCVVIVVVVVCACAVVVCAMCVAAV
    99  142 A D  T 3   +     0   0   74   81   56  DDDDDDDEDEEEEEEEQEEEEEEEEEEEAEEEEEEEEEEEEETTGGHTSNKTTTTATTTTTTEETTTTEE
   100  143 A G  T 3  S-     0   0    6   81    3  GGGGGGGGGGGGGGPGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   101  144 A G    <   -     0   0   27   81    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   102  145 A E  B  >  -G  150   0B  79   81   11  EEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEPEEEEEEEEEEEDETEEE
   103  146 A L  H  > S+     0   0    0   81    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLL
   104  147 A F  H  > S+     0   0   29   81    4  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFFFFFFFMFFF
   105  148 A S  H  > S+     0   0   49   81   62  SSSSSSSSSSSSSSNSTRQQQQQQQQQSEHHHHHHHHHHHHHDDDDDDDIDDDDDDDDDDEDDDDEDDDD
   106  149 A R  H >< S+     0   0   49   81   17  RRRRRRRRRRRRRRRRRHRRRRRRRRRRHRRRRRRRRRRRRRRRRRRRRHRRRRRRRRRRDRRRRRRRRR
   107  150 A I  H >< S+     0   0    5   80    4  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIVIIIIIILIIII
   108  151 A Q  H 3< S+     0   0   61   80   87  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSSSSSSSSSSSSVIVVRVL.STVIVLLIIVVMVIVAICII
   109  152 A D  T << S+     0   0  111   81   63  DDDDDDDDDVEEEAEEKEDEEDGDDDDAKQQQQQQQQQQQQQQSEEKADLDEDAELSAAEAEATEEESAD
   110  153 A R    <   +     0   0   65   81   51  RRRRRRRRRRRRRKRRRRRRRRNKRKKRKHHHHHHHHHHHHHKKKKKKRKKRKKKKRRQRRRRKKKMQKE
   111  154 A G        +     0   0   42   81   69  GGGGGGGGGGGGGGGGGRAQAPAAAAAGTRRRRRRRRRRRKRGGTTSGGKTGKEGGGGGGEGGETGNGEN
   112  155 A D  S    S+     0   0  147   81   84  DDDDDDDDDDDDDDDDDDEDEDDDDDEDHHHHHHHHHHHHHHSSFFASVQFSSHYHKHSYFSHYQAHSYY
   113  156 A Q  S    S-     0   0  123   80   86  QQQQQQQQQQQQQQQQQQGGGGGGGSSQ.FFFFFFFFFFFFFYYYYEYYKYYFYYYFFFYYYYYYYFFYN
   114  157 A A        -     0   0   44   80   68  AAAAAAAAAAAAAAAAAAAPAANAAASA.TTTTTTTTTTTTTTTTTnSSFPTTTSSTSTSSTTTTSSYTL
   115  158 A F  E     -I  286   0C   3   47   85  FFFFFFFFFFFFFFFFFFFFFFFFFFFFF........E........f.EFE.EEE....EEEEE..EEE.
   116  159 A T  E  >  -I  285   0C  19   48   64  TTTTTTTTTTTTTTTTTTTTTTSTTTTTT........K........S.KSD.KAR....RAKRA..QAAT
   117  160 A E  H  > S+     0   0    3   81   15  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQEEEEEEEEEEDEKEEEDEEEEDDDAEEEDDEE
   118  161 A R  H  > S+     0   0   67   81   71  RRRRRRRRrRRRRKKRRRRRRRRRRRRRHKKKKKKKKAkKKKRKKKQRARAKAAARVARAAAAAKAAAAM
   119  162 A E  H  > S+     0   0   57   66   40  EEEEEEEEeEEEEEEEEEEEEEEEEEEEEQQQQQQQQ.sMMQDDEEQD.D.D...EDDD.....DD...D
   120  163 A A  H  X S+     0   0    0   67   20  AAAAAAAAAVAAAAAAAAAAAAAAAAAVAAAAAAAAA.QAAAAAAAAA.A.A...AAAA.....AC...T
   121  164 A S  H  X S+     0   0    0   81   63  SSSSSSSSSSSAASSASSAAAAAAAAASSSSSSSSSSSVSSSSTRRASSRKSKKAAVATASSAKRVIAKI
   122  165 A E  H  X S+     0   0   83   81   75  EEEEEEEEEEEEEEEEEEEQEQQQEQHELQQQQQQQQQTQQQVEDDKNCIIHLVDKETRHHHGKDRHRKS
   123  166 A I  H >X S+     0   0   14   81   43  IIIIIIIIIIIIIIIIIIIVIVIIVIIIIVVVVVVVVVKVVVLLLLILVWVLIVALILVVCLIVLHVLVF
   124  167 A M  H 3X S+     0   0    0   81   62  MMMMMMMMMMMMMMMMMMIMIMMMMMMMMTTTTTTTTTQTTTIIVVLIIAVVTVVIIILIIVLVTVTIVI
   125  168 A K  H 3X S+     0   0   58   81   59  KKKKRRRKKHRRRRRRRRRHRHHHRHRHRKKKKKKKKKAKKKKRKKHRQAKGQRKKVRQKQGRKLRRRKK
   126  169 A S  H <>S+     0   0    0   81   71  LLLLLLLLLLLLLLLLLLLLLLLLLLLLICCCCCCCCCCCCCLLCCMLLLLLLCLCMCLLCLCCLLLLCM
   135  178 A H  H ><5S+     0   0   15   81    0  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
   136  179 A S  H 3<5S+     0   0   82   81   76  SSSSSSSSSHSSSRASGGADRDSSYSSRSLSLLLLLLLLSSSDEDDKMQSSNSAESSDSELSRAQESESQ
   137  180 A I  T <<5S-     0   0   43   81   82  IIIIIIIVIVMQHFMQMIMSMNRRMRRMLLLLLLLLLLLLLLILQQNNSMMLIQNLKRLNNLHEACINEM
   138  181 A N  T < 5S+     0   0   63   81   49  NNNNNNNNNDNNNDNNNNNNNNDDGDDDNNNNNNNNNNNNNNGGNNNDGGNGGDGGNGRGNGGGGGGGGY
   139  182 A I  E   < -J  170   0D   0   81   10  IIIIIIIIIIIIIIIIIIIIIIIIIIIILIIIIIIIIIILLIIIVVVIIIIIIIIVVIIVVIVVIIIIVI
   140  183 A A  E     -J  169   0D   0   81   60  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAVIVVVVVIVVVAVMVCTVVVMTAVTVTL
   141  184 A H        -     0   0    0   81    2  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHYHHHHHHHHHHHHHHHHHHHH
   142  185 A R        +     0   0   93   81    3  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRL
   143  186 A D        +     0   0   21   81    1  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNDDDDDDDDDDD
   144  187 A V        +     0   0    5   81   19  VVVVVVVVVVVVVIVVVLLLLLLLLLLVLLLLLLLLLLLLLLLLLLLILILLLLLLLLLLLLLLLLLLLL
   145  188 A K    >   -     0   0   85   81    0  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
   146  189 A P  G >  S+     0   0   28   81    3  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   147  190 A E  G 3  S+     0   0   99   81    1  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQEEEEE
   148  191 A N  G <  S+     0   0   15   81    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   149  192 A L  E <   + H   0 162B   2   81   18  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILIVILLLLFVCLLLLFLLILLLI
   150  193 A L  E     -GH 102 161B  30   81    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   151  194 A Y  E     - H   0 160B  21   80   23  YYYYYYYYYYYYYYYYYYYYYYYYYYYYFFFFFFFFFFFFFFYYLLFYY.LYLYYFYFYYLYFYLLYYYC
   152  195 A T  S    S-     0   0   29   80   82  TTTTTTTTTTTTTTTTTSTTTSTTSTTTKKKKKKKKKKKKKKYYMMEQF.KAKAADVEYAAAGAESARAV
   153  196 A S        -     0   0   29   80   64  SSSSSSSTSTSSSSSSSSYSKKSTSTTTDDDDDDDDDDDDDDSSSSTSN.STTTTNDTHDSTNDSTSSDN
   154  197 A K  S    S+     0   0  154   81   74  KKKKKKKKKKKKKKKKKKRPPKNTPSTRTNNNNNNNNNNNNNPPAATPQLPPPAPPKNPLKPKEKsgKER
   155  198 A R  S >  S-     0   0  163   78   81  RRRRRRRRRDEEEDEEEQGHGGDQGQQETSSSSSSSSSSSSSAADDDDDDDF.DAGSAGSAFKTLepDT.
   156  199 A P  T 3  S+     0   0  124   80   85  PPPPPPPPPSKKKKKKSPNPDTKPLPPSELLLLLLLLLLLLLDDDDEPERDETDPEEEVLKEEENHDPEE
   157  200 A N  T 3  S+     0   0  114   80   50  NNNNNNNNNNDDDNNDNDTNSYNNDNNNTDDDDDDDDDDDDDDDDDDDNGDDDNDDNDEDGDTNNDYNSA
   158  201 A A    <   -     0   0   16   81   46  AAAASSSAAATAATAAAAGAAGAAGAAASAAAAAAAAAAAAASSAASSSGTSLAAASASAASAAAANSAN
   159  202 A I        -     0   0   62   81   85  IIIIVVVIVTVVVIVVEQIIVVTIIIVTEPPPPPPPPPPPPPKKSSSKKHDKTEPKPDKSAKPVRVTEVQ
   160  203 A L  E     - H   0 151B   7   81   29  LLLLLLLLLLLLLLLLLLLLLLLLLLLLIVVVVVVVVVVVVVIIIIIIIIVIVILLLLILVILIIVILII
   161  204 A K  E     - H   0 150B  26   81   31  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKMMKKKMMKRMAKKKVKLKKMKKKKKLKK
   162  205 A L  E     +fH  74 149B   2   81   32  LLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLLLLIILLIIILIVLIIAIVIILVAILVIIII
   163  206 A T        +     0   0   21   81   66  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCCCCCCCCCCCCSSAAISSTASSAATAITAASIAGAAAAI
   164  207 A D        -     0   0   37   81    1  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   165  208 A F    >   +     0   0    2   81    3  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   166  209 A G  T 3  S+     0   0   35   81    2  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGgggggGGGgGGGGggggGGGgGGgGgGg
   167  210 A F  T 3  S+     0   0  111   80   22  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFmivvyLLLmLLFLflmsLLLfFFfLfFy
   168  211 A A    <   -     0   0   17   81   54  AAAAAAAAAAAAAAAASAASAAAAAAAAAAAAAAAAAAAAAADETTASSAISSASYKDGSASFAAAAYAK
   169  212 A K  E     -J  140   0D 106   81   40  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKDEKKKKKRTKKIKQGNKKIKKKRGKDKP
   170  213 A E  E     -J  139   0D  87   81   79  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEIVIIIIIIIIIIIGGDDHSMDEIIIIPESAIEIPLRTVDLR
   171  214 A T              0   0    8   81   77  ttttttttttttttttttttttttctttvdddddddddddddtqddgvvvdqvavgevsivqgvvnmsve
   172  215 A T              0   0  119   81   70  ppppppppppppppppppppppppppppppppppppppppppaattlaavaatmvvarlveaimrkpamn
   173      ! !              0   0    0    0    0  
   174  224 A C              0   0  160   81   60  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCQQQQQQQQQQQQQCCCCVCCACCCCCVAVCCACVCVCCCCF
   175  225 A Y        +     0   0  218   81   86  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYFFFFFFFFFFFFFGGGGGGGGGGGGGGGGGGWGGGGGGGGG
   176  226 A T  S    S+     0   0  113   81   17  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSTTTTTSSSTTFTSTTTTTTT
   177  227 A P    >   +     0   0   62   81   16  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLIPPGPPPPWPPPP
   178  228 A Y  T 3  S+     0   0  203   81   82  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYGGGGYGGYVGSGGYGYEGFGYGTGNEGE
   179  229 A Y  T 3  S+     0   0  180   81    3  YYYYYYYYYYYYYYYYYFYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYAYYYYYYYYF
   180  230 A V    <   -     0   0   61   81   32  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVLVVMVVVFCVVVMCGVMYVSVMYL
   181  231 A A    >>  -     0   0   36   81    6  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATAAAAAAAAA
   182  232 A P  T 34 S+     0   0  100   81    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   183  233 A E  T 34 S+     0   0  155   81   18  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEQQQQQQQQQQQQQEEEEEEEEEEEEEEEEEEGEEEEEEEEE
   184  234 A V  T <4 S+     0   0   99   81   19  VVVVVVVVVVVVVVVVVVVVVVVVVVVVIVVVVVVVVVVVVVVVIIVVVVVLVVIVVVIIYLVIIMVIIV
   185  235 A L  S  < S-     0   0  129   81   14  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLVLIIFVV
   186  236 A G        -     0   0   34   81   78  GGGGGGGGGGGGGGGGGGGGGGGGGGGGreeeeeeeeeeeeeAREERAALNEnARRTKLRsEKRKsdRRN
   187  237 A P        +     0   0  117   75   65  PPPPPPPPPPPPPPPPPPPPPPPPPPPPtpppppppppppppQRGG.QQMAQpRG.Q.RGkQ.KNasRKY
   188  238 A E        -     0   0   68   80   90  EEEEEEEEEEEEEEEEEEEEEEEEEEQKAYYYYYYYYYYYYYEKAAKQKQKKTRCKDGNNDKRLIFKVLE
   189  239 A K        -     0   0  158   80   83  KKKKKKKKKKKKKKKKKKKKRKKKKKKKTTTTTTTTTTTTTTPPSSCPPGGPAPAHGRPAPPNPPGVGPF
   190  240 A Y  S    S+     0   0  154   80   13  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYHYYYYYYHYYYYYYYHYYYYV
   191  241 A D        +     0   0   41   81   47  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDNNNNNNNNNNNNNGGGGGGSDGGSEGGGDTGGGGDDDGGDS
   192  242 A K  S  > S+     0   0   35   81   51  KKKKKKKKKKKKKKKKKKKKKKKKTKKKKKKKKKKKKKKKKKKKKKKKKVMKDQPHKKSPKKPSQDPKSF
   193  243 A S  H  > S+     0   0   22   81   60  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNEAPPEAAQEAAKEEPSAEPAEKRKESKP
   194  244 A C  H  > S+     0   0   50   81   50  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCVVVVCVVAVVVCVVCCVVVVVCVVVVCT
   195  245 A D  H  > S+     0   0    0   81    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   196  246 A M  H  X S+     0   0    4   81   49  MMMMMMMMMMMMMMMMMMMIMVIIMIIMMLLLLLLLLLLLLLCVIILVCWMVMIMVILMMIVVIMSIIIM
   197  247 A W  H >X S+     0   0   47   81    4  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   198  248 A S  H 3X S+     0   0   25   81   13  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSAGSSSSSASAASSSSSSSS
   199  249 A L  H 3X S+     0   0    0   81   37  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLIIIIVIILILVLVAIILVCLALVLLILL
   200  250 A G  H X S+     0   0    4   81    3  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   205  255 A I  H >X S+     0   0   19   81   21  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIVVVVVVVVVVVVVIIIIIIIEVIIIIITIIIIIIIVIVFIM
   206  256 A L  H 3< S+     0   0    0   81   22  LLLLLLLLLLLLLLLLLLLLLLLILIILLMMMMMMMMMMMMMLLLLLLLMLLLLLLLLLLLLLLLLMLLL
   207  257 A L  H << S+     0   0    4   81    3  LLLLLLLLLLLLLLLLLLLLLLLMLMMQLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   208  258 A C  H << S-     0   0    0   81   21  CCCCCCCCCCCCCCCCCCCCCCCCCCCCACCCCCCCCCCCCCCCCCSCCVCCCCCSCCSCVCCCVCCCCT
   209  259 A G  S  < S+     0   0   11   81    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGXGGGGGGGGGGGGG
   210  260 A Y  S    S-     0   0   35   81   16  YYYYYYYYYFFFFFFFYYFFFFFFYFFLYYYYYYYYYYYYYYYYYYYYYLYYFFFVYYMFYYVFYYFYFL
   211  261 A P        -     0   0   42   81   29  PPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPEPSPLEPPPPPHPSPS
   212  262 A P  S    S+     0   0   10   81    4  PPPPPPPPPPPPPPPPPPPPPPPPPPPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   213  263 A F  S    S-     0   0   18   81    6  FFFFFFFFFFFFFFFFFFFFFFFFFFFAFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   214  264 A Y        -     0   0  148   81   49  YYYYYYYYYYYYYYYYYYYYYYYYYYYNYYYYYYYYYYYYYYYYHHNYYYFYYYYWIYEFWYWYLDYVYL
   215  265 A S        +     0   0   22   81   61  SSSSSSSSSSSSSSSSSSSSSSSSSSSASsssssssssssssDHDDADESGDSDDAAGDDDDADEPQRDG
   216  266 A N        -     0   0  116   45   59  NNNNNNNNNNNNNNNNNNNNNNNNNNIIEhhhhhhhhhhhhh............................
