Complet list of 2hzi hssp fileClick here to see the 3D structure Complete list of 2hzi.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      2HZI
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-09-10
HEADER     tyrosine kinase, TRANSFERASE            2006-08-09 2HZI
COMPND     Proto-oncogene tyrosine-protein kinase ABL1
SOURCE     Homo sapiens
AUTHOR     Cowan-Jacob, S.W.; Fendrich, G.; Liebetanz, J.; Fabbro, D.; Manley, P.
SEQLENGTH   268
NCHAIN        2 chain(s) in 2HZI data set
KCHAIN        1 chain(s) used here ; chains(s) : A
NALIGN       62
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : ABL_MLVAB           1.00  1.00    1  268  119  386  268    0    0  746  P00521     Tyrosine-protein kinase transforming protein Abl OS=Abelson murine leukemia virus GN=ABL PE=3 SV=1
    2 : ABL_FSVHY           0.99  1.00    1  258  182  439  258    0    0  439  P10447     Tyrosine-protein kinase transforming protein Abl OS=Feline sarcoma virus (strain Hardy-Zuckerman 2) GN=ABL PE=2 SV=1
    3 : B0UXN6_DANRE        0.92  0.97    1  268  237  504  268    0    0  587  B0UXN6     Uncharacterized protein OS=Danio rerio GN=abl2 PE=4 SV=1
    4 : G3PAB4_GASAC        0.92  0.97    1  268  226  493  268    0    0  607  G3PAB4     Uncharacterized protein OS=Gasterosteus aculeatus GN=ABL2 PE=4 SV=1
    5 : Q61055_MOUSE        0.92  0.97   31  268    1  238  238    0    0  376  Q61055     Protein tyrosine kinase (Fragment) OS=Mus musculus GN=Abl2 PE=2 SV=1
    6 : A7RFY7_NEMVE        0.52  0.74   34  245    6  215  212    2    2  220  A7RFY7     Predicted protein OS=Nematostella vectensis GN=v1g196615 PE=4 SV=1
    7 : Q5U175_DROME        0.50  0.73   46  265    1  222  222    1    2  235  Q5U175     RE19378p OS=Drosophila melanogaster GN=Src42A PE=2 SV=1
    8 : Q9U8V5_EPTBU        0.50  0.74   33  265    1  233  234    2    2  246  Q9U8V5     Src-like B (Fragment) OS=Eptatretus burgeri PE=2 SV=1
    9 : B3KUV3_HUMAN        0.49  0.73   38  265   12  238  228    1    1  249  B3KUV3     cDNA FLJ40708 fis, clone THYMU2026904, highly similar to Proto-oncogene tyrosine-protein kinase LCK (EC 2.7.10.2) OS=Homo sapiens PE=2 SV=1
   10 : Q9H7V3_HUMAN        0.49  0.71   27  265    2  238  239    2    2  251  Q9H7V3     cDNA FLJ14219 fis, clone NT2RP3003800, highly similar to Rattus norvegicus tyrosine protein kinase pp60-c-src mRNA OS=Homo sapiens PE=2 SV=1
   11 : Q9PVU9_LETRI        0.49  0.73   33  265    1  232  233    1    1  245  Q9PVU9     Src-like B (Fragment) OS=Lethenteron reissneri PE=2 SV=1
   12 : B5DRC6_DROPS        0.48  0.76   46  264    1  221  221    1    2  234  B5DRC6     GA28339 OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA28339 PE=4 SV=1
   13 : F8W3Q8_DANRE        0.48  0.72    1  266  111  379  271    5    7  393  F8W3Q8     Uncharacterized protein (Fragment) OS=Danio rerio GN=fynrk PE=4 SV=1
   14 : H2YT47_CIOSA        0.48  0.72    1  265   12  271  265    3    5  273  H2YT47     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=3 SV=1
   15 : Q3TLX4_MOUSE        0.47  0.71    1  268   95  360  268    2    2  368  Q3TLX4     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=Lck PE=2 SV=1
   16 : B3S2E4_TRIAD        0.46  0.71    1  268   18  282  268    3    3  293  B3S2E4     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_50482 PE=3 SV=1
   17 : G1PQC6_MYOLU        0.46  0.70    1  268   62  327  268    2    2  337  G1PQC6     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=FGR PE=4 SV=1
   18 : I3MQD8_SPETR        0.44  0.71    2  264    1  261  263    2    2  265  I3MQD8     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=TXK PE=3 SV=1
   19 : E7FAC6_DANRE        0.42  0.71    3  267   49  307  266    4    8  311  E7FAC6     Uncharacterized protein OS=Danio rerio GN=LOC100536093 PE=3 SV=1
   20 : M3WXI7_FELCA        0.42  0.67   48  268   22  237  221    2    5  259  M3WXI7     Uncharacterized protein (Fragment) OS=Felis catus GN=MATK PE=4 SV=1
   21 : H3CG88_TETNG        0.41  0.65    4  257   23  284  263    4   10  284  H3CG88     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
   22 : R7UJ65_9ANNE        0.41  0.63    1  261   10  288  279    5   18  288  R7UJ65     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_45220 PE=4 SV=1
   23 : R7V397_9ANNE        0.41  0.66   16  264    1  242  249    3    7  247  R7V397     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_153170 PE=4 SV=1
   24 : H2ZYD6_LATCH        0.40  0.63    1  268   26  291  268    2    2  299  H2ZYD6     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
   25 : A7RHA0_NEMVE        0.38  0.64    1  264   50  333  287    7   26  341  A7RHA0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g81258 PE=3 SV=1
   26 : C3YL94_BRAFL        0.38  0.63   17  266   21  275  258    5   11  278  C3YL94     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_251762 PE=3 SV=1
   27 : I1ESD1_AMPQE        0.38  0.67    1  245    1  235  246    5   12  251  I1ESD1     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica PE=4 SV=1
   28 : Q179Z3_AEDAE        0.38  0.60    4  262   34  310  280    7   24  343  Q179Z3     AAEL005448-PA OS=Aedes aegypti GN=AAEL005448 PE=3 SV=1
   29 : A7RN91_NEMVE        0.37  0.62    2  267    8  297  290    7   24  303  A7RN91     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g87445 PE=4 SV=1
   30 : E9FYP4_DAPPU        0.37  0.61   10  268    1  279  279    6   20  306  E9FYP4     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_42775 PE=3 SV=1
   31 : E9GID6_DAPPU        0.37  0.58   10  264    1  271  274    7   22  302  E9GID6     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_50921 PE=3 SV=1
   32 : H3BPR7_HUMAN        0.37  0.59   12  265    2  286  288    8   37  286  H3BPR7     Tyrosine-protein kinase receptor TYRO3 (Fragment) OS=Homo sapiens GN=TYRO3 PE=3 SV=1
   33 : R7V7P0_9ANNE        0.37  0.62   10  264   20  291  275    7   23  311  R7V7P0     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_134203 PE=4 SV=1
   34 : A7RN88_NEMVE        0.36  0.59    3  265    9  304  299    9   39  304  A7RN88     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g87486 PE=2 SV=1
   35 : C3YGK3_BRAFL        0.36  0.59   16  252    7  265  259    9   22  265  C3YGK3     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_220636 PE=4 SV=1
   36 : C3Z4Z3_BRAFL        0.36  0.59    2  261    1  281  281    9   21  296  C3Z4Z3     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_157646 PE=3 SV=1
   37 : H2Y144_CIOIN        0.35  0.59    1  263   22  312  294    9   34  351  H2Y144     Uncharacterized protein OS=Ciona intestinalis GN=LOC100181011 PE=4 SV=1
   38 : C3XY31_BRAFL        0.34  0.60    3  268    1  287  290    7   27  292  C3XY31     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_206109 PE=3 SV=1
   39 : C3ZSB4_BRAFL        0.34  0.57    3  267    7  293  291    8   30  303  C3ZSB4     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_220788 PE=4 SV=1
   40 : Q9TZS7_CAEEL        0.34  0.56    1  267   59  374  316   10   49  430  Q9TZS7     Protein C24G6.2, isoform b OS=Caenorhabditis elegans GN=C24G6.2 PE=2 SV=1
   41 : A7SVX1_NEMVE        0.33  0.58    2  264    4  280  282   10   24  297  A7SVX1     Predicted protein OS=Nematostella vectensis GN=v1g134557 PE=3 SV=1
   42 : A8P8Q0_BRUMA        0.33  0.56    1  267  108  423  316   10   49  512  A8P8Q0     Protein kinase domain containing protein OS=Brugia malayi GN=Bm1_19240 PE=4 SV=1
   43 : C3ZRL2_BRAFL        0.33  0.58    1  263   15  298  284    8   21  315  C3ZRL2     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_89768 PE=4 SV=1
   44 : C3ZRR5_BRAFL        0.33  0.59    2  265   13  295  286    9   25  297  C3ZRR5     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_237298 PE=3 SV=1
   45 : D8T1I5_SELML        0.33  0.57    2  264    5  268  273    8   19  294  D8T1I5     Putative uncharacterized protein (Fragment) OS=Selaginella moellendorffii GN=SELMODRAFT_46485 PE=3 SV=1
   46 : Q4FZR2_RAT          0.33  0.56    8  264    1  272  275    7   21  280  Q4FZR2     Ryk protein (Fragment) OS=Rattus norvegicus GN=Ryk PE=2 SV=1
   47 : A7S934_NEMVE        0.32  0.56    4  267    1  300  304   10   44  304  A7S934     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109532 PE=3 SV=1
   48 : A7S936_NEMVE        0.32  0.55    4  267    1  300  304   10   44  304  A7S936     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109586 PE=3 SV=1
   49 : C3YNL7_BRAFL        0.32  0.55    3  261    1  279  284   10   30  279  C3YNL7     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_157631 PE=3 SV=1
   50 : Q4S6E0_TETNG        0.32  0.53    2  265  325  661  337    9   73  713  Q4S6E0     Fibroblast growth factor receptor (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00023332001 PE=3 SV=1
   51 : A7RVT8_NEMVE        0.31  0.52    1  266   18  316  302    9   39  318  A7RVT8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g94997 PE=3 SV=1