   217  267 A H  S    S+     0   0  148   46   59  HHHHHHHHHTTTTTTTTNHHHHNHHHNRGHHHHHHHHHHHHH.......................E....
   218  268 A G  S    S-     0   0   77   46   39  GGGGGGGGGGGGGGGGGGGGGGGGGGGAGSSSSSSSSSSSSS.......................G....
   219  269 A L  S    S+     0   0   77   50   90  LLLLFFFLLQQQQQLQQLLLLLLLQMLTQRRRRRRRRRRRRR.......................E....
   220  270 A A  S    S+     0   0   81   71   72  AAAAAAAAAAAAAAAAAPAAAAAAAASNNTTTTTTTTTTTTTEEDDPEE..E.E.EEDE.EEE.DRT...
   221  271 A I  S    S+     0   0   12   71   74  IIIIIIIIIIIIIIIIILIIIIIIMIILIIIIIIIIIIIIIIDNSSSNS..S.N.TSTN.DST.SSS...
   222  272 A S  S    S+     0   0   52   75   72  SSSSSSSSSSSSSSSSSSSSSSSSSSSRSPPPPPPPPPPPPPDDQQSDES.D.QEDVDQPQDE.QDT...
   223  273 A P  S  > S+     0   0   81   81   74  PPPPPPPPPPPPPPPPPPPPPPPPPPPQPKKKKKKKKKKKKKTSPPKISNDPEIRSESSRHPRESNPSED
   224  274 A G  H  > S+     0   0    7   81   59  GGGGGGGGGGGGGGGGGGGGGGGGGGGRGDDDDDDDDDDDDDEEVVGNRATEDQGGGDRGREGNDEASND
   225  275 A M  H  > S+     0   0   45   81   41  MMMMMMMMMMMMMMMMMMMMMMMMMMMLMMMMMMMMMMMMMMLLLLVLLKLLIEDIFVLDLLVQLMLQQD
   226  276 A K  H  > S+     0   0  150   81   90  KKKKKKKKKKKKKKKKKRKKKKKKKKKSKRRRRRRRRRRRRRFFFFYFFAGFRMQFMFYQYFAVFIFVVN
   227  277 A T  H  X S+     0   0   82   81   73  TTTTKKKKKQRRRRRRKKKAKNKKKKKEKRKRRRRRRRRKKKAKKKQASAESKEFREERYASQELAKEEE
   228  278 A R  H  <>S+     0   0   48   81   67  RRRRRRRRRRRRRRRRRRRRRRRRRRRKRKKKKKKKKKKKKKQQKKKQKYIQLKMQEAKMQQAEKSEVET
   229  279 A I  H ><5S+     0   0   61   81   23  IIIIIIIIIIIIIIIIIIIIIIIIIIILIIIIIIIIIIIIIIIIIIVIIQLIFIFICVIYIIIMIIIIML
   230  280 A R  H 3<5S+     0   0  195   81   73  RRRRRRRRRRRRRRRRRRRRRRRRRRRHRMMMMMMMMMMMMMMMRRMMMRSLERRLTILSKLIRRKCERN
   231  281 A M  T 3<5S-     0   0  135   81   85  MMMMMMMMMLMLLMMLMNTTAMTTTTSrATTTTTTTTTTTTTRRKKRRKLaKsNrYaSKrARRkTSKakn
   232  282 A G  T < 5 +     0   0   22   79   35  GGGGGGGGGGGGGGGGGGGGGGGGGGGsGGGGGGGGGGGGGGAGGGGGA.aAaAcGyGGcGASgCCGngc
   233  283 A Q      < +     0   0   94   79   69  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSSSSSSSSSSSSADKKKEQ.DSSEEKPKKDASVDDSEQDN
   234  284 A Y        -     0   0   43   81   19  YYYYYYYYYYYYYYYYYYYYYYYYYYYFYFFFFFFFFFFFFFYYYYYYYLYYYYYLVFYYYYIFWFFYFW
   235  285 A E        -     0   0  124   81   49  EEEEEEEEEEGGGEGGEEDDDTDDDDDGDEEEEEEEEEEDEEEEYYWEETDEDDYDTESEDEDEKEGEED
   236  286 A F        -     0   0   23   81    5  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFEFFFFFFFFYFYFFFFFFFFF
   237  287 A P    >>  -     0   0   50   81   66  PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPPPPPPDDDDPDDPQDPPINHDTVPDKVMDPHVE
   238  288 A N  T 34 S+     0   0  111   81   73  NNNNNNNNNNNNNNNKANTNNNNDNDDKAEEEEEEEEEEEEESSSSSSSIESNSSSMTGSSSRAEDSEAD
   239  289 A P  T 34 S+     0   0   92   81   54  PPPPPPTPPPPPPPPPPPPPPPPPTPPAEEEEEEEEEEEDEEPPPPAPPPEPDPPEPADPPPDPNDPAPE
   240  290 A E  T X4 S+     0   0   44   81   84  EEEEEEEEEEEEEEEEEEEEEEEEEEEGEEEEEEEEEEEEEEYYYYEYFFYFYYWPYEPWEFPYDGYYYE
   241  291 A W  G >< S+     0   0    1   80    7  WWWWWWWWWWWWWWWWWWWWWWWWWWWLWWWWWWWWWWWWWWWWWWWWWPWWWFWWWWWWWWWFWWWWFF
   242  292 A S  G 3  S+     0   0   61   80   68  SSSSSSSVSVASSASANSQKKQATKTTVGSSSSSSSSSSSSSDDDDKDDDSDGDDPDSPDDDPDKGDSDR
   243  293 A E  G <  S+     0   0  146   81   62  EEEEEEEEEDEEEEEDDHNNNNNNHNNNQQQQQQQQQQQQQQDTNNHENHEDNDENNANETDKGHTGGGD
   244  294 A V  S <  S-     0   0   14   81   18  VVVVVVVVVVVVVVVVVVVVVVVVVVVIVIIIIIIIIIIIIIIIVVVIIVVIVIVIIVVVVIVVIIIVVV
   245  295 A S    >>  -     0   0   41   81    7  SSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSS
   246  296 A E  H 3> S+     0   0   99   81   57  EEEEDDDEEEEEEQEEEEQQQQQQGKQCPEEEEEEEEEEEEEDETTIEEENEKPLDIDNLPEDQKDSSQD
   247  297 A E  H 3> S+     0   0   81   81   78  EEEEEEEEEEEDDEEDEEDADDASEAAASMMMMMMMMMMMMMSQDDGSSSESESNSXALNESNQDEQTQE
   248  298 A V  H <> S+     0   0    0   81   21  VVVVVVVAVAAAAAAAAAAAAAAAAAAAVAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   249  299 A K  H  X S+     0   0   30   81   15  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRIKKKKKKKKKKKKKKKRKKK
   250  300 A M  H  X S+     0   0   89   81   49  MMMMQQQDQQQQQSHQQQEDDDDDEDDQQDDDDDDDDDDDDDDDEEYDDIQDHDDDREDDNDDDADADDD
   251  301 A L  H  X S+     0   0    1   81   23  LLLLLLLLLLLLLLLLMLLLLLLLLLLLLVIVVVVVVVVIIIFFFFFFFLFFFLLLFFFLLFLLLLFFLF
   252  302 A I  H >X S+     0   0    0   81   12  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIVVVVVVVVVVVVVIIIIIIIIIIIIVIIIIVIIVIIVIIII
   253  303 A R  H 3< S+     0   0   90   81   67  RRRRRRRRRVRRRHRRQRRRRKKKRKKIKRRRRRRRRRRRRRNRSSHSRRSRNARTLRDGDRKCKRLCCS
   254  304 A N  H 3< S+     0   0   64   81   71  NNNNNNNHNQHLLRHLHQGGGGGGSGGQQKKKKKKKKKKKKKGHKKRHNGNHCKKKKSQKNHKKGHKKKK
   255  305 A L  H << S+     0   0    0   81   16  LLLLLLLLLLLLLLLLLLLMLMMMMMMLLLLLLLLLLLLLLLLLMMLLMLLLLMLMALLLMLMMLLTCML
   256  306 A L  S  < S+     0   0    3   81    5  LLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMMLLLMMLLLLLILLLLILLLLLLILLL
   257  307 A K        -     0   0   67   81   79  KKKKKKKKPKKKKKKKKKRNRNNNQNNKDKKKKKKKKKKKKKCEVVQCQKVETLVTRVNVTEDVVVVEVI
   258  308 A T  S    S+     0   0   63   81   71  TTTTTTTTVTTTTTTTTTTVTVVVTVVTTVVVVVVVVVVVVVKLVVMVKTLRVVLRLVVLVRPVSLKDVK
   259  309 A E  S >> S-     0   0   85   81   46  EEEEEEDEADDDDDDDDDEEDDDDEDDNDKKKKKKKKKKKKKIDNNDDNNEDENDDNNDDNDDQDDQDQE
   260  310 A P  G >4 S+     0   0   32   81   19  PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPPPPPVAPPPPAPPPPPPPPPSPPPPPPPPPPK
   261  311 A T  G 34 S+     0   0  102   81   74  TTTTTTTTSSTTTNTTSTTEAATSTSSSSEEEEEEEEEEEEEKRKKKDSASQTDKKATTHKQSSKDKASC
   262  312 A Q  G <4 S+     0   0  124   81   67  QQQQQQQQSEEEEEEEEEQKQKKKKEKEKEEEEEEEEEEEEERKDDKHMHLKKAKEDKFKKKRKEDKKKW
   263  313 A R  S << S-     0   0   32   81    2  RRRRRRRRGRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   264  314 A M        -     0   0   24   80   37  MMMMMMMM.MMLLMMLMMFLLFLLPLLMILLLLLLLLLLLLLVYAAMYYLLFYLLIPLMLIFLLWFMLLL
   265  315 A T     >  -     0   0   67   80   38  TTTTTTTT.TTTTTTTSTTTNTTRTRCTTTTTTTTTTTTTSTSTSSTTTGTTSSTSTTSSTTTSSSTTTS
   266  316 A I  H  > S+     0   0    8   80   64  IIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIICCAAACPAACAATAAAAVACAAMMAAAA
   267  317 A T  H  > S+     0   0   75   80   73  TTTTTTSN.GSTTTSMTTEEEEDEDQEGEEEEEEEEEEEEEELRGGDKEGEQKSFHTSGREQAQRTSTQT
   268  318 A E  H  > S+     0   0  114   80   46  EEEEEEEE.QQQQQQQQEDQEQQDQDDQQGGGGGGGGGGGGGQQEEQEQDEQQDQEEDQEQQREEQEEQA
   269  319 A F  H >< S+     0   0    0   80   70  FFFFFFFF.FFFFFFFFFVVVVVVVVVFMVVVVVVVVVVVVVAALLAAAAAAAVAVLAAAAAVVAVCAVA
   270  320 A M  H 3< S+     0   0   20   80   10  MMMMMMMM.MMMMMMMMMMMLMILMILMWLLLLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLL
   271  321 A N  H 3< S+     0   0  101   81   71  NNNNNNNNSNNNNNNNNKSMASRRQSRNRDDDDDDDDDDAADREEEIARPQQEAQCDRNQKQEDREEHDK
   272  322 A H  S XX S-     0   0   36   80   26  HHHHHHHQPHHHHHHHHQNNHNNNNNNHHHHHHHHHHHHHHHHHHHHHH DHHHHHDHHHVHHHCHHHHH
   273  323 A P  H 3> S+     0   0   62   80   37  PPPPPPPPLPPPPPPPPPKPKRKKKKKPPPPPPPPPPPPPPPPPKKPPP PLPPPPPPPPPLPPSPQPPP
   274  324 A W  H 34 S+     0   0    1   80    2  WWWWWWWWSWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWFWW
   275  325 A I  H X4 S+     0   0    1   80   28  IIIIIIIIWIIIIIIIIIIIIIIIIIIIILLLLLLLLLLLLLIIIIIII LIILVIILVVIILFIIILFL
   276  326 A M  H 3< S+     0   0   84   73   80  MMMMTTTIQSNNNNNN SARAAAAAAASSNNNNNNNNNNNNNSATT SV ASIATVTS  CSQN V SST
   277  327 A Q  T 3<  +     0   0   60   66   73  QQQQQQQQQQRQQKKQ KQRKQQQHQQQGSSSSSSSSSSCSSG    GG DGED D G  NGND G TDD
   278  328 A S  S X  S+     0   0    9   60   86  SSSSSSSSSSSSSSSS SYYYYYYFYYSSTTTTTTTTTTTTTG    DK  DN  D E  RDII S KI 