   52 : B3RNH4_TRIAD        0.31  0.55   10  262    8  283  278    8   27  283  B3RNH4     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_21564 PE=4 SV=1
   53 : C3XVC1_BRAFL        0.31  0.57   14  263    1  260  267   10   24  264  C3XVC1     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_227697 PE=3 SV=1
   54 : C3YK65_BRAFL        0.31  0.55    1  261   15  292  281    8   23  294  C3YK65     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_220126 PE=3 SV=1
   55 : C3YK67_BRAFL        0.31  0.57    1  261   15  292  281    8   23  312  C3YK67     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_79049 PE=3 SV=1
   56 : E4XFE1_OIKDI        0.31  0.53   12  267    1  268  275    8   26  271  E4XFE1     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_31 OS=Oikopleura dioica GN=GSOID_T00010261001 PE=4 SV=1
   57 : E9H5G0_DAPPU        0.31  0.52    2  268   19  349  332   11   66  453  E9H5G0     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_308023 PE=4 SV=1
   58 : L1IIZ6_GUITH        0.31  0.52   16  257    7  273  267   10   25  273  L1IIZ6     Uncharacterized protein (Fragment) OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_59508 PE=4 SV=1
   59 : B3NAS7_DROER        0.30  0.47    1  262  415  762  352   11   94  787  B3NAS7     GG24928 OS=Drosophila erecta GN=Dere\GG24928 PE=3 SV=1
   60 : F6Y6V1_MACMU        0.30  0.50    2  268  588  941  358   12   95  984  F6Y6V1     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=FLT3 PE=2 SV=1
   61 : H2Q7C7_PANTR        0.30  0.50    2  268  602  953  356   12   93  996  H2Q7C7     Uncharacterized protein OS=Pan troglodytes GN=FLT3 PE=3 SV=1
   62 : H2UNL1_TAKRU        0.30  0.51    1  268    7  351  346   10   79  351  H2UNL1     Uncharacterized protein OS=Takifugu rubripes GN=LOC101073543 PE=4 SV=1
## ALIGNMENTS    1 -   62
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1  233 A D    >         0   0  115   23   29  DDDD        DDDDD    D DE D         E  D DN       H  EE   D  S
     2  234 A K  T 3   +     0   0  161   33   67  KKKK        QKEQAK   E AE K E      RK  IQIRKE    KD  RR R IKKR
     3  235 A W  T 3  S+     0   0   48   38    7  WWWW        WYWWWWW  W WW W W    W WWWYWWWWLW   WWF  WW W FWWW
     4  236 A E  B <   +a   72   0A  60   42   17  EEEE        EEEEEEA EE EE REE    E EEEEEAEEEE EEEEE  QQ E EEEE
     5  237 A M        -     0   0   26   42   52  MMMM        IVVIIIL IV IF IVF    Y KLIVIILRVI IIKFF  II F VFFF
     6  238 A E    >   -     0   0  133   42   63  EEEE        EDPPSDN ES SD DPP    P KSPNEPENDN PPDPP  DD P PPPP
     7  239 A R  G >  S+     0   0   78   42   50  RRRR        RHRRRPR AR RR KHR    R SERRRRRAPW RRPRE  SS R HRRR
     8  240 A T  G 3  S+     0   0  105   43   69  TTTT        SSEESTK SE DT SSD    E GNAARERDSEEDDRTE  SS N SEED
     9  241 A D  G <  S+     0   0   58   43   80  DDDD        SETSSEE FA TY ECR    S HDNDNKNDRDRDDMRR  RR R ANNR
    10  242 A I  E <   -B   29   0A   9   47   29  IIII        VFLLILL VI LL LLILV LN LILILILLVIVLLLLLL LL L ILLL
    11  243 A T  E     -B   28   0A  59   47   76  TTTT        KKKKTAK KV KV SRKRK AH TVKQISITTNTTTDTVE TT K QEEV
    12  244 A M  E     +B   27   0A  49   49   36  MMMM        LLLKLFL II LI LILLLLLI PFLLIIILLILITLLLV LLML IFFL
    13  245 A K  E     -     0   0A  87   49   80  KKKK        LEVIEII EI DR GGLQGGTK GGGNHLYNGGKEEAGGV GGVG GGGG
    14  246 A H  E     -     0   0A 101   50   71  HHHH        KKERRKQ EG RE KRDTVRKY PEREnKdEQEDRREKKKQDDDV RKKR
    15  247 A K  E     -B   25   0A  69   50   83  KKKK        QQRLRET VR RV EEILEMFL LVRQkVkLRRVQEMPSDLMMIQ MVVI
    16  248 A L  S >  S+     0   0   36   53   24  LLLL        LLLLLII ILMLL LIVIILLLIILLILILVIVLLLILLILIIILILLLL
    17  249 A G  G >  S-     0   0   34   54    8  GGGG        GGGGGGG GGVGGGGGGGGGGGGGGGGGGGGGGQGGGGGGGGGDGGGGGG
    18  250 A G  G 3  S-     0   0   81   54   76  GGGG        AEARTSK AEKAEESKTEKKSSEERRRSNSLSIESSQEQEEMMEASESSS
    19  251 A G  G X  S+     0   0   34   54    2  GGGG        GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGGGG
    20  252 A Q  T <  S+     0   0  106   54   69  QQQQ        QNQACQE ESEQASQAANAEAAMMNQAAAAAASTAAKCAEAAAFCSAAAA
    21  253 A Y  T 3  S-     0   0   32   54    6  YYYY        FFFFFFF FFFFFFFFFFFFFFFFYFFFFFSFYFFFFFFFFFFFFFFFFF
    22  254 A G  S <  S-     0   0   21   54   15  GGGG        GGGGGGG GgGGGGKGGGGgGgGGgGGgGgAGGGggGGgIGGGGGKGGGG
    23  255 A E  S    S+     0   0    1   54   73  EEEE        EQEEDVD EeDEKRRHQQRqEeQQgETkLrQLERkkHQeTHLLSRLQKKK
    24  256 A V  E     - C   0  39A  21   54   27  VVVV        VVVVVVV VCVVVVVVVVVLVTVVCVALVLIVVITTVVAVVVVVVVVVVV
    25  257 A Y  E     -BC  15  38A  41   54   80  YYYY        FFWWWHM CYYWMLVFFWHKFERRYRFIYIRYYFEELVIHVTTFVYHMMV
    26  258 A E  E     + C   0  37A  30   54   85  EEVV        EEMELLV RDRMRKAILKLQQGRRNLLgKgRRHHEERmGLKQQLkRennE
    27  259 A G  E     -BC  12  36A   0   55   40  GGGG     G  GGGGGGG gLGAagGaaaaEggaaggadgngaGgppggmaaaaAgaaggg
    28  260 A V  E     -BC  11  35A  38   47   90  VVVV     T  .L.I.E. vHE.hl.pics.sirrgrgltlrt.kggnealhdvLdqrsss
    29  261 A W  E >>> -BC  10  34A  31   52   93  WWWW     W  LWYWTW. PGYTGPQHSGG.ESTTKNLMNMTR.DKKPKPRPLLLAPRKKR
    30  262 A K  G >45S+     0   0  100   53   93  KKKK     N  W.YNW.D GSRYNGWCNCLDAMPPARPRRRADEPVVDPEGDPPCEHMTTS
    31  263 A K  G 345S+     0   0  158   56   82  KKKKK    G  NNNNNRY RQENSNRNKQPGSREETGTAPADDWNLLGNAVRTTEEGRGGQ
    32  264 A Y  G <45S-     0   0  127   56   83  YYYYY    T  DGGSDAR KGQKADNGQGGSGGGGEVEEGEARSKEESKVNDGEKNSGVVP
    33  265 A S  T <<5 +     0   0  107   58   86  SSNNS  T TT TTHVSHG EVKHCKEPVTPFENQEGTQNWNDTGEIIVPKVNQQKVSTSSV
    34  266 A L  E   < -C   29   0A  77   59   83  LLLLLI T RT TTTSTLK NHVTTIVKTLTVTILLVKTCNCVETKVVLLMREQQRQATIIM
    35  267 A T  E     +C   28   0A  49   58   84  TTTTTP K VK PKK.KPK YTAKTPDLRLLKKKDAPAVQLDTDEQPPQTRYVTTPTDIQQK
    36  268 A V  E     -CD  27  84A   0   59   19  VVVVVV V AV VVVVVVV VVVVVIVVVVVVVVVVVVVVVVVVVTCCVVDVVVVCVVVVVV
    37  269 A A  E     -CD  26  83A  12   59   22  AAAAAA A IA AAAAAAA AAKAAAAAAAAAAAAAAAVAAAAVAFAAAAKAAAAVAAAAAA
    38  270 A V  E     -CD  25  82A   1   59   31  VVVVVV IV.I VVVIVIV IVVVVIIVCVVVVIAAIVYVIVVVVVVVAVFLVAAVVIVVVV
    39  271 A K  E     +CD  24  81A  28   60   12  KKKKKK KKKK KKKKKKK KKLKKKKKKKKKKKKKKKVKKKKKKKKKKKrKKKKKKQKKKK
    40  272 A T  E     - D   0  80A   0   60   73  TTTTTM TSTT TTSSTAC TKKTMTIQGTQMTTTTTTIMSKSTKTMMTMsKKMMMMRQMMM
    41  273 A L        +     0   0   25   60   38  LLLLLM LLLL LLLMLII LLDMLSMLLVILLLVVMLFLPLVVFVLLVLFILIISVILLLL
    42  274 A K  S    S+     0   0  123   60   41  KKKKKK KKKK KKKKKNK KKSKKKEKKKKKRKRRKRAPYLRKLKKKHKRKKRRKRRKKKK
    43  275 A E  S    S-     0   0  121   60   69  EEEEED PQPP PQQEPEH GESPEDGKEDKAKGVVDDEEAEIEDDEEQDKDDFFESGPEEP
    44  276 A D        +     0   0  123   60   70  DDDDDG AGGG GGGGGGD GHKGDFACNGKDGGEEGSDYDYENQQNNNDKPNNNEQSNKKT
    45  277 A T  S    S+     0   0   74   60   72  TTTTTA TSTT NTSTTSA YCATARLPAAVIAADDVAAAAADADAPPDAGLDDDDTGPAAA
    46  278 A M  S    S-     0   0   31   61   86  MMMMMMMMMMMMMMMMMMT tp.MttNktagittssysgdsdrcfsttataddkkGnqkddr
    47  279 A E     >  -     0   0   38   58   63  EEEEESDSSSSSDESSSS. qe.Sed.eeeedeesskdesescdaqeeaddvacc.areeee
    48  280 A V  H  > S+     0   0   45   62   93  VVVVVEPPPPPTPEPKPEAARVALLLEFYKRIKQYYLKIKTKYKMVLLHLYARYY.LRVRRK
    49  281 A E  H  > S+     0   0    7   62   70  EEEEEEKEDEEAKEDAKEQQREQEFEDERQDEEKRRVRKHRSRLMTRRRSKKKQQ.EEAEEQ
    50  282 A E  H  > S+     0   0   53   63   53  EEEEEDDAAAAADSAAADAADAQADKDEDEDEEDDDEDAEDEAGEMDDADDKADDNAEEAAA
    51  283 A F  H  X S+     0   0    0   63   10  FFFFFFFFFFFFFFFFFFFFFFFFLFLFLLFFFLFFFLFFLFFFFMLLFLLFLFFLLFYLLL
    52  284 A L  H  X S+     0   0   17   63   49  LLLLLILLLLLLLLLLLIVLLYLMVLILLLLLLLYYLLILMLCLRLCCSVAFLYYLVELMMM
    53  285 A K  H  X S+     0   0   30   63   74  KKKKKEAEAQEQRKAEEEADSRTASSKDSRARKSRRSGARKNRESTNNHSSQRRRESQASSS
    54  286 A E  H  X S+     0   0   27   63    0  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
    55  287 A A  H  X S+     0   0    2   63   66  AAAAAAAAAAAAAAAAAAATALAAMGAILMIAALAAILVIFIVIVSIIMMLVTTTILVILLL
    56  288 A A  H  < S+     0   0   14   63   76  AASAAKQQNQQAQKNAQKSASQSNELIAKRAALKAAHEDAESARQCAAAEKAYAANKKEKKK
    57  289 A V  H >< S+     0   0    6   63   44  VVVVVVIILVIIILLIVVVVIMVLVVLMIIMCLIIIFITLLLAAIKIIIMIITIILIIMMMI
    58  290 A M  H >< S+     0   0    9   63   11  MMMMMMMMMMMMMMMMMMMMMMMMMMMMLMMMMLLLMLTMLMLVMLMMMMLLMLLMLFLMMM
    59  291 A K  T 3< S+     0   0   57   63   74  KKKKKKKKKKKKKKKKKMTTGKSKKRQKMQKKSIVVLVIKKKIVRRAAIKINLITAILKTTT
    60  292 A E  T <  S+     0   0   97   63   80  EEEEEQKKQKKKKKQKLKQKQSATSHKQHQRENHTANTNTTTADGGLLTMHKLVARHQGQQH
    61  293 A I    <   +     0   0    2   63   34  IIVVIFLLLLLFLLLLLLLIFLLLIFFVIVVFFVVVIVLLLLVLLLVVIIVICIIILLVLLL
    62  294 A K        +     0   0  167   63   73  KKKKKQRRQRRRRRQSRSRQQpRQgKQggggDKghHggrgkghgKHggqggKGHHdgggggG
    63  295 A H    >   -     0   0   27   61   15  HHHHHHHHHHHHHHHHHHH.HhHHhHHhhhhHHheEhhhhhhnhHHhhghhHHEEhhhhhh.
    64  296 A P  T 3  S+     0   0   90   63   73  PPPPPGTDQEDNSPPPDSNHPPDDIPDPKPDPDKQQPDIEPEGKPRPPLKKKHEEELPHEEP
    65  297 A N  T 3  S+     0   0   16   63   45  NNNNNNKKRKKRKKRKKRNKNNNKNNNNNNNHHNnnNNNRHReNNNNNeNNNdkkNNNNNNh
    66  298 A L  B <  S-f  147   0B   0   63   30  LLLLLLLLLLLLLLLLLLLNIVLLIILIIVIVIIiiVILLVLiLVLIIiIIVviiIVLVIIi
    67  299 A V        -     0   0    9   63   22  VVVVVVIVVVVVIVVVVVVLIIVVIMVVVVVAIVVVLILVIVVLVLVVVIVTIIIVVLVVVV
    68  300 A Q        -     0   0   47   62   72  QQQQQQQQRQ.AQQRQQQQVHQQKNNKANAVKRNRRSSGNKNKGLPSSRNNRGQQKNRSNNN
    69  301 A L  E     + E   0  83A   2   63   16  LLLLLLLLLLQLLLLLLLLRLLLLLLLLLLMLLLLLVLLMMMLMFILLLLVLLLLILLFLLL
    70  302 A L  E     -     0   0A  54   63   54  LLLLLYYYYYLYYYYYYYLLECLHLLCLLLLVLLVLIVVLLLFIMTLLHLLLKFFILLLLLL
    71  303 A G  E     - E   0  82A   0   63   33  GGGGGGAAAAYAAAAAAGGLGGGAGGGGGGAGGGGGGGGAGAGNGHGGGGGAGGGGGAGGGG
    72  304 A V  E     -aE   4  81A   0   63   62  VVVVVIVVVVAVVVVVVVVGVCVVTVVCACCVVALLCACCCCVCAVAAIAAIIFFVATCAAA
    73  305 A C  E     + E   0  80A   4   62   52  CCCCCCCVV.VCCCVCVCiVICVVCcCCcCVsCcIICCCVGIVcVcCCICCSCNNfcsCCCc
    74  306 A T        +     0   0   42   61   59  TTTTTSTSTVVSTT.S.IeITTLTTrITgTTgLgTTTTTTETTvAeTTTTTTFIIgtpTTTk
    75  307 A R  S    S-     0   0  107   63   87  RRLLLEVEQSSQLRTMSQELTSGKQDRLRELRDPKKVKLEDETVHEVVQQRRREKSLSILLS
    76  308 A E  S    S-     0   0   50   62   71  EEEEEKEEEEEEESQEEQKHSQ.EHDQKEQTLNQSSKDSSDTSRPGNNSDGNDSSKISKSSA
    77  309 A P  S    S+     0   0   90   62   71  PPPPP.EPPEEEEQEEEKGQCEDEGARECEQPDRARQGHEGETDPEGGEGRQGNNGRGPGGG
    78  310 A P  S    S-     0   0   38   62   52  PPPPPPP.IPPPPPPPPPSGPPNPPSSPDPPIPDEEPPPPMPPHNKPPPPRVPPPLEDPPPP
    79  311 A F        -     0   0   22   63   68  FFFFFIIIYIIIIFIIILLLVAIILPVLLFYPQLKKILPLLYKLLPLLKLLLLKKPLYYIII
    80  312 A Y  E     -DE  40  73A  15   63   61  YYYYYYYYIYYYYYYYYYYYMFQYFLYTLLSMFWYYMSYCHCCYAMWWYYMAECCLFCLYYY
    81  313 A I  E     -DE  39  72A   5   62   32  IIIIIIII.IIIIIIIIIIIIIIIVVIMVLMVIIIILILLKLILIVLLIVVMLLLPVLMLLI
    82  314 A I  E     +DE  38  71A   0   63   22  IIVVVIIIIVVVIVIVVVVVLIVILVIIIIIIIILLVVVVTILIVIVVLLIIVIIVIVIIII
    83  315 A T  E     -DE  37  69A  19   63   66  TTTTTQTTTTTQTTTTTTTMTMTTVLTMIMLLLLLLTVTVGVLTTSVVLVIILLLLVTMFFT
    84  316 A E  E     -D   36   0A  42   63   16  EEEEEEEEEEEEEEEEEEEEEEEEEPEEEEEPEEEEEEEEGEEEEPKKEEEEEEEEEEEEEE
    85  317 A F        -     0   0   47   63   26  FFYYYLLFYYFYLLYLFFYHFFFFYLLYYYYFLFYYLYYYGYFFYYLLYYFYYYYYYFYYYY
    86  318 A M        -     0   0   16   63   68  MMMMMMMMMMMMMMMMMMMVMVMMAMMICVVMMCAALAMCLCAMLMAAAAAPAAAACAVCCC
    87  319 A T  S    S+     0   0   65   63   80  TTPPPKKSESSSSCEKCEASESGERDVGPMPKEAPPKPPDCSAPPNEEESPEESSLRSNCCF
    88  320 A Y  S    S-     0   0   91   63   79  YYHHYGHKNKKKNNNHHNKKNNKKWKNCHYYHKNKKYNYNRDKHRWNNRKYFHKKYFKKYYY
    89  321 A G  E     -G  139   0B  28   63    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    90  322 A N  E  >  -G  138   0B   5   63   61  NNNNNCSSSSSSSSSSSCSNANSSNDSDNRDDDDDDDCDDEDEDSNCCDNNNSNNNNSNDDD
    91  323 A L  H  > S+     0   0    0   63    5  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLELLLLLFFLLLLLLLLLLLLLL
    92  324 A L  H  > S+     0   0   25   63   57  LLLLLLLLVLLLLLVSLLVVDQILRLLVLLLHLLLLLKKLDLLKFKLLLRLHLLLRQDLLLV
    93  325 A D  H  > S+     0   0   57   63   68  DDDDDHEDDDDDEGDDENDNSQDDQSQTNTHASSGGADGKDHLSKLDDSESQHNNSSVTNNN
    94  326 A Y  H  X S+     0   0   23   63   23  YYYYYYYFFFFFYYFYFYYFFYYFFVYMFFYFYYFFFWFFYFIFLFYYAYFYLVFFYIYYYY
    95  327 A L  H  < S+     0   0    1   63    8  LLLLLLLLLLLLLLLLLLLLLLLLLLLYLLLLLLLLLLLLYLLLLLIILLLLLLLLLLLLLL
    96  328 A R  H  < S+     0   0  131   63   54  RRRRRRQKKKKRQKKQKRRRRRRKRACTRRRLRKRRHVLRSRKRHRKKRRRQWRRRISRRRH
    97  329 A E  H  < S+     0   0  125   63   73  EEEDEKAETGEENKTKDDSTMDSTDENTKDTALKGSETKEDKQKRQEEQAAQTEQFNNTSSK
    98  330 A C  S  < S-     0   0   28   63   90  CCCCCSIGPEGGDNPDRRRRNRRPRSNLRHLSSKIVANCrPrQCPCHHSRRALKKQhFvkkn
    99  331 A N    >>  -     0   0   95   62   73  NNEDSQADSTDDr.SGEKGGDRGErEQsrrrRrrRkrsRhedPrhkrrrrrtrKKrganeea
   100  332 A R  T 34 S+     0   0  139   59   79  RRRKRFgGGGGG..GRGGRRGsRGkFRrwqkIqwnrkskeknRnrnnnrgwdk..kkkpkkc
   101  333 A Q  T 34 S+     0   0  165   55   91  QQDEEKrRIKRRa.IEQKTA.aRNe.Lyeer.pvqgysymtlLy.qaa.eapl..imeynne
   102  334 A E  T <4 S+     0   0  107   58   89  EEQEELSHKYYYTDKLDLVLQTART.VLTATGKQIEHLDISVNN.APP.QEPV..TSTIVVG
   103  335 A V  S  < S+     0   0    0   60   60  VVVVVQLLLLLLLLLKLRIVFLIVL.NLFLIELFKVILFVLIGF.IMM.LYINSNLVMLLLL
   104  336 A N     >  -     0   0   67   60   76  SNNNT.KKTRKHRNNLMKGSTTTQTKKDTTDNSTLLTPNTSTSE.STT.TTSKMDQSSDTTT
   105  337 A A  H  > S+     0   0   70   60   84  AAAAASMLILLFMLVPL.GTPTRLLLTHLSTPLQLHEMELSLLV.QEE.FLPRLLTTLNFFT
   106  338 A V  H  > S+     0   0   57   63   87  VVVVVAQPNPPESSNSPEDPIRKPLDDKTREFPMGGKEMKQKGMRQKKQKVSHHHSALKEEN
   107  339 A V  H  > S+     0   0   13   63   78  VVVVVETQKQQDDTKLQMRQQDDKNEIEDDETDESNSQKQQQRERDEENDDYINNFDVEDDD
   108  340 A L  H  X S+     0   0   26   63   30  LLLLLMLLLLLLQLLILLLLLLQLLLLLLLLLMLLLLLILLLFMRLKKFLTLFLLLLQLLLL
   109  341 A L  H  X S+     0   0   27   62   59  LLLLLTIVLVVIIIL.VLILVTIIMLLHVTHIVVLLWIYLILAYLVFLWVSLELLHILHLLL
   110  342 A Y  H  X S+     0   0   79   63   89  YYYYYEDDDDDYDDDDDSNQGANDTYDDITDRSSGRNRQQRMRQQHKKRSMLNYYESQNCCS
   111  343 A M  H  X S+     0   0    0   63   56  MMMMMMMMMMMIMIMMMVFFMFFFFFMFTFFFIAYYIFVFFFYVMMFFLCAMMFFKWVFFFF
   112  344 A A  H  X S+     0   0    2   63   37  AAAAAVAAAAAAGAASACSSLAASCAAASAAMCAAAAGAAAAAAAAAAGASAMAAASAAAAT
   113  345 A T  H  X S+     0   0    8   63   91  TTTTTRASAAATAAAAAQMLRVSAYYIRFYRVVYVVHIRVWVVRLIYYVYYKVIIRFRLYYY
   114  346 A Q  H  X S+     0   0   11   63   31  QQQQQQQQQQQQQQQQQDDHGHDQQQQQQCQDDQHHQDQQQQQQDQEEDQQQEDDEQQQQQQ
   115  347 A I  H  X S+     0   0    0   63   17  IIIIIVIIIIIVVIIIVVVVIVTTIVIIVVIIVVIIVVIIVIIIVIIIVVIIVIIIIIIVVV
   116  348 A S  H  X S+     0   0    0   63   38  SSSSSAAAAAAAAAAAACCAAACAAACASAAAAASSAAASASSAAAAAAASACTTAACAAAA
   117  349 A S  H  X S+     0   0   24   63   83  SSSSSAAAESASSSEHEEKEASNEKCACRKRCKRRRLNNYDYRRECKKRRKECHQSRDNKKK
   118  350 A A  H  X S+     0   0    0   63   22  AAAAAAGGGGGGGGGGGGAGGGGDGGTGAGGGGGGAGGGGGGAGGGGGAGGGGAAGGGGGGG
   119  351 A M  H  X S+     0   0    0   63   12  MMMMMMMMMMMMMMMMMMMMMMMGMMMMMMMMCMLLLMMLMLLMMMMMLMMMLLLMMMMMMM
   120  352 A E  H  X S+     0   0   61   63   65  EEEEEKAAAAAEAAASAEEEKDAAEEKKQEEEKEQQESIEEEEDNSRRLEEQESGADVREEE
   121  353 A Y  H  X S+     0   0   41   63   40  YYYYYYYYFYYYYYFYYYYYYFYYYYFHFYHYYFEEYHYYYYEHYYHHYYFYHHHHYQFFFF
   122  354 A L  H  <>S+     0   0    0   63   13  LLLLLLLIIVILLLILMLLLLVLILLLLLILLLLLLLLILLLLILLLLLLLLLLLLLLLLLL
   123  355 A E  H ><5S+     0   0   26   63   61  EEEEEEEEEEEEEEEEEEEESSEYAAEEAYESEAEETASSSSRAHAEEQAATAKKQASEEEA
   124  356 A K  H 3<5S+     0   0  109   63   78  KKKKKSSRERRSLTESRRASDSKTSAQESSLSDSRRKAEQSQRRsRKKESRSSGRKSLEFFS
   125  357 A K  T 3<5S-     0   0  108   63   77  KKKKKHQMRMMKQNQQMNNKMQEHRLSKRKKRMRLLTMSKQKLSpRKKLQKLRLLFKHQKKK
   126  358 A N  T < 5S+     0   0   45   63   72  NNNNNNNNNNNLNNNNNCNKSGKTKQGNRGGNHRRKREGGKGRRVEKKKKKDRRRRKEESSN
   127  359 A F  E   < -I  154   0C   8   63   56  FFFFFFYYYYYLYYYYYYFLFLFHCFFICVIFFCIIICYFIFIYIVCCLCCILIIIVVICCC
   128  360 A I  E     -I  153   0C   2   63   35  IIIIIIIIIVIIIIIIIIVVVLVTIVITVVTIVIAVIVVVIVAVVIVVVIVVVSSVLVTVVV
   129  361 A H        -     0   0    5   63    0  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
   130  362 A R  S    S+     0   0   77   63   23  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRGRGRRRGGRKRRRRRRRRRGGRRRRR
   131  363 A D        +     0   0   52   63    3  DDDDDDDDDDDDDDDDDDDDDDDGDDNDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   132  364 A L        +     0   0    0   63   13  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVVVLLVLVVLLLLLVLLLIVVLLLLLLL
   133  365 A A  S >  S-     0   0    0   63   31  AAAAAAARRRRAAARRRAAAAAAMAAPAAAAAAAAAAAAAAAAAKAAAAAAAAAAAAAAAAA
   134  366 A A  G >  S+     0   0    0   62    5  AAAAAAAAAAAAAAAAAAAAAAA.AAAAAAAAAAAAAAAAAAAASAAAAAATAAAAAAAAAA
   135  367 A R  G 3  S+     0   0   46   63   28  RRRRRRRAAAARRRAQARRRRRRCRRRRRRRRRRRRRRRRRRRRPRRRRRRRRRRRRRRRRR
   136  368 A N  G <  S+     0   0    8   63    4  NNNNNNNNNNNNNNNNNNNNNNNLNNNNNNNNnNNNNNNNNNNNNNNNNNNNNNNNNnNNNN
   137  369 A C  E <   - H   0 147B   0   63   46  CCCCCCVIIIIVVIIVICVIIVVYICCIVVLCsVVVIIIVIIVVLCIIVVVCIVVVVpVVVV
   138  370 A L  E     -GH  90 146B  35   63   12  LLLLLLLLLLLLLLLLLLLLLLLLLMQLLLLMMLLLLLLLLLLLLVLILLLLLLLLLELLLL
   139  371 A V  E     +GH  89 145B   0   63   24  VVVVVIVVVVVIVVVVVVVIVVIIVVVIVVVLSIIIVLVVVVVVVILLIVVVIIIVLDIVVL
   140  372 A G    >   -     0   0    6   63   63  GGGGGGGGSGGGGGSGGSSSNSNCANGDGDSAGATIGGGHGHSGDDNNSTGGCTTYAHDTTS