   279  329 A T  T 3  S+     0   0   89   59   83  TTTTMMMTMMMMMMMM VTTTTTSANNMMEEEEEEEEEEEEEE    TT  AN  T A  EAKK S VK 
   280  330 A K  T 3  S+     0   0  149   60   71  KKKKQQQQQAAVVVVE KEEEAQAADAVEAAAAAAAAAAAAAA    AA  AQ  V P  RAKE S PE 
   281  331 A V  S <  S-     0   0    5   59   60  VVVVIIIVVVVVVVVV VVVVVVVVVVVVLLLLLLLLLLLLLL     R  LT  A L  VFAA A AA 
   282  332 A P        -     0   0   68   58   59  PPPPPPPPPPPPPPPP PPPPPPPPPPPPDDDDDDDD DDDDT     S  DQ  P T  ADPD A TD 
   283  333 A Q        +     0   0  117   56   68  QQQQPPPQQQPQQSPQ LQQQQQQPQQSHNNNNNNNN NNNNK     Q  KP  D Q   KND A AD 
   284  334 A T        -     0   0   30   45   67  TTTTTTTTTTTTTTTT TTTTTTTTTTTT          VIIN     D  DL  K I   D D   ND 
   285  335 A P  E     -I  116   0C  98   44   65  PPPPPPPPPPPPPPPP QPPPPPPPPPPP          LLL      I  IP  P G   I A   LA 
   286  336 A L  E     -I  115   0C  11   41   29  LLLLLLLLLLLLLLLL LLLLLLLLLLLL          PPP      Y  L   I L   L     L  
   287  337 A H  S >> S+     0   0   65   37   78  HHHHHHHHHHHHHHHH HYHYHCCACCHL          SSS      Y      D S         P  
   288  338 A T  H 3> S+     0   0    0   37   41  TTTTTTTTTTTTTTTT TTTSTTTTTTTT          ASA      S      S S         K  
   289  339 A S  H 3> S+     0   0    4   37   75  SSSSSSSSSSAAATAA SNGVNGGGGGSP          QQQ      V      A E         V  
   290  340 A R  H X4 S+     0   0  143   37   58  RRRRRRRRRRRRRRRR QRRRKRRTRRRK          MMM      S      V I         R  
   291  341 A V  H >< S+     0   0   39   36   32  VVVVVVVVVVVVVVVV VIMVMMMVMMVI          MMM      V      L L            
   292  342 A L  H 3< S+     0   0   25   34    3  LLLLLLLLLLLLLLLL LLLLLLLLLLLL          MMM               L            
   293  343 A K  T << S+     0   0  109   34   63  KKKKKKKKKTQQQTQE TRKRKKKKKKTQ          DDD               S            
   294  344 A E    <   +     0   0  132   33   39  EEEEEEEEEEEEEEEE EEEEEEEEEEE           KKK               P            
   295  345 A D              0   0  129   33   55  DDDDEEEEEDDDDDDD EEGEGGGESGD           AAA               K            
   296  346 A K              0   0  240   18   17  KKKKKKKKK KKKRKK           K                             R            
## ALIGNMENTS   71 -   80
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1   44 A P              0   0  186    6   38          S 
     2   45 A Q        +     0   0  152    9   53          Q 
     3   46 A F        -     0   0  173    9  100          S 
     4   47 A H        +     0   0  159   10   83          S 
     5   48 A V        -     0   0   98   14   49          L 
     6   49 A K        -     0   0  146   14   34          K 
     7   50 A S        -     0   0   86   14   82          K 
     8   51 A G        -     0   0   57   14   82          R 
     9   52 A L        -     0   0   44   21   58     L    LV
    10   53 A Q        -     0   0  130   23   66     S    KE
    11   54 A I  E     -a   80   0A  41   25   84     P    SR
    12   55 A K  E     -a   81   0A  70   38   28     K    RE
    13   56 A K        +     0   0  123   42   83     V T  PH
    14   57 A N  S    S-     0   0   61   45   81    HK E  PN
    15   58 A A    >   -     0   0   41   46   73    DR D  SV
    16   59 A I  G >> S+     0   0   12   50   26    IR I  VV
    17   60 A I  G 34 S+     0   0  105   50   82    SV S  FM
    18   61 A D  G <4 S+     0   0  101   53   40    LG S  DE
    19   62 A D  T <4 S+     0   0   51   55   59    QK V  KQ
    20   63 A Y  E  <  -B   40   0A   6   72    0  Y YYYYYYYF
    21   64 A K  E     -B   39   0A 135   74   76  K DEIEKILQ
    22   65 A V  E     -B   38   0A  62   74   33  I LLMILMIV
    23   66 A T  E     -     0   0A  33   74   72  G GGSRTSEE
    24   67 A S  E    S+     0   0A 111   46   74  . ....S..I
    25   68 A Q  E     -     0   0A 108   74   65  K RRKEEKKQ
    26   69 A V  E     +B   36   0A  68   75   76  E ETTRLTEV
    27   70 A L  E     -     0   0A  72   78   13  LLVILLLLLL
    28   71 A G  E     -B   35   0A  29   78    7  GSGGGGGGGQ
    29   72 A L  E     +B   34   0A 141   78   93  KRRESSESSS
    30   73 A G  E >   -B   33   0A  47   79    4  GGGGGGGGGL
    31   74 A I  T 3  S+     0   0  174   79   79  SSETAAAAHK
    32   75 A N  T 3  S-     0   0   79   79   86  FFFFCFYCYH
    33   76 A G  E <   +B   30   0A  31   79   34  GSGAGSAGAP
    34   77 A K  E     -B   29   0A 131   78   81  VIVKEEKET.
    35   78 A V  E     -BC  28  50A  28   79   16  VVTVVVVVVN
    36   79 A L  E     -BC  26  49A  33   79   87  RYYRKVQKKI
    37   80 A Q  E     + C   0  48A  19   79   82  IMLFLLGLEI
    38   81 A I  E     -BC  22  47A   0   79   56  AVCAAAAAGH
    39   82 A F  E     -BC  21  46A  49   79   91  KRTKFQVFII
    40   83 A N  E  >  -B   20   0A  22   79   71  AEDNEESENE
    41   84 A K  T  4 S+     0   0  116   79   49  RKITRRLRKD
    42   85 A R  T  4 S+     0   0  223   79   77  NKKEKGQKRV
    43   86 A T  T  4 S-     0   0   80   79   39  STTNTSTTTF
    44   87 A Q     <  +     0   0  124   79   70  KGGDCAGCGL
    45   88 A E        -     0   0  116   79   63  KNEEKHKKES
    46   89 A K  E     +C   39   0A  59   79   77  LLKPKLEKVE
    47   90 A F  E     -C   38   0A  30   80   47  FYYVVVYVVS
    48   91 A A  E     -CD  37  95A  10   80    4  AAAAAAAAAK
    49   92 A L  E     -CD  36  94A   7   80   43  ILCIILVIII
    50   93 A K  E     -CD  35  93A  32   80    8  KKKKKKKKKC
    51   94 A M  E     + D   0  92A  45   81   61  MCSIICIIIM
    52   95 A L  E     - D   0  91A   5   81   26  ILILIIIIFV
    53   96 A Q  E     - D   0  90A 100   81   96  AKSDSPESHR
    54   97 A D        +     0   0   22   81   58  KKKKKKKKPI
    55   98 A C  S  > S-     0   0   51   81   83  NKkeRkqRqc
    56   99 A P  H  > S+     0   0   95   73   76  M.lv.lg.np
    57  100 A K  H >> S+     0   0  157   73   54  K.RQ.RH.DK
    58  101 A A  H 3> S+     0   0   10   75   62  N.TK.GS.DN
    59  102 A R  H 3X S+     0   0   88   76   55  F.AH.KR.HE
    60  103 A R  H < S+     0   0   46   81   82  VHRRRERRRY
    67  110 A R  H >< S+     0   0   87   81   78  ESrrenEeeS
    68  111 A A  H >< S+     0   0    0   76   75  I.vidiVdt.
    69  112 A S  T << S+     0   0    2   77   74  R.ECPAEPN.
    70  113 A Q  T <  S+     0   0   56   79   83  I.ITAVTAI.
    71  114 A C  S X  S-     0   0    6   79   97  L.MMLLLLL.
    72  115 A P  T 3  S+     0   0   92   79   79  K.KKNRYNM.
    73  116 A H  T 3  S+     0   0   31   80   72  ANHLVRQVR.
    74  117 A I  B <  S-f  162   0B   1   81   46  ALMVEICEVM
    75  118 A V        -     0   0    1   81   76  DEPKTSQTHL
    76  119 A R        -     0   0  117   81   63  hNkhehgehD
    77  120 A I  E     - E   0  95A   3   79   11  v.ivliili.
    78  121 A V  E     -     0   0A  56   79   32  M.VVKVLKV.
    79  122 A D  E     - E   0  94A  23   80   66  R.SRKAEKKA
    80  123 A V  E     -aE  11  93A   1   80   28  L.LLLLLLLL
    81  124 A Y  E     -aE  12  92A   1   80   71  Y.KFNEINLF
    82  125 A E  E     + E   0  91A  38   81   46  GEDEHDEHDQ
    83  126 A N  E     - E   0  90A  22   81   82  VISVpVFpsV
    84  127 A L  E     + E   0  89A 130   50   93  ....n..dv.
    85  128 A Y  E >  S- E   0  88A 142   79   75  Y.FMFHFFS.
    86  129 A A  T 3  S-     0   0   82   79   73  D.EGFEEFK.
    87  130 A G  T 3  S+     0   0   75   79   66  E.DSDSDDA.
    88  131 A R  E <   - E   0  85A 116   79   72  L.DKAPDAQ.
    89  132 A K  E     - E   0  84A 105   79   80  E.DAESTEI.
    90  133 A C  E     -DE  53  83A   4   79   92  R.ARDHRDQ.
    91  134 A L  E     -DE  52  82A   1   79   43  T.VIYLFYK.
    92  135 A L  E     -DE  51  81A  12   78   57  F.HFYYYYY.
    93  136 A I  E     -DE  50  80A   0   80   30  LRIIILLIL.
    94  137 A V  E     +DE  49  79A   0   80   14  IVVVVAVVV.
    95  138 A M  E     -DE  48  77A  15   81   27  LLMLLMFLLT
    96  139 A E        -     0   0   41   81   12  EREEEEEEEE
    97  140 A C        -     0   0   17   81   82  LRLYLLKLKY
    98  141 A L    >   +     0   0   23   81   55  ILCVMVLMVM
    99  142 A D  T 3   +     0   0   74   81   56  RSETETQEDG
   100  143 A G  T 3  S-     0   0    6   81    3  GGGGGGGGDG
   101  144 A G    <   -     0   0   27   81    1  SGGGGGGGGG
   102  145 A E  B  >  -G  150   0B  79   81   11  NEEEEESEEE
   103  146 A L  H  > S+     0   0    0   81    2  LLLLLLILLL
   104  147 A F  H  > S+     0   0   29   81    4  MFFFFFLFFF
   105  148 A S  H  > S+     0   0   49   81   62  DDDEDDADDD
   106  149 A R  H >< S+     0   0   49   81   17  RRRIKRHRRY
   107  150 A I  H >< S+     0   0    5   80    4  IIIIVIIVIV
   108  151 A Q  H 3< S+     0   0   61   80   87  LLVAVMQVIV
   109  152 A D  T << S+     0   0  111   81   63  KDATGEKGKD
   110  153 A R    <   +     0   0   65   81   51  TRRNNRRNKR
   111  154 A G        +     0   0   42   81   69  KGGGKGKKVG
   112  155 A D  S    S+     0   0  147   81   84  LVHRRSHRST
   113  156 A Q  S    S-     0   0  123   80   86  LYYLLYFLLL
   114  157 A A        -     0   0   44   80   68  FTTKKTNKRS
   115  158 A F  E     -I  286   0C   3   47   85  S.........
   116  159 A T  E  >  -I  285   0C  19   48   64  E.........
   117  160 A E  H  > S+     0   0    3   81   15  REEEEEEEQE
   118  161 A R  H  > S+     0   0   67   81   71  EQREAKLAEV
   119  162 A E  H  > S+     0   0   57   66   40  .DAETDETEE
   120  163 A A  H  X S+     0   0    0   67   20  AAAACAACTA
   121  164 A S  H  X S+     0   0    0   81   63  ASARKSSKKS
   122  165 A E  H  X S+     0   0   83   81   75  KKAKLHRLAT
   123  166 A I  H >X S+     0   0   14   81   43  LVVYYLVYLI
   124  167 A M  H 3X S+     0   0    0   81   62  TIMFFVVFFV
   125  168 A K  H 3X S+     0   0   58   81   59  KKKQYGRYNR
   126  169 A S  H <>S+     0   0    0   81   71  LLCCLLLLLL
   135  178 A H  H ><5S+     0   0   15   81    0  HHHHHHHHHH
   136  179 A S  H 3<5S+     0   0   82   81   76  SKKSESTESA
   137  180 A I  T <<5S-     0   0   43   81   82  INQRNLKNQR
   138  181 A N  T < 5S+     0   0   63   81   49  LSGGGGGGNG
   139  182 A I  E   < -J  170   0D   0   81   10  IIVVIIIIII
   140  183 A A  E     -J  169   0D   0   81   60  TVMYIVAIII
   141  184 A H        -     0   0    0   81    2  HHHHHHHHHH
   142  185 A R        +     0   0   93   81    3  RRRRRRRRRR
   143  186 A D        +     0   0   21   81    1  DDDDDDDDDD
   144  187 A V        +     0   0    5   81   19  LLLLLLLLIL
   145  188 A K    >   -     0   0   85   81    0  KKKKKKKKKK
   146  189 A P  G >  S+     0   0   28   81    3  PPPLPPPPPP
   147  190 A E  G 3  S+     0   0   99   81    1  EEEEEEEEEE
   148  191 A N  G <  S+     0   0   15   81    0  NNNNNNNNNN
   149  192 A L  E <   + H   0 162B   2   81   18  LLFLVLIVIL
   150  193 A L  E     -GH 102 161B  30   81    0  MLLLLLLLLM
   151  194 A Y  E     - H   0 160B  21   80   23  YFFLLYCLLL
   152  195 A T  S    S-     0   0   29   80   82  AYADSAESNT
   153  196 A S        -     0   0   29   80   64  SSNASTSSIS
   154  197 A K  S    S+     0   0  154   81   74  dPKSQPPQtK
   155  198 A R  S >  S-     0   0  163   78   81  pEK.EFEKpS
   156  199 A P  T 3  S+     0   0  124   80   85  EEE.EEKEDR
   157  200 A N  T 3  S+     0   0  114   80   50  YNT.DDVDEG
   158  201 A A    <   -     0   0   16   81   46  SASGCSSCKA
   159  202 A I        -     0   0   62   81   85  TKPNLKPLQS
   160  203 A L  E     - H   0 151B   7   81   29  IILLIIVILV
   161  204 A K  E     - H   0 150B  26   81   31  KMKKKMkKgK
   162  205 A L  E     +fH  74 149B   2   81   32  LIAVIVlIiI
   163  206 A T        +     0   0   21   81   66  CSISTSNTAI
   164  207 A D        -     0   0   37   81    1  DDDDDDNDDD
   165  208 A F    >   +     0   0    2   81    3  FFFFFFSFFF
   166  209 A G  T 3  S+     0   0   35   81    2  gGgggGCggG
   167  210 A F  T 3  S+     0   0  111   80   22  mLfllL.lfL
   168  211 A A    <   -     0   0   17   81   54  CSFTGSTGTA
   169  212 A K  E     -J  140   0D 106   81   40  SKKEEKPEGK
   170  213 A E  E     -J  139   0D  87   81   79  STPQTIITEL
   171  214 A T              0   0    8   81   77  pvgvsqtsil
   172  215 A T              0   0  119   81   70  faitlaplld
   173      ! !              0   0    0    0    0  
   174  224 A C              0   0  160   81   60  CCVCCCCCCD
   175  225 A Y        +     0   0  218   81   86  GGGGGGGGGK
   176  226 A T  S    S+     0   0  113   81   17  TTSTTTSTTT
   177  227 A P    >   +     0   0   62   81   16  PPPPPPAPPA
   178  228 A Y  T 3  S+     0   0  203   81   82  GGYNTGETSS
   179  229 A Y  T 3  S+     0   0  180   81    3  YYYYYYYYYF
   180  230 A V    <   -     0   0   61   81   32  MVMVLVMLVL
   181  231 A A    >>  -     0   0   36   81    6  AgAAAgAAAg
   182  232 A P  T 34 S+     0   0  100   81    0  PpPPPpPPPp
   183  233 A E  T 34 S+     0   0  155   81   18  EHEEEEEEEE
   184  234 A V  T <4 S+     0   0   99   81   19  VSVVVAVVVM
   185  235 A L  S  < S-     0   0  129   81   14  LLLILCVLLL
   186  236 A G        -     0   0   34   81   78  diRevWenLQ
   187  237 A P        +     0   0  117   75   65  hq.rt.atKR
   188  238 A E        -     0   0   68   80   90  RKRGA.TASQ
   189  239 A K        -     0   0  158   80   83  SPNYG.FGDA
   190  240 A Y  S    S+     0   0  154   80   13  YYYDY.YYYY
   191  241 A D        +     0   0   41   81   47  DSGGNEDNSS
   192  242 A K  S  > S+     0   0   35   81   51  SQPARWKRSM
   193  243 A S  H  > S+     0   0   22   81   60  KAEAAARAKS
   194  244 A C  H  > S+     0   0   50   81   50  VVIAVSCVVV
   195  245 A D  H  > S+     0   0    0   81    0  DDDDDDDDDD
   196  246 A M  H  X S+     0   0    4   81   49  VCVICTLCMM
   197  247 A W  H >X S+     0   0   47   81    4  WWWWWEWWWW
   198  248 A S  H 3X S+     0   0   25   81   13  SSSSSRSSSA
   199  249 A L  H 3X S+     0   0    0   81   37  LIACLHLLAL
   200  250 A G  H X S+     0   0    4   81    3  YYYYFAYFYY
   205  255 A I  H >X S+     0   0   19   81   21  VIIVICIIVV
   206  256 A L  H 3< S+     0   0    0   81   22  LLLLCAMCCL
   207  257 A L  H << S+     0   0    4   81    3  LLLLLLLLLL
   208  258 A C  H << S-     0   0    0   81   21  CCCASCSSCC
   209  259 A G  S  < S+     0   0   11   81    1  GGgGGGGGGG
   210  260 A Y  S    S-     0   0   35   81   16  YYfFYYYYFC
   211  261 A P        -     0   0   42   81   29  LPQLPPPPPL
   212  262 A P  S    S+     0   0   10   81    4  PPTPPPPPPP
   213  263 A F  S    S-     0   0   18   81    6  HFFFFFFFFF
   214  264 A Y        -     0   0  148   81   49  PFYESYVSSD
   215  265 A S        +     0   0   22   81   61  WElDEDgEDD
   216  266 A N        -     0   0  116   45   59  ..i...e...
   217  267 A H  S    S+     0   0  148   46   59  ..S...V...
   218  268 A G  S    S-     0   0   77   46   39  ..G...C...
   219  269 A L  S    S+     0   0   77   50   90  V.K.H.RHS.
   220  270 A A  S    S+     0   0   81   71   72  EEEDREVKL.
   221  271 A I  S    S+     0   0   12   71   74  NNTNTSCTG.
   222  272 A S  S    S+     0   0   52   75   72  AEEIQDQQPD
   223  273 A P  S  > S+     0   0   81   81   74  ETQIVPNVPG
   224  274 A G  H  > S+     0   0    7   81   59  TLGASEKSSG
   225  275 A M  H  > S+     0   0   45   81   41  TLVLLLLLMK
   226  276 A K  H  > S+     0   0  150   81   90  LFAYKFFKRI
   227  277 A T  H  X S+     0   0   82   81   73  RSQKDNEDDA
   228  278 A R  H  <>S+     0   0   48   81   67  RKAKQQSQQN
   229  279 A I  H ><5S+     0   0   61   81   23  MIIIIIIIIE
   230  280 A R  H 3<5S+     0   0  195   81   73  RMISTLQTLK
   231  281 A M  T 3<5S-     0   0  135   81   85  SRRESRESTa
   232  282 A G  T < 5 +     0   0   22   79   35  TAS.GAGGGa
   233  283 A Q      < +     0   0   94   79   69  DEA.KSKKKK
   234  284 A Y        -     0   0   43   81   19  LYIAYYYYFF
   235  285 A E        -     0   0  124   81   49  EADQNEENAG
   236  286 A F        -     0   0   23   81    5  FFFFFFFFFL
   237  287 A P    >>  -     0   0   50   81   66  KHKTIDPIYR
   238  288 A N  T 34 S+     0   0  111   81   73  PSRCPSDPSF
   239  289 A P  T 34 S+     0   0   92   81   54  EPDPEPKEPP
   240  290 A E  T X4 S+     0   0   44   81   84  FFPSVFDVYR
   241  291 A W  G >< S+     0   0    1   80    7  WWW.WWWWWW
   242  292 A S  G 3  S+     0   0   61   80   68  EDP.ADSADA
   243  293 A E  G <  S+     0   0  146   81   62  KDRWEDHEDS
   244  294 A V  S <  S-     0   0   14   81   18  IIVFVIIVIg
   245  295 A S    >>  -     0   0   41   81    7  SSSSSSSSEs
   246  296 A E  H 3> S+     0   0   99   81   57  ADDTEENEDE
   247  297 A E  H 3> S+     0   0   81   81   78  TSSGKSEKSS
   248  298 A V  H <> S+     0   0    0   81   21  CAAAAAAAVA
   249  299 A K  H  X S+     0   0   30   81   15  KKKKLKKLLK
   250  300 A M  H  X S+     0   0   89   81   49  DDDKDDDDHD
   251  301 A L  H  X S+     0   0    1   81   23  LFLLLFLLLL
   252  302 A I  H >X S+     0   0    0   81   12  IIVIVIIVVL
   253  303 A R  H 3< S+     0   0   90   81   67  CGRTKRSKTR
   254  304 A N  H 3< S+     0   0   64   81   71  KNKRKHKKNN
   255  305 A L  H << S+     0   0    0   81   16  MMMILLLLLL
   256  306 A L  S  < S+     0   0    3   81    5  LMLLLLLLLL
   257  307 A K        -     0   0   67   81   79  SKEDVEVIVE
   258  308 A T  S    S+     0   0   63   81   71  LKPPVRRVVV
   259  309 A E  S >> S-     0   0   85   81   46  DDDNDDDDND
   260  310 A P  G >4 S+     0   0   32   81   19  APPPPPAPSS
   261  311 A T  G 34 S+     0   0  102   81   74  ATRTKQKKDT
   262  312 A Q  G <4 S+     0   0  124   81   67  QKKTAKQAVN
   263  313 A R  S << S-     0   0   32   81    2  RRRRRRRRRR
   264  314 A M        -     0   0   24   80   37  LFLIFFLFFF
   265  315 A T     >  -     0   0   67   80   38  STSTTTSTST
   266  316 A I  H  > S+     0   0    8   80   64  ATAITCATVA
   267  317 A T  H  > S+     0   0   75   80   73  ADASEQAEIE
   268  318 A E  H  > S+     0   0  114   80   46  QQEQEQQEEQ
   269  319 A F  H >< S+     0   0    0   80   70  VAVIAAVAAA
   270  320 A M  H 3< S+     0   0   20   80   10  LLLLLLLLML
   271  321 A N  H 3< S+     0   0  101   81   71  EKEERQQREA
   272  322 A H  S XX S-     0   0   36   80   26  HHHDHHHHHH
   273  323 A P  H 3> S+     0   0   62   80   37  SPSPPLPPPP
   274  324 A W  H 34 S+     0   0    1   80    2  WWWWWWWWWW
   275  325 A I  H X4 S+     0   0    1   80   28  IVIFLIVLFV
   276  326 A M  H 3< S+     0   0   84   73   80   ALKQSQQKT
   277  327 A Q  T 3<  +     0   0   60   66   73    NKDGGDK 
   278  328 A S  S X  S+     0   0    9   60   86    AG D. S 
   279  329 A T  T 3  S+     0   0   89   59   83    KY T.   