   141  373 A E  G >  S+     0   0  115   63   58  EEEEEEDDDEDEDKDEESEESDDTDSYEEHEEDDAAEEEEEDGERDVAADPSGEEEDLSHHQ
   142  374 A N  G 3  S-     0   0  133   63   61  NNNNNNGNTNNNNNTNRTDDNEDCDQSKNNGDKDDNNNRGGKDRNTDDDDDSKQQNDANGGG
   143  375 A H  G <  S+     0   0   24   63   91  HHHHHRNLLLLNNNLMLCNLLLCLNRNKYKRMCYDNLLLTETDLWLNNGNYYGNNLGVKKKK
   144  376 A L    <   -     0   0   58   63   57  LLVVVTIVSVIVVCSDVIIVVVTYINITVLVTVVVVVVVAVNVKVQVVVVVFTIITVSTVVI
   145  377 A V  E     - H   0 139B   0   63   66  VVVVVVVCCCCACVCCCVAACCACLVVLMCLVVLAACAVCCAAVVVAAGMMIAAAVAVLVVV
   146  378 A K  E     - H   0 138B  22   63   12  KKKKKKKKKKKKKKKKKKKKKKKSKKKKKKKCKKKKKKKKKKKKKKMMKKKKKKKKKKKKKK
   147  379 A V  E     -fH  66 137B   0   63   20  VVVVVVIIIVIIVVIIIIVVVVILIVVIIVIVIVLLIVIIVILIVIVVLIVVILLIVIIIII
   148  380 A A        -     0   0    2   63   44  AAAAAAAAAAACAAAAASSSSSSSAAGSAASAGAAAASAGAGASCTSSAASSAGGSAASCCC
   149  381 A D    >   +     0   0    8   63    6  DDDDDDDDDDDDDDDDDDDDDDDSDDGDDDDDDDDDDDDDDDDDDDDDDDDNDDDDDDDDDD
   150  382 A F  T 3  S+     0   0   53   63    7  FFFFFFFFFFFFFFFFFFFFFFFVFFFFFFFFFFFFFFFFFFFFFNFFFFFFFFFFFYFFFF
   151  383 A G  T 3  S+     0   0   33   63    6  GGGGGGGGGGGGGGGGGGGGGGGVGGSGGGGGGGGGGGGGGGGGGAGGGGGGGGGGGGGGGG
   152  384 A L    <   -     0   0   18   63   12  LLLLLLLLLLLLLLLLLMLLLLLPLFSLLLLLLLLLLLLLMLLLLLLLLLLVLLLMMLLLLL
   153  385 A S  E     -I  128   0C  22   62   46  SSSSSAAAAAAAAAAAATTASS.SALASASSSAAAAASTCACAASSSSSAAVAAASASSAAA
   154  386 A R  E     +I  127   0C  56   62   30  RRRRRRRRRRRRrRRRRRKKRR.SRIRRrRRRRRrrNRTrKrhERRRRrrRNRrrKriRrrr
   155  387 A L        -     0   0   23   43   68  LLLLLYLLLLLVfALDLY.AFD.V.EF.iS.K..vv...i.iv.....iv...vvKma.iii
   156  388 A M    >   -     0   0  108   44   72  MMMMMVIIIIIIQIIDIV.ELV.I.IV.YV.I..YY...Y.YY.I...YH...YYLYS.MMM
   157  389 A T  T 3  S+     0   0   75   49   89  TTTTTIKEEEEAMKELEL.RTIAF.PPTKRHY..AA...A.RA.K...Tn.R.NSSYRHSSH
   158  390 A G  T 3  S+     0   0   68   60   47  GGGGGDEDDDDDdED.DD.KenRNdpDGEdGsddtsdddDdDedHddddpdd.ttQEgGddD
   159  391 A D    <   -     0   0   90   58   69  DDDDDDDNNNNDnKNYDDE.prPTdeD.Ea.dderkgsgQdSsgSdgghidd.ppNGa.rvN
   160  392 A T        -     0   0   75   61   88  TTTTTEEEEEEEVIEAEEA.TEVNYVEIHGVYYETTVEYSIASYTYAARRLY.VVYNSIGVN
   161  393 A Y  E     -J  184   0D  49   62   69  YYYYYYYYYYYYYYYKYYS.YYDHYVYYYEYYYYNNIYQQYNGRFHYYDAYYDINYYVYNRY
   162  394 A T  E     -J  183   0D  15   62   89  TTTTTTETTTTCEETANIS.TESWRTEVVMVRRVRNKVRYIYNRLCDDNVVIMHHRQSTNGV
   163  395 A A        -     0   0    2   63   82  AAAAAAAAAAAPASAQPSTGSSNVKEANKYNQKKPHGKQKRKDQSLNNPLKMYQQKQTNVNS
   164  396 A H    >   -     0   0   31   62   83  HHHHHSRRRRRKK.RSQSQLSKQLTRSTTETGEHGGRSDSTSDDSGTTGLTEAGGTTATNVK
   165  397 A A  T 3  S+     0   0   41   63   82  AAAAAEVQEQQQETEGQSDDLTQTTGVRTQRCGTVVATAKTKVRKDTTQLTDNQQSGGRLRG
   166  398 A G  T 3  S+     0   0   51   63   68  GGGGGGGGGGGGGSGSGGTSGKGGDMGNARKAEPDEEKEGEGDLSNGGSQSLSEEKQSTKLS
   167  399 A A    <   -     0   0   22   63   70  ATAAATAAAAASTKASAAASGRGAGGVKGGRSGGEEKSQGGGERTEGGNGGPEQQGKMRAAT
   168  400 A K        -     0   0  124   63   73  KKKKKKRKKKKRKTKKKKKRKCKKRRKKLAMKLLLFCKKKRRLKANVVHRLPLRRMLAKRRF
   169  401 A F        -     0   0   43   63   33  FFFFFFFFFFFFFFFLFFLLILFFLVYVLLLLLVLLVLILLLLIGRLLLLLLLLLLMRLLLL
   170  402 A P    >   -     0   0   43   63    5  PPPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPPPPPTPPPPPPPPPPPPPPPPP
   171  403 A I  G >  S+     0   0   53   63   30  IIIIIIIIIIIVVIIVIVVVILIIVIVLVILVVILLLLLLVVLLPVVVLVVILLLFVVLVVV
   172  404 A K  G 3  S+     0   0   25   63   20  KKKKKKKKKKKKKKKKKKKKRRKKKKRRKRRKRKKKKRRKKKKKERRRKKKRKKKKKRRKKK
   173  405 A W  G <  S+     0   0   36   63    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   174  406 A T    <   -     0   0    9   63   59  TTTTTATTTTTTTSTTTSTTTMTTMMSLMMLLMIMMVMIMTMMMMMMMMMMMMMMMMMLMMM
   175  407 A A    >>  -     0   0    1   63   22  AAAAAAAAAAAAAAAAAPSAASAAASPSAAAASAAASAASASAAAAAAAAAAAAAAAASAAA
   176  408 A P  H 3> S+     0   0    1   63   57  PPPPPPPPPPPPPPPPPPPPPPPPFVPIIPLLPILLPYPPVPLPPLIILPPPPIIPIPIPPP
   177  409 A E  H 3> S+     0   0   26   63    0  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
   178  410 A S  H <> S+     0   0    0   63   52  SSSSSVAAAAAAAAAAAVAAASAAASVAASSSSSSSRSRAAASRVSSSSASAGSSSSSASSS
   179  411 A L  H  < S+     0   0   41   63   36  LLLLLIAAIAAIIAIIAFLLILLILIIMLLMLLLIIMLLILILLLLLLLLLILLLLLIILLI
   180  412 A A  H  < S+     0   0   41   63   91  AAAAALNMNLMINLNLLHRKAFKNFVTRVITAVTEEQFLRIKEERVEERFFLKVLRTERFFF
   181  413 A Y  H  < S-     0   0  152   63   85  YYYYYYYFYYFYERYYYFEHYDDYDSHDDQDDDDTTSYRHGHSGNNDDDDDENHHDDREEED
   182  414 A N     <  +     0   0   35   63   77  NNNNNSSGGGGGNKGNGNKGRNSGRGAHQSNNGKGGgNeYgYRgENYYGRRGeLLARRNGGN
   183  415 A K  E     +J  162   0D  99   63   84  KKTTTKKRTRRKKITRRKKKKILSVTRLVVLLIIEEpVrEeEEvPETTEVVDlQQIIQVIIL
   184  416 A F  E     +J  161   0D  11   63   12  FFFFFFFFFFFFFFFFFYFFFYFFYFYYYFYYFYYYIYYFYFFYSFYYFYYVFFFFFYYYYY
   185  417 A S    >>  -     0   0   17   62   41  SSSSSSSTTTTSTSTSTSSSTSTTTS.STTSTTSTTTTTSTTTTNSTTTTTTTSSTSSSTTT
   186  418 A I  H 3> S+     0   0   10   62   80  IIIIISIIIIIIIIIVISTSSTSITM.SHQSVTQCCSSSITMCAESTTHHETDCCETESIIT
   187  419 A K  H 3> S+     0   0   41   62   47  KKKKKKKKKKKKKKKKKKKKAKKKQK.KSKQQLKQERQKKLQEQKAKKKQKSKEEKQKKKKL
   188  420 A S  H <> S+     0   0    5   62    2  SSSSSSSSSSSSSSSSSSSSSSSSSS.SSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSS
   189  421 A D  H  X S+     0   0    2   62    0  DDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   190  422 A V  H  X S+     0   0    0   62   13  VVVVVVVVVVVVVVVVVVVVVVMMVV.VVIVVIVVVVVVIVVTVVVVVVVVVILLVVVIVVV
   191  423 A W  H  X S+     0   0    1   62    0  WWWWWWWWWWWWWWWWWWWWWWWWWW.WWWWWWWWWWWWWWWWWFWWWWWWWWWWWWWWWWW
   192  424 A A  H  X S+     0   0    6   62   27  AAAAAASSSSSSSSSSSSSSSSSSSS.ASSAAASSSSSSSSSSSSASSSSSASSSSSAASSS
   193  425 A F  H  X S+     0   0    0   63    6  FFFFFFFFFFFYFFFFFFYFYFFFFFSFFFFFFYFFFFFFFFFFFFYYYYFFFFFFYFYYYY
   194  426 A G  H  X S+     0   0    0   63    2  GGGGGGGGGGGGGGGGGGGGGGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   195  427 A V  H  X S+     0   0    0   63   13  VVVVVIIIIIIIIIIIIVIVIVIIIVIIVIVVVVVVIVVIVIVIVVVVVVIIVVVIVVVIII
   196  428 A L  H  X S+     0   0    0   63   28  LLLLLLLLLLLLLLLLLLLLVLLLVVLVLLVTLLLLLLVLVLLVITLLLLLTLLLTLTVLLL
   197  429 A L  H  X S+     0   0    5   63   10  LLLLLALLLLLLLLLLLMLLMLLLVLLLLVLMMLLLLLLLLMLLLLLLLMLLLLLVLMLLLL
   198  430 A W  H  X S+     0   0   13   63   43  WWWWWWTTTTTMYTTTTWWWWWWMWWWWWWWWWWWWYWYFYFWYWWWWWWWWWWWWWWWWWW
   199  431 A E  H  <>S+     0   0    1   63    0  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
   200  432 A I  H ><5S+     0   0    6   63   21  IIIIIVLLILLLIIILLVIVVIIIIILIIIIIVIIIMIIVIIIILLMMIIIIVIIIIVIIII
   201  433 A A  H 3<5S+     0   0   18   63   80  AAAAAYVVVTVFVIVVIFYFMVYVIIWGFVCMLFAATIAICVACAMEEAFMLAVVFFWGFFF
   202  434 A T  T 3<5S-     0   0   19   63   30  TTTTTTTTTTTTTGTTSTSSSTSTTTSTTTTTTTTTTTTTTTATTTSSTTTTQTTTTTTSSS
   203  435 A Y  T < 5S-     0   0   30   63   74  YYYYYGYKHKKYFKHYKEFYYLFYFAGLLLLRLLLLLLLLILFLSLGGMLLFLGGLLYLLLL
   204  436 A G  S     S-     0   0    2   62    0  YYYYYYYYYYYYYYYYYFYYYYYYYYYYYYYYYYyfYYYYYYyY.YYYyYYYYyyYYYYYYY
   209  441 A P  T 3  S-     0   0   74   63   44  PPPPPPPPPPPPPPPPPEPPWPPPPGPPPPAAPPDDPEPPPPQPHVAAPPPGPGGPPWPPPP
   210  442 A G  T 3  S+     0   0   88   63   44  GGGGGAGGGGGGTDGGGNRKDGSGGRATGGNGADgdGGGGGGrGGDGGgGGDgnnTGaTggg
   211  443 A I    <   -     0   0   40   62   59  IIIIITMMMMMMMLMQMKIMMMIMVLFVLMVIRLlvIM.MIIlLMIMMpILKeppLLtIppi
   212  444 A D    >   -     0   0   82   63   75  DDDDDNTVTVVHTTTTNSPSSTSSPSSSPEAETHSTDNLPAQSSNDSSDPPSGTTTEDSVVV
   213  445 A L  G >> S+     0   0   87   63   85  LLLLLNNNNNNSNNNNNNLLNGLNINNNAADNNPFFQGGPGPCVPPGGCVTDACCAGDNDDD
   214  446 A S  G 34 S+     0   0   86   63   88  SSSSSTARPRRRFRPARLKKQRAPEKIHNRAALSLLDKREKDPNMFVVHEEVDQQDNSSAAS
   215  447 A Q  G <> S+     0   0   96   63   51  QQQQQDEEEEEEQEEEEQEEDDDDKDQEEEQEEDQQTRTDDDKHQEEEHEQERQQETLENNS
   216  448 A V  H <> S+     0   0    1   63   32  VVVVVVVVVVVVVVVVVVVVVVVVLTVLVVLIVVMMLMLVIILLVMIILLLVLLLILILFFF
   217  449 A Y  H  X S+     0   0   60   63   63  YYYYYVLLILLIVLILLVVSGMVICMLLYMMYLFVVLMLLPLVKVALLIFLLFVVLVGIYYY
   218  450 A E  H  > S+     0   0   95   63   68  EEDDDQTEQDEEQDQQDEPEGEMRMVDSQRTNQEGGMDEPDDGDGAEKNKDEDEEPRPPKKN
   219  451 A L  H ><>S+     0   0   51   63   90  LLLLLMQQNQQNQQNQQARARMHALQQFYRYYFYIIKMEFCHLRAYRRVLYNAIIHQKFLLK
   220  452 A L  H ><5S+     0   0    3   63   29  LLLLLVVVLVVILVLVVIVVDIVLLVILLVLLVLLLIILLLLLLVLLLLLLILLLLLVLIII
   221  453 A E  H 3<5S+     0   0  100   63   72  EEEEEIEEEEEEPEEEESEERDNENKEHMKLIRLRRKKREEDRQGKKKEKSIQQQNELMRQK
   222  454 A K  T <<5S-     0   0  173   63   77  KKKKKNHRRRRRKSRKHNKKCQERTNRNEDSGNDRQAGTGTAQAFDQQEEEKNQQSKEANNS