   280  330 A K  T 3  S+     0   0  149   60   71    KK AQ   
   281  331 A V  S <  S-     0   0    5   59   60    AP FA   
   282  332 A P        -     0   0   68   58   59    PP DP   
   283  333 A Q        +     0   0  117   56   68    N  RE   
   284  334 A T        -     0   0   30   45   67    V  DR   
   285  335 A P  E     -I  116   0C  98   44   65    S  IG   
   286  336 A L  E     -I  115   0C  11   41   29    L  LL   
   287  337 A H  S >> S+     0   0   65   37   78        P   
   288  338 A T  H 3> S+     0   0    0   37   41        T   
   289  339 A S  H 3> S+     0   0    4   37   75        P   
   290  340 A R  H X4 S+     0   0  143   37   58        Q   
   291  341 A V  H >< S+     0   0   39   36   32        V   
   292  342 A L  H 3< S+     0   0   25   34    3        L   
   293  343 A K  T << S+     0   0  109   34   63        Q   
   294  344 A E    <   +     0   0  132   33   39        R   
   295  345 A D              0   0  129   33   55        N   
   296  346 A K              0   0  240   18   17            
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1   44 A   0   0   0   0   0   0   0   0   0  83  17   0   0   0   0   0   0   0   0   0     6    0    0   0.451     15  0.61
    2   45 A   0  11   0   0   0   0   0   0   0   0   0   0   0  11   0   0  78   0   0   0     9    0    0   0.684     22  0.47
    3   46 A   0   0   0   0  44   0   0   0   0   0  11  11   0   0   0   0  33   0   0   0     9    0    0   1.215     40 -0.01
    4   47 A   0   0   0   0   0   0   0  10   0  10  20   0   0  30   0   0  20   0   0  10    10    0    0   1.696     56  0.17
    5   48 A  29  57   0   0   0   0   0   0   0   7   0   7   0   0   0   0   0   0   0   0    14    0    0   1.055     35  0.50
    6   49 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   7  71  21   0   0   0    14    0    0   0.759     25  0.65
    7   50 A   0   0   0   0   0   0   0   0   7   7  43   0   0   7   7   7   0   0  21   0    14    0    0   1.636     54  0.17
    8   51 A   0   0   0   0   0   0   0  29   0   0   0  29   0   0   7   0  21   0   7   7    14    0    0   1.611     53  0.18
    9   52 A  10  67   0   0   0   0   0   0   0   0   0   0   0   0  19   0   5   0   0   0    21    0    0   0.955     31  0.42
   10   53 A   0   0   0   0   0   0   0   0   0   0   4   9   0   4   9   9  48  17   0   0    23    0    0   1.567     52  0.33
   11   54 A   0   0  44   0   4   0   0   0   0  32   4   4   0   0   4   8   0   0   0   0    25    0    0   1.443     48  0.15
   12   55 A   0   0   0   0   0   0   0   0   0   0   0   0   0   3   8  82   5   3   0   0    38    0    0   0.713     23  0.72
   13   56 A   2   2   0   0   0   0   2   0   0   2   5  21   0   2  14  29   0  17   0   2    42    0    0   1.944     64  0.16
   14   57 A   4   0   2   0   0   0   4   0   0   2   9  31   0  13   0   4   0   7  22   0    45    0    0   1.946     64  0.19
   15   58 A   4   2   0   0   0   0   0   2  37  17  24   0   0   0   2   0   0   0   2   9    46    0    0   1.696     56  0.27
   16   59 A  20   8  66   0   4   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0    50    0    0   1.005     33  0.74
   17   60 A  10  24   4   2   2   0   0   0   2   0  10  40   0   0   2   0   0   2   2   0    50    0    0   1.768     59  0.17
   18   61 A   0   2   0   0   0   0   0   2   0   0   6   0   0   0   0   0   2  34   6  49    53    0    0   1.266     42  0.60
   19   62 A   5   0   0   2   0   0   2   0   0   0   4   0   0   2   0   5   4  25   2  49    55    0    0   1.547     51  0.41
   20   63 A   0   0   0   0   4   0  96   0   0   0   0   0   0   0   0   0   0   0   0   0    72    0    0   0.173      5  0.99
   21   64 A   0   4   4   0   0   0   0   0   1   0   9   5   0   0   5  24   5  19  14   8    74    0    0   2.147     71  0.24
   22   65 A  23  24  43   4   3   0   1   0   0   0   0   1   0   0   0   0   0   0   0   0    74    0    0   1.388     46  0.66
   23   66 A   0   0   0   0   0   0   0  19   1   0  22  19   0   1   5   7   1   5  19   0    74    0    0   1.948     65  0.27
   24   67 A   0   0   2   0   0   0   0   2   2   0  17  30   0   0   0  22   0   0  11  13    46    0    0   1.755     58  0.26
   25   68 A   1   0   0   0   0   0   0   0   1   0   3   8   0   3  14  15  39  12   3   1    74    0    0   1.848     61  0.34
   26   69 A  47   4   1   1   0   0   0   0   1   0   0   8   0   0   1  21   0  15   0   0    75    0    0   1.528     51  0.23
   27   70 A   3  85  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    78    0    0   0.499     16  0.86
   28   71 A   0   0   0   0   0   0   0  96   0   0   1   0   0   0   1   0   1   0   0   0    78    0    0   0.205      6  0.92
   29   72 A   3  33   1   0   0   0   0   3  19   0  12   1   0   1  12   8   1   6   0   0    78    0    0   1.966     65  0.06
   30   73 A   0   1   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0    79    0    0   0.068      2  0.96
   31   74 A   6   0  46   0   0   0   0   0  19   0  13   1   0   4   1   1   1   3   5   0    79    0    0   1.699     56  0.21
   32   75 A   0   0   0   0  30   0  10   0   0   0  18   3   3   4   0   0   0   0  33   0    79    0    0   1.577     52  0.14
   33   76 A   0   0   0   0   0   0   0  66   8   1  25   0   0   0   0   0   0   0   0   0    79    0    0   0.874     29  0.65
   34   77 A  17   0   6   0   0   0   0   0   0  14   1   8   0   0   3  38   3  10   0   0    78    0    0   1.793     59  0.19
   35   78 A  91   0   1   0   0   0   0   0   0   0   1   4   0   0   1   0   0   0   1   0    79    0    0   0.430     14  0.84
   36   79 A  15  23   4   1   3   3  10   0   0   0   0   1   1   1  27  10   1   0   0   0    79    0    0   2.026     67  0.13
   37   80 A  16  14   3   3   1   0   0   1   1   1   0   0   0   0   9   3  15  33   0   0    79    0    0   1.939     64  0.17
   38   81 A   6   0  10   0   0   0   0   4  16   0   3   0  58   1   0   0   0   1   0   0    79    0    0   1.346     44  0.44
   39   82 A  22   0   5   4  23   0   6   0   1   0   3  14   0   1   5   5   5   6   0   0    79    0    0   2.224     74  0.08
   40   83 A   0   0   0   0   0   0   0   0   1   0  10   0   4  15   1  22   5  16  18   8    79    0    0   2.034     67  0.28
   41   84 A   3   5   3   0   0   0   0   0   0   0   1   3   0   0  28  56   0   0   1   1    79    0    0   1.278     42  0.51
   42   85 A   5   1   0   0   1   0   0   5   9   0  20   0   0   0  15  28   4   6   1   4    79    0    0   2.072     69  0.23
   43   86 A   0   0   0   0   1   0   0   0   1   0  23  70   0   0   0   1   1   0   3   0    79    0    0   0.903     30  0.60
   44   87 A   0   1   0   1   0   0   0  41   3   0   4   0   4   0   1  19  20   1   3   3    79    0    0   1.754     58  0.30
   45   88 A   0   3   0   1   0   0   0   1   4   0   3   0   0   8   5  14  16  38   1   6    79    0    0   1.937     64  0.37
   46   89 A   3  11   1   0   0   0   0   1   1   6   1   3   0   1  18  39   4   5   4   1    79    0    0   2.013     67  0.23
   47   90 A  16   3   0   0  46   1  21   0   0   0   1   0  11   0   0   0   0   0   0   0    80    0    0   1.429     47  0.53
   48   91 A   0   0   0   0   0   0   0   1  98   0   0   0   0   0   0   1   0   0   0   0    80    0    0   0.134      4  0.96
   49   92 A   9  56  20   6   0   0   0   0   4   0   0   0   4   0   0   0   1   0   0   0    80    0    0   1.333     44  0.57
   50   93 A   0   1   0   0   0   0   0   0   0   0   0   0   1   0   0  96   1   0   0   0    80    0    0   0.201      6  0.91
   51   94 A  20   7  35  16   0   0   0   0   0   0   5   1  15   0   0   1   0   0   0   0    81    0    0   1.714     57  0.39
   52   95 A   5  62  32   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.865     28  0.73
   53   96 A   1  14   1   0   9   0  11   0   1   5   6   0   0   2   7  11  14   4   5   9    81    0    0   2.492     83  0.03
   54   97 A   0   0   1   0   0   0   0   0   1   1   1   4   0   0   5  35   0   1   0  51    81    0    0   1.254     41  0.41
   55   98 A   0   0   0   0   2   0   0   0   4   0  15   6  15   0  21  19   4   1  12   1    81    0    0   2.080     69  0.16
   56   99 A   8  18   1   1   0   0   0   1   7  48   3   3   0   0   0   0   0   7   1   1    73    0    0   1.723     57  0.23
   57  100 A   1   4   0   0   0   0   0   0   0   1   7   0   0   3   8  64   4   1   3   3    73    0    0   1.407     46  0.45
   58  101 A   0   0   0   0   0   0   0   7  55   5   8   5   1   0   1   9   4   0   3   1    75    0    0   1.645     54  0.38
   59  102 A   0   0   0   0   3   0   0   4   3   1   3   0   0   3  62  17   0   4   1   0    76    0    0   1.351     45  0.44
   60  103 A   4   1   1   0   0   0   1   0   1   1   1   0   0   1  37   9   5   5  16  16    81    0    0   1.966     65  0.25
   61  104 A   1   5   0   0   1   0   0   1   4   1   0   0   0   0   3   3   3  65   0  12    75    0    0   1.338     44  0.50
   62  105 A  61   4   7   1   1   0   1   0   1   0   4   0   0   1   1   7   3   5   0   3    76    0    0   1.605     53  0.35
   63  106 A   3   1   0   0   0   0   0   3   6   0   5   0   0   0  18   6   4  28   6  20    79    0    0   2.027     67  0.27
   64  107 A   5  60   6   2   0   0   1   0   0   0   4   2   1   6   0   1   2   0   4   4    81    0    0   1.600     53  0.38
   65  108 A  10   2   1   0   2   0   0   1   4   0   0   1   1  54   1   0   7  10   1   2    81    0    0   1.703     56  0.28
   66  109 A   1   1   5  15   4  36   2   1   0   0   1   1   1   2  15   1   2   2   7   0    81    0    0   2.142     71  0.18
   67  110 A   0   1   1  15   0   0   0   0   2   0   4   2   0   0  40   0   4  28   2   0    81    0    0   1.634     54  0.21
   68  111 A  18   3  17   1   0   0   0   0  33   0   0   3  18   0   0   0   0   4   0   3    76    0    0   1.763     58  0.24
   69  112 A   1   1   5   3   0   0   0   0  22   3  43   1   3   0   4   0   1   8   3   3    77    0    0   1.875     62  0.26
   70  113 A   9   3  19   0   0   0   0  24   6   1   3  15   0   0   1   4  10   1   3   1    79    0    0   2.190     73  0.17
   71  114 A   4  27   1   9   0   0   0   8   0   0   1   0  28  19   1   3   0   0   0   0    79    0    0   1.817     60  0.02
   72  115 A   1   5   0   3   0   0   1   0   1  33   9   1   1   1  18  13   8   0   4   1    79    0    0   2.100     70  0.20
   73  116 A   3   4   1   0   0   0   0   0   1   0   3   0   0  38  13   8   5   3  20   4    80    0    0   1.926     64  0.27
   74  117 A  12  14  56   7   1   0   0   0   1   0   1   0   1   1   2   0   0   2   0   0    81    0    0   1.503     50  0.53
   75  118 A  56   4   0   1   0   0   0   0   0   4  11   2   0   1   1   7   2   2   4   4    81    0    0   1.689     56  0.24
   76  119 A   0   0   0   0   0   0   0   4   0   0   2   0   1  32  12   6  19   5  15   4    81    0    0   1.928     64  0.36
   77  120 A  10   4  85   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0    79    0    0   0.551     18  0.89
   78  121 A  33  14  44   5   0   0   0   0   0   0   0   0   0   0   0   3   0   1   0   0    79    0    0   1.300     43  0.67
   79  122 A   0   0   0   0   0   0   0   1   5   0   6   5   0   1   8  14   8  17   0  35    80    0    0   1.916     63  0.33
   80  123 A  49  45   3   3   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    80    0    0   0.949     31  0.71
   81  124 A   4   3   6   0  16   0  46   0   1   0   0   0   1   5   0   8   0   8   3   0    80    0    0   1.781     59  0.28
   82  125 A   0   1   0   0   0   0   1   4  16   0   0   0   0   2   0   0   1  52   0  22    81    0    0   1.345     44  0.54
   83  126 A  17   2   5   0   6   1   2   0   2   2   2   4   1   0   0   0   0   0  53   0    81    0    0   1.648     54  0.18
   84  127 A   4  18   6  14   4   0   4   0   2   0   4  12   0   0   0   0   0  26   2   4    50    0    0   2.158     72  0.07
   85  128 A   1   0   1   1  23   0  33   1   0   0  18   0   1  14   1   0   1   0   0   4    79    0    0   1.795     59  0.25
   86  129 A   3   0   0   0   3   0   0   9   8   0  20   0   0   6   3   1  13  27   4   5    79    0    0   2.132     71  0.26
   87  130 A   0   0   1   0   0   0   0  29   1  18  18   6   0   0   0   0   0   9   5  13    79    0    0   1.885     62  0.34
   88  131 A   1   1   0   0   0   0   0   4   3  10   4   4   0   0  33  23   3   4   5   6    79    0    0   2.054     68  0.27
   89  132 A   1   0   1   1   0   0   0   4  19   1   8   8   0   0  13  25   0   5   4  10    79    0    0   2.169     72  0.20
   90  133 A   0   0   0   3   3   0   4   0   3   0   1   0  39   8  23   6   1   3   3   5    79    0    0   1.926     64  0.08
   91  134 A   6  66   6   0   6   0   8   0   0   0   0   1   3   1   1   1   0   0   0   0    79    0    0   1.309     43  0.56
   92  135 A   1  54   0   0   6   0  27   0   1   0   1   0   1   8   0   0   0   0   0   0    78    0    0   1.283     42  0.43
   93  136 A  11  38  50   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0    80    0    0   1.015     33  0.70
   94  137 A  80   1  15   0   0   0   0   0   4   0   0   0   0   0   0   0   0   0   0   0    80    0    0   0.641     21  0.85
   95  138 A   1  14   0  73   2   0   0   0   0   0   0  10   0   0   0   0   0   0   0   0    81    0    0   0.876     29  0.72
   96  139 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   4  86   1   7    81    0    0   0.549     18  0.87
   97  140 A   0  33   1  16   4   1   7   0   0   0   0   0  33   0   1   2   0   0   0   0    81    0    0   1.595     53  0.18
   98  141 A  23  14   2  46   0   0   1   0   6   0   0   0   7   0   0   0   0   0   0   0    81    0    0   1.480     49  0.45
   99  142 A   0   0   0   0   0   0   0   4   2   0   2  23   0   1   1   1   2  48   1  12    81    0    0   1.564     52  0.43
  100  143 A   0   0   0   0   0   0   0  98   0   1   0   0   0   0   0   0   0   0   0   1    81    0    0   0.133      4  0.97
  101  144 A   0   0   0   0   0   0   0  99   0   0   1   0   0   0   0   0   0   0   0   0    81    0    0   0.067      2  0.98
  102  145 A   0   0   0   0   0   0   0   0   0   1   1   1   0   0   0   1   0  93   1   1    81    0    0   0.397     13  0.88
  103  146 A   1  98   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.133      4  0.97
  104  147 A   0   2   0   2  95   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.231      7  0.95
  105  148 A   0   0   1   0   0   0   0   0   1   0  21   1   0  16   1   0  11   5   1  41    81    0    0   1.651     55  0.37
  106  149 A   0   0   1   0   0   0   1   0   0   0   0   0   0   5  90   1   0   0   0   1    81    0    0   0.459     15  0.82
  107  150 A   5   1  94   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    80    0    0   0.265      8  0.96
  108  151 A  17   6  11   3   0   0   0   0   3   0  17   1   1   0   1   0  39   0   0   0    80    0    0   1.745     58  0.13
  109  152 A   1   2   0   0   0   0   0   4  12   0   4   2   0   0   0   7  17  22   0  27    81    0    0   1.924     64  0.37
  110  153 A   0   0   0   1   0   0   0   0   0   0   0   1   0  16  46  27   2   1   5   0    81    0    0   1.408     47  0.49
  111  154 A   1   0   0   0   0   0   0  48   9   1   1   6   0   0  16   9   1   5   2   0    81    0    0   1.698     56  0.31
  112  155 A   2   1   0   0   5   0   6   0   2   0  12   1   0  26   4   1   2   4   0  32    81    0    0   1.975     65  0.15
  113  156 A   0   8   0   0  25   0  28   9   0   0   3   0   0   0   0   1  25   1   1   0    80    0    0   1.712     57  0.14
  114  157 A   0   1   0   0   3   0   1   0  32   3  14  38   0   0   1   4   0   0   4   0    80    0    0   1.601     53  0.31
  115  158 A   0   0   0   0  68   0   0   0   0   0   2   0   0   0   0   0   0  30   0   0    47    0    0   0.704     23  0.14
  116  159 A   0   0   0   0   0   0   0   0  10   0   6  63   0   0   6   8   2   2   0   2    48    0    0   1.325     44  0.36
  117  160 A   0   0   0   0   0   0   0   0   1   0   0   0   0   0   1   1   2  85   0   9    81    0    0   0.602     20  0.85
  118  161 A   2   1   0   1   0   0   0   0  22   0   0   0   0   1  41  25   2   4   0   0    81    0    0   1.513     50  0.29
  119  162 A   0   0   0   3   0   0   0   0   2   0   2   3   0   0   0   0  15  56   0  20    66    0    0   1.269     42  0.59
  120  163 A   3   0   0   0   0   0   0   0  88   0   0   3   4   0   0   0   1   0   0   0    67    0    0   0.523     17  0.80
  121  164 A   4   0   2   0   0   0   0   0  26   0  49   2   0   0   6  10   0   0   0   0    81    0    0   1.404     46  0.37
  122  165 A   2   5   2   0   0   0   0   1   2   0   1   4   1   9   5   9  21  31   1   5    81    0    0   2.173     72  0.24
  123  166 A  32  17  40   0   1   1   4   0   1   0   0   0   1   1   0   1   0   0   0   0    81    0    0   1.483     49  0.56
  124  167 A  16   4  17  36   5   0   0   0   1   0   0  20   0   0   0   0   1   0   0   0    81    0    0   1.664     55  0.38
  125  168 A   1   1   0   0   0   0   2   4   2   0   0   0   0  10  32  40   6   0   1   0    81    0    0   1.600     53  0.40
  126  169 A   2   0   4   1   0   0   0   0   0   0  12   6   0   0   1   4  40   9   2  19    81    0    0   1.856     61  0.33
  127  170 A  19   9  65   4   0   0   0   0   2   0   0   1   0   0   0   0   0   0   0   0    81    0    0   1.069     35  0.74
  128  171 A   4  26   5   0   0   0   0  25  21   0   1   6  12   0   0   0   0   0   0   0    81    0    0   1.778     59  0.15
  129  172 A   2  20   2   1   0   0   0   6   2   0   9  10   0   0   0   7   4  25   2   9    81    0    0   2.224     74  0.16
  130  173 A   7   0   0   0   0   0   0   4  85   0   4   0   0   0   0   0   0   0   0   0    81    0    0   0.574     19  0.77
  131  174 A  38  23  36   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    81    0    0   1.167     38  0.71
  132  175 A   2   0   0   0   0   0   1   2  10   0   9   0   0   4  12   9  35  10   1   5    81    0    0   2.068     69  0.28
  133  176 A   1   0   0   1   6   0  62   0   0   0   1   2   0  26   0   0   0   0   0   0    81    0    0   1.074     35  0.54
  134  177 A   0  65   1   4   0   0   0   0   0   0   0   0  30   0   0   0   0   0   0   0    81    0    0   0.814     27  0.29
  135  178 A   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    81    0    0   0.000      0  1.00
  136  179 A   0  12   0   1   0   0   1   2   6   0  44   1   0   1   5   4   4   9   1   7    81    0    0   1.950     65  0.23
  137  180 A   2  25  17  12   1   0   0   0   1   0   2   0   1   2   9   2   9   2  12   0    81    0    0   2.208     73  0.18
  138  181 A   0   1   0   0   0   0   1  32   0   0   1   0   0   0   1   0   0   0  52  11    81    0    0   1.166     38  0.50
  139  182 A  15   4  81   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.572     19  0.89
  140  183 A  22   1   7   4   0   0   1   0  57   0   0   6   1   0   0   0   0   0   0   0    81    0    0   1.305     43  0.39
  141  184 A   0   0   0   0   0   0   1   0   0   0   0   0   0  99   0   0   0   0   0   0    81    0    0   0.067      2  0.98
  142  185 A   0   1   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0    81    0    0   0.067      2  0.96
  143  186 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  99    81    0    0   0.067      2  0.99
  144  187 A  22  73   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.714     23  0.80
  145  188 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0    81    0    0   0.000      0  1.00
  146  189 A   0   1   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0    81    0    0   0.067      2  0.96
  147  190 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  99   0   0    81    0    0   0.067      2  0.98
  148  191 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0    81    0    0   0.000      0  1.00
  149  192 A   5  81   9   0   4   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0    81    0    0   0.703     23  0.82
  150  193 A   0  98   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.116      3  0.99
  151  194 A   0  15   0   0  25   0  57   0   0   0   0   0   3   0   0   0   0   0   0   0    80    0    0   1.042     34  0.76
  152  195 A   3   0   0   3   1   0   5   1  15   0   8  34   0   0   1  20   1   5   1   3    80    0    0   2.017     67  0.18
  153  196 A   0   0   1   0   0   0   1   0   1   0  45  19   0   1   0   3   0   0   6  22    80    0    0   1.493     49  0.36
  154  197 A   0   2   0   0   0   0   0   1   4  20   4   6   0   0   4  33   4   2  19   1    81    0    0   1.950     65  0.25
  155  198 A   0   1   0   0   4   0   0   8   6   4  21   4   0   1  13   4   5  14   0  15    78    0    0   2.291     76  0.19
  156  199 A   1  19   0   0   0   0   0   0   0  22   4   3   0   1   3  11   0  22   3  11    80    0    0   1.986     66  0.14
  157  200 A   1   0   0   0   0   0   4   4   1   0   3   5   0   0   0   0   0   3  34  46    80    0    0   1.413     47  0.49
  158  201 A   0   1   0   0   0   0   0   6  60   0  22   4   2   0   0   1   0   0   2   0    81    0    0   1.224     40  0.54
  159  202 A  19   2  15   0   0   0   0   0   1  22   6   7   0   1   1  12   4   5   1   2    81    0    0   2.223     74  0.14
  160  203 A  23  48  28   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   1.050     35  0.70
  161  204 A   1   2   0  10   0   0   0   1   1   0   0   0   0   0   1  83   0   0   0   0    81    0    0   0.694     23  0.68
  162  205 A   7  62  27   0   0   0   0   0   4   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.967     32  0.67
  163  206 A   0   0   7   0   0   0   0   1  17   0  12  43  17   0   0   0   0   0   1   0    81    0    0   1.529     51  0.34
  164  207 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  99    81    0    0   0.067      2  0.98
  165  208 A   0   0   0   0  99   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0    81    0    0   0.067      2  0.97
  166  209 A   0   0   0   0   0   0   0  99   0   0   0   0   1   0   0   0   0   0   0   0    81    0    0   0.067      2  0.98
  167  210 A   3  21   1   5  66   0   3   0   0   0   1   0   0   0   0   0   0   0   0   0    80    0    0   1.046     34  0.78
  168  211 A   0   0   1   0   2   0   2   4  63   0  14   6   1   0   0   2   0   1   0   2    81    0    0   1.385     46  0.45
  169  212 A   0   0   2   0   0   0   0   4   0   2   1   1   0   0   2  77   1   5   1   2    81    0    0   1.058     35  0.60
  170  213 A   2   4  25   1   0   0   0   2   1   4   4   5   0   1   2   0   1  42   0   5    81    0    0   1.864     62  0.20
  171  214 A  16   1   2   1   0   0   0   5   1   1   5  37   1   0   0   0   5   2   1  20    81    0    0   1.936     64  0.22
  172  215 A   5   6   2   4   1   0   0   0  14  54   0   6   0   0   2   1   0   1   1   1    81    0    0   1.671     55  0.30
  173          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  174  224 A   7   0   0   0   1   0   0   0   4   0   0   0  70   0   0   0  16   0   0   1    81    0    0   0.964     32  0.39
  175  225 A   0   0   0   0  16   1  37  44   0   0   0   0   0   0   0   1   0   0   0   0    81    0    0   1.130     37  0.13
  176  226 A   0   0   0   0   1   0   0   0   0   0   9  90   0   0   0   0   0   0   0   0    81    0    0   0.360     12  0.82
  177  227 A   0   1   1   0   0   1   0   1   2  93   0   0   0   0   0   0   0   0   0   0    81    0    0   0.380     12  0.84
  178  228 A   1   0   0   0   1   0  60  22   0   0   4   4   0   0   0   0   0   5   2   0    81    0    0   1.231     41  0.17
  179  229 A   0   0   0   0   4   0  95   0   1   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.224      7  0.96