   223  455 A D  T < 5 +     0   0  112   63   20  DDGGGGGGGGGGGGGGGGGGDGGDGGGGGGGGEGGGGGGGGGGGQGGGGGGLHGGGGGGGGG
   224  456 A Y      < +     0   0   92   63   63  YYYYYYYYYYYFYYYYYFYYYYYYYYYNQHNNGKIIYGYGYGLYHYYYHHQYFIILYDNFFY
   225  457 A R        -     0   0   19   63   13  RRRRRRRRRRRRRRRRHRKRRRRRRRRRRRRRCRRRRRRRRRRRRRRRRRRERRRRRRRKKR
   226  458 A M        -     0   0    4   63   20  MMMMMLMMMMMMMMMMMLMMLMMMMLLLMLLLLMMMMLEIMMLMRILLLMMGLLLLMLLMMM
   227  459 A E        -     0   0  157   63   68  EEEEEEPPVPPPSPVPTYDEPDEPEPEDAEVKDEEKEEPEPDDPLAEEQDAGPDDQESEDDS
   228  460 A R        -     0   0  113   63   69  RRQQQKQCRCCKSQRKCRSPPRSRRKKRQRRQRKRRKKRKCQRKPQKKLKQERMMVKKRQQK
   229  461 A P    >   -     0   0   12   63   17  PPPPPPPPPPPPPWPPPPPPPPPTPPPPPPPpPPPPPPPPpPPPiPPPPPPnPPPNPPPppP
   230  462 A E  T 3  S+     0   0  192   56   72  EEEEELPPDPPTPPDPPHDEPRDEVQ.EESDpDVPPAVPDvDPEpI..RTQp.AA..E.eeE
   231  463 A G  T 3  S+     0   0   70   63   65  GGGGGRNGNESnNDNGGLGGDHGSNHkNDHNrNDGGSPGNDNGDDNssGNNsqEEEdTeEEH
   232  464 A C    <   -     0   0    5   59   28  CCCCCCCCCCCfCCCACACCCCCCCCcCCCVsCCCCCCLC.CCCVCccCCCacCC.aCc..A
   233  465 A P     >  -     0   0   73   59   41  PPPPPPEPPPPPHPPPPPPPPPPPSPPSPRSDPAPPSPQP.PPPDPSSSTPSTPP.PPT..P
   234  466 A E  H  > S+     0   0   88   60   75  EEPPPDPTEEEDKDEDAMPGAKQEKSYAQPENDQEETDQEANDDPDQQMHLNEPP.TWP..Q
   235  467 A K  H  > S+     0   0  120   61   69  KKKKKARSESSNCSEASSVPSPEEEEKEEEKLDEDDEEDNTNKASEEENEEEDDDECGQ..D
   236  468 A V  H  > S+     0   0   11   63   41  VVVVVALLLLLILLLLLVVILLILLLVLMFLLLILLMILFLYLMILLLMLICRLLMMCVIIV
   237  469 A Y  H  X S+     0   0   34   63   24  YYYYYYYHYHHYYYYYYYYHHYYYYYYYYYYYYYYYYYYYYYYYAFYYYYYYYYYPGYYYYY
   238  470 A E  H  X S+     0   0  140   63   71  EEEEESEdQDEQDAHNDEDAADDDEDAEDRQDHNRRASDDQEDDSAAARMTKQVVkERTIID
   239  471 A L  H  X S+     0   0   29   63   29  LLLLLTImLLLLIILIVVILLVIIIILLLLILLILLLIMVVVVLIVLLLIILLIIiIIIIIM
   240  472 A M  H  X S+     0   0    0   63    2  MMMMMMMMMMMLMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMIMMMMMMMMMMLMMMMMM
   241  473 A R  H >< S+     0   0   93   63   89  RRRRRRLLRCMLLLMTLYKGLRTLRRRLLSLYGTRRKTLMARKLQAYYVRRQLTTDSQLQQM
   242  474 A A  H >< S+     0   0   29   63   78  AAAAAKEQLQQQDNLNQSQSDDKKNSRHRRKQLDSAKTRQSSSQECEEREDKQSSSSEQSSK
   243  475 A C  H 3< S+     0   0    0   63    7  CCCCCCCCCCCCCCCCTCCCCCTCCCSCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   244  476 A W  T << S+     0   0    2   63    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   245  477 A Q    <   -     0   0   93   63   76  QQQQKHHKKRKDKDKKRHTEQSNKNLRKQHSSSVRRKKQNAARRQANNSHMRKSSKKKLAAN
   246  478 A W  S    S+     0   0  107   61   93  WWWWW KKEKKADVEELELAKAIKEK AHSAAALDDLTWATQEWNLPPAAQLFEEQADEFFS
   247  479 A N  S >  S-     0   0   68   61   66  NNSSS DEREDVVDRSDTDEEENKND EDDNDMSVVDLDDCEEQDDEEDVLDNDDNDNEDDE
   248  480 A P  G >  S+     0   0   33   61   30  PPPPP PPPPPPPPPAPPAPRPAPPA PPPPPPPPPPPEPPPPPPPPPHPPPEPPLPKPSSP
   249  481 A S  G 3  S+     0   0   94   61   76  SSLLA MEEEEEAKEDEKVAANDEES DAQDKEEAAWEDDDSSVSEKKDSDKKTTIKHERRE
   250  482 A D  G <  S+     0   0   96   61   68  DDDDD REDEEKDKDEEGVRNAQDAG DQRDQKDTTKDDDDMALQENNRQQRNTAEEAEKKK
   251  483 A R  S <  S-     0   0    5   61    0  RRRRR RRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   252  484 A P        -     0   0   17   61   13  PPPPP PPPPPPPYPPPPPPPPPPPT PPPPPPPPPPPPIPPPPPPPPPPPPPPPTPPPPPP
   253  485 A S     >  -     0   0   23   60   64  SASSS TTTTTTTSTTTASPRSSTTD STDTSST TTSEETDESSKAAETHSDKKSSNTSSS
   254  486 A F  H  > S+     0   0    0   60   28  FFFFF FFFFFFFFFFFFFFFFFFFF FFFFFFF PFFFFFFPFFFFFPFFFAPPFFFFFFF
   255  487 A A  H  > S+     0   0   36   60   74  AAAAA EEDEEEEEDEETRRSKTETE ATGHTAT DTPTSAGAREQSSQRGETEEASIDPPL
   256  488 A E  H  > S+     0   0  120   60   82  EEEEE TYYYYFTTYTYEDKEAEYSS DQEQCQE GQQEDSTESKQIDDQTDTVVDEDAHHG
   257  489 A I  H  X S+     0   0    1   60   26  IIIIT LLLLLLLLLLLLLLVLTMLL ILLLLVL LVLLVLILLILIILLLIILLIILLLLL
   258  490 A H  H  X S+     0   0   25   58   89  HHHHH QQRQQNQLRRQLRA TAQVV YLKRRLV EVKYRQREKLVVVIVVVRRRLE YTTS
   259  491 A Q  H  X S+     0   0  109   57   81  Q QQQ WTSAAHWCSWSQEE DVSQK KESCMLK EKSEMKQQDNQSSKEETEEEEE KSSD
   260  492 A A  H  X S+     0   0   32   57   92  A AAA KFVFFYKKVQFVKK RKVAR STESEQK RESEQLKRKDCRRSDRMRRRNM VFFT
   261  493 A F  H  X S+     0   0    2   57   18  F FFF LLLLLFLLLLLLLL LLLFL LILLLLL LLLLLLLLILLLLVHLFLLLYI LLLI
   262  494 A E  H  X S+     0   0   55   52   52  E EEE EEEEEEEEDEETQA  SEDE EDGEEED  NDDANATDQTEE DGSE  TS SGGA
   263  495 A T  H  X S+     0   0   45   49   74  T TTT DDDDDSDDDDDEDR  ADDL  KQDNDK  ARATTSEKAEEE RN A  PS  CCS
   264  496 A M  H  X S+     0   0   30   46   77  M MMM FYFYYFFAFFYIIE  IFLM  ILFILM   TVQLQ NLFTT VV    PQ  QQL
   265  497 A F  H >< S+     0   0   58   37   25  F FFF YFFFF FYFFF IL   Y L  LL L I   LVL L L  LL LL    FM  LLL
   266  498 A Q  H 3< S+     0   0  132   27   70  Q HHH       D THT TR   T N  ED       QDE E    RR  E    DE  EAP
   267  499 A E  H 3<        0   0  149   24   60  E DDD         ATS NS   A    GD       DSD D    AA       NS  DDS
   268  500 A S    <<        0   0  101   16   58  S SSS         TGT  A   T     A       S                  T  AAS
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1  233 A   0   0   0   0   0   0   0   0   0   0   4   0   0   4   0   0   0  17   4  70    23    0    0   0.966     32  0.71
    2  234 A   0   0   9   0   0   0   0   0   6   0   0   0   0   0  18  39   9  15   0   3    33    0    0   1.675     55  0.32
    3  235 A   0   3   0   0   5  87   5   0   0   0   0   0   0   0   0   0   0   0   0   0    38    0    0   0.528     17  0.93
    4  236 A   0   0   0   0   0   0   0   0   5   0   0   0   0   0   2   0   5  88   0   0    42    0    0   0.491     16  0.82
    5  237 A  17   7  36  12  19   0   2   0   0   0   0   0   0   0   2   5   0   0   0   0    42    0    0   1.747     58  0.48
    6  238 A   0   0   0   0   0   0   0   0   0  38  10   0   0   0   0   2   0  21  10  19    42    0    0   1.550     51  0.36
    7  239 A   0   0   0   0   0   2   0   0   5   7   7   0   0   7  64   2   0   5   0   0    42    0    0   1.317     43  0.50
    8  240 A   0   0   0   0   0   0   0   2   5   0  23  19   0   0   7   2   0  23   5  14    43    0    0   1.912     63  0.31
    9  241 A   0   0   0   2   2   0   2   0   5   0   9   5   2   2  21   2   0   9  12  26    43    0    0   2.178     72  0.19
   10  242 A  11  57  28   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   2   0    47    0    0   1.076     35  0.70
   11  243 A  11   0   4   0   0   0   0   0   4   0   4  32   0   2   4  23   4   6   2   2    47    0    0   2.036     67  0.24
   12  244 A   2  49  22  12   8   0   0   0   0   2   0   2   0   0   0   2   0   0   0   0    49    0    0   1.464     48  0.64
   13  245 A   6   6   8   0   0   0   2  37   2   0   0   2   0   2   2  14   2  10   4   2    49    0    0   2.112     70  0.19
   14  246 A   4   0   0   0   0   0   2   2   0   2   0   2   0  10  20  22   6  16   2  12    50    0    0   2.122     70  0.28
   15  247 A  14  12   6  10   2   0   0   0   0   2   2   2   0   0  14  14  10  10   0   2    50    0    0   2.331     77  0.16
   16  248 A   6  60  32   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    53    0    0   0.907     30  0.75
   17  249 A   2   0   0   0   0   0   0  94   0   0   0   0   0   0   0   0   2   0   0   2    54    0    0   0.276      9  0.91
   18  250 A   0   2   2   4   0   0   0   9   9   0  24   4   0   0   7   9   4  24   2   0    54    0    0   2.127     71  0.24
   19  251 A   0   0   0   0   0   0   0  98   2   0   0   0   0   0   0   0   0   0   0   0    54    0    0   0.092      3  0.98
   20  252 A   0   0   0   4   2   0   0   0  43   0   7   2   6   0   0   2  20   9   6   0    54    0    0   1.766     58  0.30
   21  253 A   0   0   0   0  85   0  13   0   0   0   2   0   0   0   0   0   0   0   0   0    54    0    0   0.475     15  0.94
   22  254 A   0   0   2   0   0   0   0  93   2   0   0   0   0   0   0   4   0   0   0   0    54    0    0   0.341     11  0.85
   23  255 A   2   9   0   0   0   0   0   2   0   0   2   4   0   6  11  13  17  30   0   6    54    0    0   2.053     68  0.26
   24  256 A  78   6   4   0   0   0   0   0   4   0   0   6   4   0   0   0   0   0   0   0    54    0    0   0.883     29  0.72
   25  257 A   9   4   6   7  15   9  22   0   0   0   0   4   2   7   7   2   0   6   0   0    54    0    0   2.349     78  0.19
   26  258 A   6  15   2   6   0   0   0   7   2   0   0   0   0   4  17   9   7  19   6   2    54    0    0   2.325     77  0.15
   27  259 A   0   2   0   2   0   0   0  56  31   4   0   0   0   0   0   0   0   2   2   2    55    0    0   1.171     39  0.60
   28  260 A  15  13   6   0   0   0   0   9   2   2  11   6   2   6  11   2   2   6   2   4    47    0    0   2.561     85  0.09
   29  261 A   0  10   0   4   0  17   4   8   2  12   4  10   0   2   8  12   2   2   4   2    52    0    0   2.528     84  0.06
   30  262 A   4   2   0   4   0   6   4   6   6  13   4   4   6   2   9   9   0   6   8   9    53    0    0   2.711     90  0.07
   31  263 A   2   4   0   0   0   2   2  13   5   4   4   7   0   0  11  13   5   9  18   4    56    0    0   2.476     82  0.17
   32  264 A   7   0   0   0   0   0  11  23   5   2   9   2   0   0   4   9   4  13   5   7    56    0    0   2.342     78  0.17
   33  265 A  12   0   3   0   2   2   0   5   0   5  14  16   2   5   0   7   7   9  10   2    58    0    0   2.488     83  0.14
   34  266 A  12  20   8   3   0   0   0   0   2   0   2  24   3   2   5   7   5   3   3   0    59    0    0   2.279     76  0.17
   35  267 A   5   7   2   0   0   0   3   0   5  14   0  22   0   0   3  19   9   2   0   9    58    0    0   2.209     73  0.16
   36  268 A  88   0   2   0   0   0   0   0   2   0   0   2   5   0   0   0   0   0   0   2    59    0    0   0.539     17  0.81
   37  269 A   5   0   2   0   2   0   0   0  88   0   0   0   0   0   0   3   0   0   0   0    59    0    0   0.516     17  0.77
   38  270 A  66   2  19   0   2   0   2   0   8   0   0   0   2   0   0   0   0   0   0   0    59    0    0   1.072     35  0.68
   39  271 A   2   2   0   0   0   0   0   0   0   0   0   0   0   0   2  93   2   0   0   0    60    0    0   0.337     11  0.88
   40  272 A   0   0   3  23   0   0   0   2   2   0  10  42   2   0   2  10   5   0   0   0    60    0    0   1.701     56  0.27
   41  273 A  13  55  12   8   5   0   0   0   0   2   3   0   0   0   0   0   0   0   0   2    60    0    0   1.455     48  0.62
   42  274 A   0   3   0   0   0   0   2   0   2   2   2   0   0   2  17  68   0   2   2   0    60    0    0   1.150     38  0.59
   43  275 A   3   0   2   0   3   0   0   7   3  13   3   0   0   2   0   7   7  33   0  17    60    0    0   2.065     68  0.30
   44  276 A   0   0   0   0   2   0   3  27   3   2   3   2   2   2   0   8   5   7  15  20    60    0    0   2.178     72  0.30
   45  277 A   3   3   2   0   0   0   2   3  32   7   5  23   2   0   2   0   0   0   2  15    60    0    0   2.000     66  0.28
   46  278 A   0   0   2  33   2   0   2   5   5   2   8  16   2   0   3   7   2   0   3  10    61    0    0   2.199     73  0.13
   47  279 A   2   0   0   0   0   0   0   0   7   0  26   0   5   0   2   2   3  40   0  14    58    0    0   1.654     55  0.36
   48  280 A  15  13   3   2   2   0  11   0   6  13   0   3   0   2  10  13   2   6   0   0    62    0    0   2.387     79  0.07
   49  281 A   2   2   0   2   2   0   0   0   5   0   3   2   0   2  16  13  11  35   0   6    62    0    0   2.006     66  0.30
   50  282 A   0   0   0   2   0   0   0   2  32   0   2   0   0   0   0   3   2  25   2  32    63    0    0   1.515     50  0.47
   51  283 A   0  27   0   2  70   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.736     24  0.89
   52  284 A   6  59   6   8   2   0   8   0   2   0   2   0   5   0   2   0   0   2   0   0    63    0    0   1.539     51  0.50
   53  285 A   0   0   0   0   0   0   0   2  13   0  21   3   0   2  17  16   6  13   5   3    63    0    0   2.117     70  0.25
   54  286 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0    63    0    0   0.000      0  1.00
   55  287 A   8  14  16   6   2   0   0   2  44   0   2   6   0   0   0   0   0   0   0   0    63    0    0   1.679     56  0.33
   56  288 A   0   3   2   0   0   0   2   0  33   0   8   0   2   2   3  17  13   8   6   2    63    0    0   2.058     68  0.24
   57  289 A  24  16  38  11   2   0   0   0   3   0   0   3   2   0   0   2   0   0   0   0    63    0    0   1.662     55  0.56
   58  290 A   2  22   0  73   2   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    63    0    0   0.761     25  0.88
   59  291 A   6   5  11   3   0   0   0   2   5   0   3  10   0   0   5  46   3   0   2   0    63    0    0   1.895     63  0.26
   60  292 A   2   6   0   2   0   0   0   5   6   0   3  11   0  10   3  19  16  11   5   2    63    0    0   2.377     79  0.19
   61  293 A  22  43  22   0  11   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0    63    0    0   1.342     44  0.66
   62  294 A   0   0   0   0   0   0   0  35   0   2   3   0   0  10  17  17  13   0   0   3    63    0    0   1.748     58  0.27
   63  295 A   0   0   0   0   0   0   0   2   0   0   0   0   0  90   0   0   0   7   2   0    61    0    0   0.407     13  0.84
   64  296 A   0   3   3   0   0   0   0   3   0  35   3   2   0   5   2  10   5  13   3  14    63    0    0   2.100     70  0.26
   65  297 A   0   0   0   0   0   0   0   0   0   0   0   0   0   6  10  19   0   3  60   2    63    0    0   1.195     39  0.55
   66  298 A  16  46  37   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2   0    63    0    0   1.083     36  0.69
   67  299 A  67  10  19   2   0   0   0   0   2   0   0   2   0   0   0   0   0   0   0   0    63    0    0   1.007     33  0.77
   68  300 A   3   2   0   0   0   0   0   5   5   2   8   0   0   2  13  10  32   0  19   0    62    0    0   1.980     66  0.27
   69  301 A   3  79   3   8   3   0   0   0   0   0   0   0   0   0   2   0   2   0   0   0    63    0    0   0.845     28  0.84
   70  302 A   6  52   5   2   5   0  19   0   0   0   0   2   3   3   0   2   0   2   0   0    63    0    0   1.602     53  0.45
   71  303 A   0   2   0   0   0   0   2  68  25   0   0   0   0   2   0   0   0   0   2   0    63    0    0   0.872     29  0.67
   72  304 A  44   3   6   0   3   0   0   2  21   0   0   3  17   0   0   0   0   0   0   0    63    0    0   1.560     52  0.38
   73  305 A  19   0  10   0   2   0   0   2   0   0   5   0  60   0   0   0   0   0   3   0    62    0    0   1.242     41  0.47
   74  306 A   5   3   8   0   2   0   0   7   2   2   7  57   0   0   2   2   0   5   0   0    61    0    0   1.626     54  0.41
   75  307 A   8  17   2   2   0   0   0   2   0   2  11   5   0   2  16   8  10  13   0   5    63    0    0   2.348     78  0.13
   76  308 A   0   2   2   0   0   0   0   3   2   2  21   3   0   3   2  10  10  27   6   8    62    0    0   2.179     72  0.29
   77  309 A   0   0   0   0   0   0   0  21   3  18   0   2   3   2   8   2   8  26   3   5    62    0    0   2.069     69  0.29
   78  310 A   2   2   3   2   0   0   0   2   0  68   5   0   0   2   2   2   0   5   3   5    62    0    0   1.391     46  0.48
   79  311 A   3  30  25   0  13   0   8   0   2   8   0   0   0   0   0  10   2   0   0   0    63    0    0   1.839     61  0.32
   80  312 A   0   8   2   8   6   5  49   0   3   0   3   2  10   2   0   0   2   2   0   0    63    0    0   1.843     61  0.38
   81  313 A  13  23  55   6   0   0   0   0   0   2   0   0   0   0   0   2   0   0   0   0    62    0    0   1.240     41  0.67
   82  314 A  38  11  49   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    63    0    0   1.026     34  0.77
   83  315 A  13  21   5   8   3   0   0   2   0   0   2  44   0   0   0   0   3   0   0   0    63    0    0   1.645     54  0.34
   84  316 A   0   0   0   0   0   0   0   2   0   5   0   0   0   0   0   3   0  90   0   0    63    0    0   0.411     13  0.84
   85  317 A   0  17   0   0  27   0  52   2   0   0   0   0   0   2   0   0   0   0   0   0    63    0    0   1.128     37  0.73
   86  318 A   8   5   2  48   0   0   0   0  24   2   0   0  13   0   0   0   0   0   0   0    63    0    0   1.435     47  0.32
   87  319 A   2   2   0   2   2   0   0   3   5  19  19   5   8   0   3   8   0  17   3   3    63    0    0   2.330     77  0.19
   88  320 A   0   0   0   0   3   3  21   2   0   0   0   0   2  14   5  29   0   0  21   2    63    0    0   1.849     61  0.21
   89  321 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.000      0  1.00
   90  322 A   0   0   0   0   0   0   0   0   2   0  29   0   8   0   2   0   0   3  30  27    63    0    0   1.515     50  0.38
   91  323 A   0  95   0   0   3   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0    63    0    0   0.222      7  0.95
   92  324 A  10  63   2   0   2   0   0   0   0   0   2   0   0   3   5   6   3   0   0   5    63    0    0   1.394     46  0.43
   93  325 A   2   3   0   0   0   0   0   6   3   0  14   5   0   6   0   3   6   6  13  32    63    0    0   2.144     71  0.31
   94  326 A   3   3   3   2  40   2  46   0   2   0   0   0   0   0   0   0   0   0   0   0    63    0    0   1.250     41  0.76
   95  327 A   0  94   3   0   0   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.280      9  0.92
   96  328 A   2   3   2   0   0   2   0   0   2   0   3   2   2   5  54  19   6   0   0   0    63    0    0   1.582     52  0.46
   97  329 A   0   2   0   2   2   0   0   3   6   0   8  14   0   0   2  14   8  22   6  11    63    0    0   2.259     75  0.26