  180  230 A  77   6   0   9   1   0   2   1   0   0   1   0   2   0   0   0   0   0   0   0    81    0    0   0.934     31  0.67
  181  231 A   0   0   0   0   0   0   0   4  95   0   0   1   0   0   0   0   0   0   0   0    81    0    0   0.224      7  0.94
  182  232 A   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    81    0    0   0.000      0  1.00
  183  233 A   0   0   0   0   0   0   0   1   0   0   0   0   0   1   0   0  16  81   0   0    81    0    0   0.569     18  0.81
  184  234 A  79   2  12   2   0   0   1   0   1   0   1   0   0   0   0   0   0   0   0   0    81    0    0   0.790     26  0.81
  185  235 A   5  88   5   0   1   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0    81    0    0   0.521     17  0.86
  186  236 A   1   4   1   0   0   1   0  36   5   0   2   1   0   0  12   4   1  23   5   2    81    0    0   1.961     65  0.22
  187  237 A   0   0   0   1   0   0   1   5   4  57   1   4   0   1   8   5   9   0   1   0    75    0    0   1.600     53  0.35
  188  238 A   1   3   1   0   1   0  16   3   6   0   1   3   1   0   5  13   5  36   3   3    80    0    0   2.131     71  0.09
  189  239 A   1   0   0   0   3   0   1   9   5  16   4  17   1   1   3  35   0   0   3   1    80    0    0   2.004     66  0.17
  190  240 A   1   0   0   0   0   0  94   0   0   0   0   0   0   4   0   0   0   0   0   1    80    0    0   0.293      9  0.86
  191  241 A   0   0   0   0   0   0   0  23   0   0   7   1   0   0   0   0   0   2  19  47    81    0    0   1.346     44  0.52
  192  242 A   1   0   0   2   1   1   0   0   1   6   6   1   0   1   2  69   4   0   0   2    81    0    0   1.321     44  0.48
  193  243 A   0   0   0   0   0   0   0   0  15   6  56   0   0   0   2   7   1  11   1   0    81    0    0   1.418     47  0.39
  194  244 A  32   0   1   0   0   0   0   0   2   0   1   1  62   0   0   0   0   0   0   0    81    0    0   0.917     30  0.49
  195  245 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    81    0    0   0.000      0  1.00
  196  246 A  11  20  19  41   0   1   0   0   0   0   1   1   6   0   0   0   0   0   0   0    81    0    0   1.577     52  0.50
  197  247 A   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   1   0   0    81    0    0   0.067      2  0.95
  198  248 A   0   0   0   0   0   0   0   1   6   0  91   0   0   0   1   0   0   0   0   0    81    0    0   0.363     12  0.86
  199  249 A   6  72  14   0   0   0   0   0   5   0   0   0   2   1   0   0   0   0   0   0    81    0    0   0.976     32  0.63
  200  250 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.000      0  1.00
  201  251 A  94   0   4   0   0   0   0   0   0   0   0   1   1   0   0   0   0   0   0   0    81    0    0   0.290      9  0.93
  202  252 A   9   2  89   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.408     13  0.93
  203  253 A   4  16  19  33   0   0   0   0   6   0   5  16   1   0   0   0   0   0   0   0    81    0    0   1.763     58  0.35
  204  254 A   0   0   0   0   2   0  96   0   1   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.182      6  0.96
  205  255 A  25   0  69   1   1   0   0   0   0   0   0   1   1   0   0   0   0   1   0   0    81    0    0   0.872     29  0.79
  206  256 A   0  72   4  20   0   0   0   0   1   0   0   0   4   0   0   0   0   0   0   0    81    0    0   0.858     28  0.78
  207  257 A   0  95   0   4   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0    81    0    0   0.224      7  0.97
  208  258 A   4   0   0   0   0   0   0   0   2   0   7   1  85   0   0   0   0   0   0   0    81    0    0   0.597     19  0.78
  209  259 A   0   0   0   0   0   0   0  98   1   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.079      2  0.99
  210  260 A   2   4   0   1  31   0  60   0   0   0   0   0   1   0   0   0   0   0   0   0    81    0    0   0.989     33  0.83
  211  261 A   0   5   0   0   0   0   0   0   0  85   5   0   0   1   0   0   1   2   0   0    81    0    0   0.634     21  0.71
  212  262 A   0   0   0   0   0   0   0   0   0  98   0   1   1   0   0   0   0   0   0   0    81    0    0   0.133      4  0.96
  213  263 A   0   0   0   0  98   0   0   0   1   0   0   0   0   1   0   0   0   0   0   0    81    0    0   0.133      4  0.94
  214  264 A   2   2   1   0   4   4  72   0   0   1   4   0   0   2   0   0   0   2   2   2    81    0    0   1.262     42  0.50
  215  265 A   0   1   0   0   0   1   0   5   6   1  54   0   0   1   1   0   1   6   0  21    81    0    0   1.477     49  0.38
  216  266 A   0   0   7   0   0   0   0   0   0   0   0   0   0  29   0   0   0   4  60   0    45    0    0   0.984     32  0.41
  217  267 A   2   0   0   0   0   0   0   2   0   0   2  17   0  65   2   0   0   2   7   0    46    0    0   1.177     39  0.41
  218  268 A   0   0   0   0   0   0   0  67   2   0  28   0   2   0   0   0   0   0   0   0    46    0    0   0.790     26  0.61
  219  269 A   2  32   0   2   6   0   0   0   0   0   2   2   0   4  28   2  18   2   0   0    50    0    0   1.797     59  0.09
  220  270 A   1   1   0   0   0   0   0   0  37   3   1  20   0   0   3   1   0  23   3   7    71    0    0   1.752     58  0.28
  221  271 A   0   3  56   1   0   0   0   1   0   0  15   8   1   0   0   0   0   0  10   3    71    0    0   1.431     47  0.25
  222  272 A   1   0   1   0   0   0   0   0   1  20  41   1   0   0   1   0  12   7   0  13    75    0    0   1.679     56  0.27
  223  273 A   2   0   4   0   0   0   0   1   0  44   9   2   0   1   4  17   2   6   4   2    81    0    0   1.888     63  0.25
  224  274 A   2   1   0   0   0   0   0  46   4   0   5   2   0   0   5   1   1   7   4  21    81    0    0   1.765     58  0.40
  225  275 A   5  25   2  54   1   0   0   0   0   0   0   1   0   0   0   2   4   1   0   4    81    0    0   1.415     47  0.58
  226  276 A   4   1   2   2  19   0   5   1   4   0   1   0   0   0  20  37   2   0   1   0    81    0    0   1.884     62  0.09
  227  277 A   0   1   0   0   1   0   1   0   9   0   5   6   0   0  22  31   5  12   2   4    81    0    0   2.012     67  0.26
  228  278 A   1   1   1   2   0   0   1   0   4   0   2   1   0   0  37  28  14   5   1   0    81    0    0   1.775     59  0.32
  229  279 A   2   4  83   4   2   0   1   0   0   0   0   0   1   0   0   0   1   1   0   0    81    0    0   0.801     26  0.77
  230  280 A   0   7   4  23   0   0   0   0   0   0   4   4   1   1  47   4   1   2   1   0    81    0    0   1.685     56  0.27
  231  281 A   0   6   0  19   0   0   1   0   9   0   9  26   0   0  15  10   0   2   4   0    81    0    0   2.037     67  0.15
  232  282 A   0   0   0   0   0   0   1  73  13   0   4   1   6   0   0   0   0   0   1   0    79    0    0   0.953     31  0.65
  233  283 A   1   0   0   0   0   0   0   0   4   1  23   0   0   0   0  14  41   6   1   9    79    0    0   1.657     55  0.30
  234  284 A   1   4   2   0  26   2  63   0   1   0   0   0   0   0   0   0   0   0   0   0    81    0    0   1.055     35  0.81
  235  285 A   0   0   0   0   0   1   4  10   2   0   1   4   0   0   0   1   1  51   2  22    81    0    0   1.551     51  0.50
  236  286 A   0   1   0   0  95   0   2   0   0   0   0   0   0   0   0   0   0   1   0   0    81    0    0   0.248      8  0.95
  237  287 A   4   1   4   1   0   0   1   0   0  60   0   2   0   4   1   4   1   1   1  14    81    0    0   1.535     51  0.33
  238  288 A   0   0   1   1   1   0   0   1   5   4  22   2   1   0   2   2   0  20  28   7    81    0    0   2.021     67  0.26
  239  289 A   0   0   0   0   0   0   0   0   5  59   0   2   0   0   0   1   0  23   1   7    81    0    0   1.191     39  0.46
  240  290 A   2   0   0   0   9   2  17   2   0   5   1   0   0   0   1   0   0  57   0   2    81    0    0   1.459     48  0.16
  241  291 A   0   1   0   0   5  93   0   0   0   1   0   0   0   0   0   0   0   0   0   0    80    0    0   0.331     11  0.93
  242  292 A   4   0   0   0   0   0   0   4   9   5  38   4   0   0   1   6   3   1   1  25    80    0    0   1.877     62  0.31
  243  293 A   0   0   0   0   0   1   0   5   1   0   1   4   0   7   1   2  17  26  20  14    81    0    0   2.017     67  0.38
  244  294 A  59   0  38   0   1   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.786     26  0.82
  245  295 A   0   0   0   0   1   0   0   0   0   0  96   1   0   0   0   0   0   1   0   0    81    0    0   0.199      6  0.92
  246  296 A   0   2   2   0   0   0   0   1   1   4   2   4   1   0   0   4  12  47   4  15    81    0    0   1.821     60  0.43
  247  297 A   0   1   0  16   0   0   0   2   7   0  19   2   0   0   0   2   5  28   4  11    81    0    0   1.999     66  0.21
  248  298 A  14   0   0   0   0   0   0   0  85   0   0   0   1   0   0   0   0   0   0   0    81    0    0   0.462     15  0.78
  249  299 A   0   4   1   0   0   0   0   0   0   0   0   0   0   0   2  93   0   0   0   0    81    0    0   0.339     11  0.84
  250  300 A   0   0   1   6   0   0   1   0   2   0   1   0   0   4   1   1  17   6   1  57    81    0    0   1.508     50  0.51
  251  301 A  11  59   5   1  23   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   1.097     36  0.77
  252  302 A  26   1  73   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.635     21  0.88
  253  303 A   1   2   1   0   0   0   0   2   1   0   7   4   5   2  54  12   1   0   2   2    81    0    0   1.727     57  0.33
  254  304 A   0   4   0   0   0   0   0  14   0   0   2   0   1  12   4  38   6   0  19   0    81    0    0   1.771     59  0.29
  255  305 A   0  72   1  23   0   0   0   0   1   0   0   1   1   0   0   0   0   0   0   0    81    0    0   0.796     26  0.84
  256  306 A   0  89   4   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.420     14  0.94
  257  307 A  17   1   2   0   0   0   0   0   0   1   1   4   2   0   4  42   4   9   9   4    81    0    0   1.925     64  0.20
  258  308 A  42   9   0   1   0   0   0   0   0   4   1  30   0   0   6   6   0   0   0   1    81    0    0   1.565     52  0.29
  259  309 A   0   0   1   0   0   0   0   0   1   0   0   0   0   0   0  16   4  17  14  47    81    0    0   1.454     48  0.53
  260  310 A   1   0   0   0   0   0   0   0   6  88   4   0   0   0   0   1   0   0   0   0    81    0    0   0.518     17  0.81
  261  311 A   0   0   0   0   0   0   0   0   7   0  16  30   1   1   2  15   4  17   1   5    81    0    0   1.958     65  0.26
  262  312 A   1   1   0   1   1   1   0   0   4   0   1   1   0   2   2  28  16  32   1   5    81    0    0   1.903     63  0.32
  263  313 A   0   0   0   0   0   0   0   1   0   0   0   0   0   0  99   0   0   0   0   0    81    0    0   0.067      2  0.97
  264  314 A   1  45   5  24  14   1   5   0   3   3   0   0   0   0   0   0   0   0   0   0    80    0    0   1.567     52  0.62
  265  315 A   0   0   0   0   0   0   0   1   0   0  22  71   1   0   3   0   0   0   1   0    80    0    0   0.834     27  0.61
  266  316 A   3   0  54   3   0   0   0   0  28   1   0   5   8   0   0   0   0   0   0   0    80    0    0   1.272     42  0.36
  267  317 A   0   1   1   1   1   0   0   8   5   0   9  20   0   1   4   3   8  32   1   5    80    0    0   2.132     71  0.27
  268  318 A   0   0   0   0   0   0   0  16   1   0   0   0   0   0   1   0  40  32   0   9    80    0    0   1.350     45  0.54
  269  319 A  39   4   1   1  24   0   0   0  30   0   0   0   1   0   0   0   0   0   0   0    80    0    0   1.357     45  0.29
  270  320 A   0  65   3  31   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0    80    0    0   0.790     26  0.90
  271  321 A   0   0   1   1   0   0   0   0   7   1   5   0   1   1  12   5  10  14  23  17    81    0    0   2.163     72  0.28
  272  322 A   1   0   0   0   0   0   0   0   0   1   0   0   1  80   0   0   3   0  10   4    80    0    0   0.788     26  0.73
  273  323 A   0   5   0   0   0   0   0   0   0  77   4   0   0   0   1  11   1   0   0   0    80    0    0   0.826     27  0.62