   98  330 A   3   5   3   0   2   0   0   5   3   8   8   0  14   6  19   8   3   2   8   3    63    0    0   2.542     84  0.09
   99  331 A   0   0   0   0   0   0   0   8   5   2   8   3   0   3  32   8   3  11   6  10    62    0    0   2.169     72  0.26
  100  332 A   0   0   2   0   3   5   0  20   0   2   3   0   2   0  25  20   3   2  10   2    59    0    0   2.070     69  0.21
  101  333 A   2   7   5   4   0   0   9   2  11   4   2   4   0   0  11   5  11  16   5   2    55    0    0   2.559     85  0.08
  102  334 A  10  10   5   0   0   0   5   3   5   5   5  12   0   3   2   5   7  12   3   5    58    0    0   2.655     88  0.11
  103  335 A  18  38  12   5   8   0   2   2   0   0   2   0   0   0   2   3   2   2   5   0    60    0    0   1.959     65  0.40
  104  336 A   0   5   0   3   0   0   0   2   0   2  15  32   0   2   3  12   3   2  13   7    60    0    0   2.111     70  0.24
  105  337 A   3  30   2   5   7   0   0   2  10   7   5  12   0   3   3   0   3   7   2   0    60    0    0   2.341     78  0.15
  106  338 A  11   3   2   5   2   0   0   5   3  11   8   2   0   5   5  14   6  10   5   5    63    0    0   2.653     88  0.13
  107  339 A  11   2   3   2   2   0   2   0   0   0   3   5   0   0   5   6  16  14   8  22    63    0    0   2.297     76  0.22
  108  340 A   0  76   3   5   5   0   0   0   0   0   0   2   0   0   2   3   5   0   0   0    63    0    0   0.993     33  0.70
  109  341 A  16  40  18   2   2   3   3   0   2   0   2   5   0   6   0   0   0   2   0   0    62    0    0   1.845     61  0.41
  110  342 A   0   2   2   3   0   0  16   3   2   0  10   3   3   2  10   3  10   3   8  22    63    0    0   2.419     80  0.10
  111  343 A   6   2   6  35  37   2   5   0   3   0   0   2   2   0   0   2   0   0   0   0    63    0    0   1.669     55  0.44
  112  344 A   2   2   0   3   0   0   0   5  71   0  11   2   5   0   0   0   0   0   0   0    63    0    0   1.081     36  0.62
  113  345 A  16   5   8   2   3   2  17   0  16   0   3  11   0   2  13   2   2   0   0   0    63    0    0   2.289     76  0.09
  114  346 A   0   0   0   0   0   0   0   2   0   0   0   0   2   6   0   0  68   6   0  16    63    0    0   1.034     34  0.68
  115  347 A  37   0  60   0   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0   0    63    0    0   0.782     26  0.82
  116  348 A   0   0   0   0   0   0   0   0  67   0  21   3  10   0   0   0   0   0   0   0    63    0    0   0.929     31  0.61
  117  349 A   0   2   0   0   0   0   3   0  10   0  19   0   8   3  16  16   2  13   6   3    63    0    0   2.222     74  0.17
  118  350 A   0   0   0   0   0   0   0  75  22   0   0   2   0   0   0   0   0   0   0   2    63    0    0   0.684     22  0.77
  119  351 A   0  16   0  81   0   0   0   2   0   0   0   0   2   0   0   0   0   0   0   0    63    0    0   0.595     19  0.88
  120  352 A   2   2   2   0   0   0   0   2  19   0   6   0   0   0   5   8   6  43   2   5    63    0    0   1.849     61  0.35
  121  353 A   0   0   0   0  17   0  60   0   0   0   0   0   0  16   0   0   2   5   0   0    63    0    0   1.113     37  0.60
  122  354 A   3  83  13   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.596     19  0.87
  123  355 A   0   0   0   0   0   0   3   0  19   0  13   3   0   2   2   3   3  52   0   0    63    0    0   1.486     49  0.39
  124  356 A   0   5   0   0   3   0   0   2   5   0  29   3   0   0  19  17   5  10   0   3    63    0    0   2.032     67  0.22
  125  357 A   0  13   0  11   2   0   0   0   0   2   5   2   0   5  11  32  13   2   5   0    63    0    0   2.075     69  0.23
  126  358 A   2   2   0   0   0   0   0  11   0   0   5   2   2   2  16  17   2   6  33   2    63    0    0   1.988     66  0.28
  127  359 A   6   8  21   0  25   0  21   0   0   0   0   0  17   2   0   0   0   0   0   0    63    0    0   1.746     58  0.44
  128  360 A  43   3  41   0   0   0   0   0   3   0   3   6   0   0   0   0   0   0   0   0    63    0    0   1.232     41  0.65
  129  361 A   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  130  362 A   0   0   0   0   0   0   0  10   0   0   0   0   0   0  89   2   0   0   0   0    63    0    0   0.394     13  0.76
  131  363 A   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   2  97    63    0    0   0.163      5  0.96
  132  364 A  14  84   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.489     16  0.86
  133  365 A   0   0   0   2   0   0   0   0  84   2   0   0   0   0  11   2   0   0   0   0    63    0    0   0.587     19  0.69
  134  366 A   0   0   0   0   0   0   0   0  97   0   2   2   0   0   0   0   0   0   0   0    62    0    0   0.165      5  0.95
  135  367 A   0   0   0   0   0   0   0   0  10   2   0   0   2   0  86   0   2   0   0   0    63    0    0   0.553     18  0.72
  136  368 A   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  98   0    63    0    0   0.082      2  0.96
  137  369 A  41   3  30   0   0   0   2   0   0   2   2   0  21   0   0   0   0   0   0   0    63    0    0   1.359     45  0.53
  138  370 A   2  89   2   5   0   0   0   0   0   0   0   0   0   0   0   0   2   2   0   0    63    0    0   0.513     17  0.88
  139  371 A  63  10  24   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   2    63    0    0   0.986     32  0.76
  140  372 A   0   0   2   0   0   0   2  41   6   0  16  10   3   5   0   0   0   0   8   8    63    0    0   1.845     61  0.37
  141  373 A   2   2   0   0   0   0   2   3   6   2   8   2   0   5   2   2   2  41   0  24    63    0    0   1.864     62  0.42
  142  374 A   0   0   0   0   0   0   0  11   2   0   3   6   2   0   5   6   5   2  37  22    63    0    0   1.893     63  0.39
  143  375 A   2  25   0   3   0   2   6   5   0   0   0   3   5  10   5  10   0   2  21   3    63    0    0   2.257     75  0.08
  144  376 A  49   6  14   0   2   0   2   0   2   0   5  11   2   0   0   2   2   0   3   2    63    0    0   1.761     58  0.42
  145  377 A  37   8   2   5   0   0   0   2  24   0   0   0  24   0   0   0   0   0   0   0    63    0    0   1.529     51  0.34
  146  378 A   0   0   0   3   0   0   0   0   0   0   2   0   2   0   0  94   0   0   0   0    63    0    0   0.302     10  0.87
  147  379 A  43  11  46   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.964     32  0.79
  148  380 A   0   0   0   0   0   0   0  10  54   0  27   2   8   0   0   0   0   0   0   0    63    0    0   1.177     39  0.55
  149  381 A   0   0   0   0   0   0   0   2   0   0   2   0   0   0   0   0   0   0   2  95    63    0    0   0.244      8  0.93
  150  382 A   2   0   0   0  95   0   2   0   0   0   0   0   0   0   0   0   0   0   2   0    63    0    0   0.244      8  0.92
  151  383 A   2   0   0   0   0   0   0  95   2   0   2   0   0   0   0   0   0   0   0   0    63    0    0   0.244      8  0.93
  152  384 A   2  87   0   6   2   0   0   0   0   2   2   0   0   0   0   0   0   0   0   0    63    0    0   0.557     18  0.88
  153  385 A   2   2   0   0   0   0   0   0  53   0  35   5   3   0   0   0   0   0   0   0    62    0    0   1.094     36  0.53
  154  386 A   0   0   3   0   0   0   0   0   0   0   2   2   0   2  81   6   0   2   3   0    62    0    0   0.838     27  0.70
  155  387 A  19  30  16   2   7   0   5   0   7   0   2   0   0   0   0   5   0   2   0   5    43    0    0   2.032     67  0.32
  156  388 A  11   5  30  20   0   0  23   0   0   0   2   0   0   2   0   0   2   2   0   2    44    0    0   1.839     61  0.28
  157  389 A   0   4   4   2   2   0   4   0  12   4   8  18   0   6  10   8   0  12   4   0    49    0    0   2.450     81  0.11
  158  390 A   0   0   0   0   0   0   0  17   0   3   3   5   0   2   2   2   2  10   3  52    60    0    0   1.633     54  0.53
  159  391 A   2   0   2   0   0   0   2  10   3   7   7   2   0   2   5   3   2   7  14  33    58    0    0   2.232     74  0.31
  160  392 A  13   2   7   0   0   0  13   3   8   0   5  16   0   2   3   0   0  23   5   0    61    0    0   2.206     73  0.12
  161  393 A   3   0   3   0   2   0  61   2   2   0   2   0   0   3   3   2   3   2   8   5    62    0    0   1.603     53  0.31
  162  394 A  13   2   5   3   0   2   3   2   2   0   5  24   3   3  11   2   2   8   8   3    62    0    0   2.506     83  0.11
  163  395 A   3   3   0   2   0   0   3   3  24   6  10   3   0   2   2  14  11   2  11   2    63    0    0   2.383     79  0.18
  164  396 A   2   5   0   0   0   0   0  11   3   0  15  18   0  11  13   6   5   5   2   5    62    0    0   2.351     78  0.16
  165  397 A   8   5   0   0   0   0   0  10  13   0   3  17   2   0   8   5  16   6   2   6    63    0    0   2.366     78  0.18
  166  398 A   0   5   0   2   0   0   0  40   3   2  14   3   0   0   2   8   3  11   3   5    63    0    0   2.015     67  0.31
  167  399 A   2   0   0   2   0   0   0  25  27   2   8   8   0   0   6   6   5   8   2   0    63    0    0   2.063     68  0.30