  274  324 A   0   0   0   0   1  98   0   0   0   0   1   0   0   0   0   0   0   0   0   0    80    0    0   0.134      4  0.98
  275  325 A   8  26  60   0   5   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0    80    0    0   1.056     35  0.72
  276  326 A   4   1   3   7   0   0   0   0  16   0  16  12   1   0   1   3   7   0  27   0    73    0    0   2.078     69  0.19
  277  327 A   0   0   0   0   0   0   0  15   0   0  18   2   2   2   3   9  32   2   5  12    66    0    0   1.934     64  0.26
  278  328 A   0   0   5   0   2   0  13   3   2   0  37  22   0   0   2   3   0   2   2   8    60    0    0   1.893     63  0.13
  279  329 A   3   0   0  22   0   0   2   0   7   0   3  25   0   0   0   7   0  25   5   0    59    0    0   1.845     61  0.16
  280  330 A  10   0   0   0   0   0   0   0  42   3   2   0   0   0   2  15  13  12   0   2    60    0    0   1.717     57  0.29
  281  331 A  46  27   5   0   3   0   0   0  14   2   0   2   0   0   2   0   0   0   0   0    59    0    0   1.456     48  0.40
  282  332 A   0   0   0   0   0   0   0   0   3  59   2   5   0   0   0   0   2   0   0  29    58    0    0   1.082     36  0.41
  283  333 A   0   2   0   0   0   0   0   0   4  13   4   0   0   2   2   5  38   2  25   5    56    0    0   1.813     60  0.31
  284  334 A   4   2   7   0   0   0   0   0   0   0   0  64   0   0   2   2   0   0   4  13    45    0    0   1.263     42  0.33
  285  335 A   0   9   9   0   0   0   0   5   5  68   2   0   0   0   0   0   2   0   0   0    44    0    0   1.150     38  0.34
  286  336 A   0  88   2   0   0   0   2   0   0   7   0   0   0   0   0   0   0   0   0   0    41    0    0   0.487     16  0.71
  287  337 A   0   3   0   0   0   0   8   0   3   5  11   0  11  57   0   0   0   0   0   3    37    0    0   1.457     48  0.22
  288  338 A   0   0   0   0   0   0   0   0   5   0  14  78   0   0   0   3   0   0   0   0    37    0    0   0.717     23  0.58
  289  339 A   8   0   0   0   0   0   0  16  16   5  35   3   0   0   0   0   8   3   5   0    37    0    0   1.876     62  0.25
  290  340 A   3   0   3   8   0   0   0   0   0   0   3   3   0   0  70   5   5   0   0   0    37    0    0   1.157     38  0.42
  291  341 A  64   6   6  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    36    0    0   0.954     31  0.68
  292  342 A   0  91   0   9   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    34    0    0   0.298      9  0.97
  293  343 A   0   0   0   0   0   0   0   0   0   0   3  12   0   0   6  50  18   3   0   9    34    0    0   1.493     49  0.37
  294  344 A   0   0   0   0   0   0   0   0   0   3   0   0   0   0   3   9   0  85   0   0    33    0    0   0.569     19  0.60
  295  345 A   0   0   0   0   0   0   0  15   9   0   3   0   0   0   0   3   0  27   3  39    33    0    0   1.543     51  0.45
  296  346 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  11  89   0   0   0   0    18    0    0   0.349     11  0.82
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     1   172   215     8 tTSHNSLTTp
     2   122   122     8 tTSHNSLTTp
     3   126   134     8 tTSHNSLTTp
     4   172   201     8 tTSHNSLTTp
     5   171   192     8 tTSHNSLATp
     6   171   197     8 tTSHNSLATp
     7   171   192     8 tTTHNSLATp
     8   172   178     8 tTSYNSLATp
     9   100   128     2 rAAe
     9   153   183     8 tTTHNSLATp
    10   160   215     8 tKMHNSLQTp
    11   164   197     8 tTVQNALQTp
    12   160   197     7 tTQNALQTp
    13   158   195     7 tTQNALQTp
    14   164   187     8 tTLHNPLQTp
    15   162   197     8 tTIQNALQTp
    16   160   197     7 tTQNALQTp
    17   161   187     8 tTVQNALQTp
    18   168   200     8 tTSNKCLTTp
    19   163   249     7 tCFNSLQTp
    20   161   186     8 tFIKDTLQTp
    21   164   244     8 tTNFNSLQTp
    22   169   172     8 tLIKDTLQTp
    23   161   178     8 tLVKDTLQTp
    24   168   171     8 tFTNDTLQTp
    25   161   180     8 cFAKETLQTp
    26   168   171     8 tFSNYTLQTp
    27   168   171     8 tFTNDTLQTp
    28   163   211     8 tSLHKSLQTp
    28   222   278     4 rAVFKs
    29   162   200     7 vDDAGLKTp
    29   176   221     5 rAEAKSt
    30    58    59     6 nSVQFPHe
    30   144   151     6 dQGDLMTp
    30   158   171    18 eAQRRHQKEKSGIIPTSPTp
    30   187   218     1 sKh
    31    13    24     1 nWt
    31    73    85     6 nSVQFPHe
    31   159   177     6 dQGDLMTp
    31   173   197    18 eAQRRHQKEKSGIIPTSPTp
    31   202   244     1 sKh
    32    13    24     1 nWt
    32    73    85     6 nSVQFPHe
    32   159   177     6 dQGDLMTp
    32   173   197    18 eAQRRHQKEKSGIIPTSPTp
    32   202   244     1 sKh
    33    13    24     1 nWt
    33    73    85     6 nSVQFPHe
    33   159   177     6 dQGDLMTp
    33   173   197    18 eAQRRHQKEKSGIIPTSPTp
    33   202   244     1 sKh
    34    13    43     1 nWt
    34    73   104     6 nSVQFPHe
    34   159   196     6 dQGDLMTp
    34   173   216    18 eAQRRHQKEKSGIIPTSPTp
    34   202   263     1 sKh
    35    13    23     1 nWt
    35    73    84     6 nSVQFPHe
    35   159   176     6 dQGDLMTp
    35   173   196    18 eAQRRHQKEKSGIIPTSPTp
    35   202   243     1 sKh
    36    13    24     1 nWt
    36    73    85     6 nSVQFPHe
    36   159   177     6 dQGDLMTp
    36   173   197    18 eAQRRHQKEKSGIIPTSPTp
    36   202   244     1 sKh
    37    11    12     1 nWt
    37    21    23     2 gPVr
    37    71    75     6 nSVQFPHe
    37   157   167     6 dQGDLMTp
    37   171   187    18 eAQRRHQKEKSGIIPTSPTp
    37   200   234     1 sKh
    38    11    12     1 nWt
    38    71    73     6 nSVQFPHe
    38   157   165     6 dQGDLMTp
    38   171   185    18 eAQRRHQKEKSGIIPTSPTp
    38   200   232     1 sKh
    39    14    18     1 nWt
    39    74    79     6 nSVQFPHe
    39   107   118     2 kQAs
    39   160   173     6 dQGDLMTp
    39   174   193    18 eAQRRHQKEKSGIIPTSPTp
    39   203   240     1 sKh
    40     9    24     1 nWt
    40    69    85     6 nSVQFPHe
    40   155   177     6 dQGDLMTp
    40   169   197    18 eAQRRHQKEKSGIIPTSPTp
    40   198   244     1 sKh
    41     9    23     1 nWt
    41    69    84     6 nSVQFPHe
    41   155   176     6 dHGDLMTp
    41   169   196    18 eAQRRHQKEKSGIIPTSPTp
    41   198   243     1 sNh
    42    13    24     1 nWt
    42    23    35     1 gPv
    42    73    86     6 nSVQFPHe
    42   159   178     6 dQGDLMTp
    42   173   198    18 eAQRRHQKEKFGIIPTSPTp
    42   202   245     1 sKh
    43    57    73     2 hPNi
    43   144   162     3 gLSHm
    43   149   170     4 tAMATa
    44     4    18     1 nTk
    44    57    72     2 hPNi
    44   144   161     4 gLSKTi
    44   149   170     6 qMDQLGTa
    45    38    88     1 sEl
    45    59   110     2 hPHi
    45   146   199     4 gFAKTv
    45   151   208     5 dSGLVTt
    46    38    88     1 sEl
    46    59   110     2 hPHi
    46   146   199     4 gFAKTv
    46   151   208     5 dSGLVTt
    47    51    51     2 hERi
    47    88    90     5 nRVGGCf
    47   140   147     5 gLARKHy
    47   145   157     6 gEPPMKSl
    48    33    34     1 sKv
    48    55    57     1 kLv
    48    75    78     2 hPNi
    48   167   172     7 vESDVMATa
    49    46    46     2 hENv
    49   138   140     7 vDKDIMSTa
    50    31    31     1 sFv
    50    52    53     3 nHPFi
    50   141   145     8 vTDAATAKTv
    51    55    61     3 dHPYi
    51   143   152     3 gFSKm
    51   148   160     6 dAQILLTa
    51   200   218     3 aVCAa
    52    47    50     1 kAl
    52    52    56     1 eAl
    52    68    73     2 hPNi
    52   160   167     7 qAGNMLGTa
    53   149   153     8 vGDDVFMKTt
    53   163   175     5 nNISNSp
    53   201   218     3 sILSa
    54    36    71     1 tAl
    54    57    93     2 hPNi
    54   150   188     8 aADGVVMQTm
    55    53    94     3 sHPNi
    55   145   189     8 vEHQVLMKTv
    55   198   250     3 rILNc
    56    38    66     1 rKl
    56    50    79     1 rEi
    56    59    89     3 eHPNv
    56   146   179     3 gLSVf
    56   151   187     5 gNSFCDv
    57    36    82     1 kAl
    57    41    88     1 nVq
    57    48    96     1 eEl
    57    57   106     2 hPNi
    57   144   195     4 gIAKQl
    57   149   204     5 eDLIYKa
    57   204   264     2 aSRy
    58    37   115     1 fQi
    58    56   135     2 hPNi
    58   143   224     3 gLSCm
    58   148   232     8 vTGENVMKTr
    59    38    39     1 rEg
    59    45    47     1 sEl
    59    54    57     2 hCNi
    59   141   146     3 gLASs
    59   146   154     7 sSNWSMTTl
    60    53    83     3 sHPNi
    60   145   178     8 iDDQVTMKTv
    60   198   239     3 rILNc
    61    40    57     1 kKl
    61    61    79     2 hPNi
    61   153   173     4 vQGDTe
    61   167   191     5 sPEVLKk
    62    65    71     2 hPNi
    62   157   165     7 qAGNMLGTa
    63    35    35     1 kKl
    63    47    48     1 rEv
    63    56    58     3 kHPNi
    63   143   148     3 gLSVf
    63   148   156     5 gERFNEi
    64    36    48     1 aAl
    64    57    70     2 hPNi
    64   150   165     8 vTEETNMSTm
    64   202   225     3 kILNg
    65    40    41     1 kEl
    65    61    63     3 gNKYv
    65   153   158     8 vHTPESLTTr
    66    37    95     1 fMt
    66    55   114     3 qHPNi
    66   130   192     1 sNe
    66   142   205     4 gLAKIf
    66   147   214     3 nLKTk
    66   161   231     4 sGSGSa
    67    57    70     2 hPNc
    67   132   147     4 gDPASp
    67   149   168     8 mSGRSTMSTp
    67   163   190     4 dPARGs
    68    36    68     1 kLv
    68    57    90     3 gHPNi
    68   144   180     3 gLSQf
    68   149   188     7 sQYYMLMTa
    68   201   247     3 aILAn
    69    36    48     1 aAl
    69    57    70     2 hPNi
    69    64    79     1 vYd
    69   149   165     8 vTEETNMSTm
    69   201   225     3 kILNg
    70    13    29     1 nEd
    70    45    62     1 qGp
    70    64    82     2 hVNl
    70   151   171     4 gLARRy
    70   156   180     4 eKLRVn
    70   208   236     3 nILAc
    71    57    57     2 hPNv
    71   133   135     4 dDPASp
    71   145   151     3 gLAKm
    71   150   159     6 pMEKMTSf
    71   164   179     1 dKh
    72   118   118     7 vENGVMSTa
    72   127   134    15 gKLSLWSLKTPPSPHTp
    72   132   154    17 iSMTTTNDCSFTAPEVLAq
    73    42    94     1 kKl
    73    54   107     1 rEv
    73    63   117     3 kHPNi
    73   150   207     3 gLSVf
    73   155   215     5 gEQFNEi
    73   191   256    26 gVPPFWAGLFMLYRILFVSYGFSTYDLf
    73   197   288     1 lFi
    74    47    55     1 eKv
    74    59    68     1 rEi
    74    68    78     2 hPNv
    74   152   164     3 gLSAl
    74   157   172     8 vKADGLLHTt
    74   171   194     1 eDr
    75    37    60     1 kFa
    75    44    68     1 eTd
    75    53    78     3 eIEIl
    75    60    88     6 pCIIKIKn
    75   141   175     4 gHSKIl
    75   146   184     4 sLMRTl
    75   160   202     3 vSVGt
    76    43    50     1 kAl
    76    53    61     1 nEi
    76    62    71     2 hPNi
    76   154   165     7 qAGNMLGTa
    76   163   181     4 gEGRHp
    77    37    72     1 qAg
    77    56    92     3 gNKNi
    77   138   177    11 kICDFDLGSGVKl
    77   147   197     6 tTPELTTp
    77   161   217     5 eVFRDEa
    77   190   251    11 gHCGADCGWDRGe
    78    37    69     1 kFa
    78    44    77     1 eAd
    78    53    87     3 eIEIl
    78    60    97     6 pCIIKIKd
    78   141   184     4 gQSKIl
    78   146   193     4 sLMRTl
    78   160   211     3 nSFGt
    79    55   142     1 qQn
    79    67   155     1 eEt
    79    76   165     2 hPNi
    79    83   174     4 sFVEPv
    79   152   247     4 tRRRYp
    79   159   258    12 gPWDEDEIDIQVKi
    79   164   275     3 gLAKf
    79   169   283     5 iQFTNTl
    80    47    87     1 cIp
    80   140   181     2 lDAd
    80   149   192     6 gTRGYLAp
    80   193   242     2 aARa
    80   206   257     1 gLs
//