  168  400 A   3  13   0   3   3   0   0   0   5   2   0   2   3   2  19  44   0   0   2   0    63    0    0   1.784     59  0.26
  169  401 A   6  49   5   2  32   0   2   2   0   0   0   0   0   0   3   0   0   0   0   0    63    0    0   1.340     44  0.66
  170  402 A   0   0   0   0   0   0   0   0   2  97   0   2   0   0   0   0   0   0   0   0    63    0    0   0.163      5  0.95
  171  403 A  37  25  35   0   2   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0    63    0    0   1.215     40  0.69
  172  404 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  24  75   0   2   0   0    63    0    0   0.626     20  0.79
  173  405 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  174  406 A   2   6   3  48   0   0   0   0   2   0   5  35   0   0   0   0   0   0   0   0    63    0    0   1.282     42  0.40
  175  407 A   0   0   0   0   0   0   0   0  83   3  14   0   0   0   0   0   0   0   0   0    63    0    0   0.546     18  0.78
  176  408 A   3  11  14   0   2   0   2   0   0  68   0   0   0   0   0   0   0   0   0   0    63    0    0   1.024     34  0.43
  177  409 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0    63    0    0   0.000      0  1.00
  178  410 A   6   0   0   0   0   0   0   2  40   0  48   0   0   0   5   0   0   0   0   0    63    0    0   1.106     36  0.48
  179  411 A   0  56  29   5   2   0   0   0  10   0   0   0   0   0   0   0   0   0   0   0    63    0    0   1.119     37  0.63
  180  412 A   8  13   5   3  13   0   0   0  13   0   0   6   0   2  11   6   2  11   8   0    63    0    0   2.413     80  0.09
  181  413 A   0   0   0   0   5   0  27   3   0   0   5   3   0  10   5   0   2  10   5  27    63    0    0   2.020     67  0.15
  182  414 A   0   3   0   0   0   0   6  32   3   0   6   0   0   2  11   5   2   5  25   0    63    0    0   1.947     64  0.22
  183  415 A  13  10  13   0   0   0   0   0   0   3   2  13   0   0  11  17   5  13   0   2    63    0    0   2.207     73  0.15
  184  416 A   2   0   2   0  57   0  38   0   0   0   2   0   0   0   0   0   0   0   0   0    63    0    0   0.885     29  0.87
  185  417 A   0   0   0   0   0   0   0   0   0   0  42  56   0   0   0   0   0   0   2   0    62    0    0   0.754     25  0.58
  186  418 A   3   0  32   3   0   0   0   0   2   0  19  16   8   5   0   0   3   6   0   2    62    0    0   1.969     65  0.20
  187  419 A   0   5   0   0   0   0   0   0   3   0   3   0   0   0   2  66  15   6   0   0    62    0    0   1.165     38  0.52
  188  420 A   0   0   0   0   0   0   0   0   0   0  98   2   0   0   0   0   0   0   0   0    62    0    0   0.083      2  0.97
  189  421 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    62    0    0   0.000      0  1.00
  190  422 A  84   3   8   3   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    62    0    0   0.639     21  0.86
  191  423 A   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0    62    0    0   0.083      2  1.00
  192  424 A   0   0   0   0   0   0   0   0  24   0  76   0   0   0   0   0   0   0   0   0    62    0    0   0.553     18  0.72
  193  425 A   0   0   0   0  78   0  21   0   0   0   2   0   0   0   0   0   0   0   0   0    63    0    0   0.587     19  0.94
  194  426 A   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   2   0    63    0    0   0.082      2  0.97
  195  427 A  52   0  48   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.692     23  0.86
  196  428 A  14  76   2   0   0   0   0   0   0   0   0   8   0   0   0   0   0   0   0   0    63    0    0   0.752     25  0.71
  197  429 A   5  83   0  11   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.613     20  0.90
  198  430 A   0   0   0   3   3  71   8   0   0   0   0  14   0   0   0   0   0   0   0   0    63    0    0   0.938     31  0.56
  199  431 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0    63    0    0   0.000      0  1.00
  200  432 A  13  16  67   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.969     32  0.78
  201  433 A  21   3  10   6  17   3   5   3  21   0   0   3   5   0   0   0   0   3   0   0    63    0    0   2.193     73  0.20
  202  434 A   0   0   0   0   0   0   0   2   2   0  17  78   0   0   0   0   2   0   0   0    63    0    0   0.697     23  0.70
  203  435 A   0  40   2   2  10   0  21  10   2   0   2   0   0   3   2   8   0   2   0   0    63    0    0   1.846     61  0.25
  204  436 A   0   0   0   0   0   0   0  94   3   0   2   0   0   0   0   0   2   0   0   0    63    0    0   0.302     10  0.91
  205  437 A   3   3   0  10   0   0   0  21   3   0   3   3   0   0  22  13   8   5   6   0    63    0    0   2.215     73  0.17
  206  438 A  17   0   5   6   2   0   2   0   2   3  21  16   0   0   3   0   5   5   6   8    63    0    0   2.325     77  0.14
  207  439 A   0   0   0   0   0   2   0   0   0  98   0   0   0   0   0   0   0   0   0   0    63    0    0   0.082      2  0.94
  208  440 A   0   0   0   0   3   0  97   0   0   0   0   0   0   0   0   0   0   0   0   0    62    0    0   0.143      4  1.00
  209  441 A   2   0   0   0   0   3   0   6   6  73   0   0   0   2   0   0   2   3   0   3    63    0    0   1.106     36  0.56
  210  442 A   0   0   0   0   0   0   0  63   6   0   2   6   0   0   5   2   0   0   6  10    63    0    0   1.314     43  0.56
  211  443 A   6  16  26  31   2   0   0   0   0   8   0   3   0   0   2   3   2   2   0   0    62    0    0   1.874     62  0.41
  212  444 A  10   2   0   0   0   0   0   2   3  10  24  19   0   3   0   0   2   5   6  16    63    0    0   2.134     71  0.24
  213  445 A   3  14   2   0   3   0   0  11   6   8   2   2   6   0   0   0   2   0  32  10    63    0    0   2.144     71  0.14
  214  446 A   5   6   2   2   3   0   0   0  11   6  16   2   0   3  14   8   5   6   5   6    63    0    0   2.567     85  0.12
  215  447 A   0   2   0   0   0   0   0   0   0   0   2   5   0   3   3   3  25  38   3  16    63    0    0   1.722     57  0.48
  216  448 A  52  24  11   6   5   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    63    0    0   1.310     43  0.67
  217  449 A  19  30  10   8   5   0  17   3   2   2   2   0   2   0   0   2   0   0   0   0    63    0    0   1.990     66  0.37
  218  450 A   2   0   0   5   0   0   0   8   2   8   2   3   0   0   5   6  11  24   5  21    63    0    0   2.230     74  0.32
  219  451 A   2  17   6   5   6   0  10   0   8   0   0   0   2   5  10   5  17   2   6   0    63    0    0   2.416     80  0.09
  220  452 A  25  57  16   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2    63    0    0   1.026     34  0.71
  221  453 A   0   5   5   3   0   0   0   2   0   2   3   0   0   2  11  14   8  38   5   3    63    0    0   2.052     68  0.27
  222  454 A   0   0   0   0   2   0   0   5   6   0   6   5   2   3  14  19  11  10  13   5    63    0    0   2.350     78  0.23
  223  455 A   0   2   0   0   0   0   0  86   0   0   0   0   0   2   0   0   2   2   0   8    63    0    0   0.596     19  0.80
  224  456 A   0   3   6   0   8   0  57   6   0   0   0   0   0   6   0   2   3   0   6   2    63    0    0   1.572     52  0.36
  225  457 A   0   0   0   0   0   0   0   0   0   0   0   0   2   2  90   5   0   2   0   0    63    0    0   0.433     14  0.87
  226  458 A   0  33   3  59   0   0   0   2   0   0   0   0   0   0   2   0   0   2   0   0    63    0    0   0.986     32  0.79
  227  459 A   5   2   0   0   0   0   2   2   5  22   5   2   0   0   0   3   3  33   0  17    63    0    0   1.922     64  0.32
  228  460 A   2   2   0   3   0   0   0   0   0   5   5   0   8   0  30  25  19   2   0   0    63    0    0   1.823     60  0.30
  229  461 A   0   0   2   0   0   2   0   0   0  92   0   2   0   0   0   0   0   0   3   0    63    0    0   0.383     12  0.82
  230  462 A   7   2   2   0   0   0   0   0   5  29   2   4   0   2   4   0   4  27   0  14    56    0    0   1.979     66  0.28
  231  463 A   0   2   0   0   0   0   0  27   0   2  10   2   0   6   3   2   2  11  22  13    63    0    0   2.031     67  0.35
  232  464 A   3   2   0   0   2   0   0   0   8   0   2   0  83   0   0   0   0   0   0   0    59    0    0   0.685     22  0.72
  233  465 A   0   0   0   0   0   0   0   0   2  69  14   5   0   2   2   0   2   2   0   3    59    0    0   1.136     37  0.59
  234  466 A   0   2   0   3   0   2   2   2   7  17   2   5   0   2   0   5  12  22   5  15    60    0    0   2.318     77  0.24
  235  467 A   2   2   0   0   0   0   0   2   5   3  13   2   3   0   2  15   2  31   7  13    61    0    0   2.134     71  0.30
  236  468 A  17  48  14  10   3   0   2   0   2   0   0   0   3   0   2   0   0   0   0   0    63    0    0   1.576     52  0.58
  237  469 A   0   0   0   0   2   0  86   2   2   2   0   0   0   8   0   0   0   0   0   0    63    0    0   0.596     19  0.75
  238  470 A   3   0   3   2   0   0   0   0  13   0   5   3   0   3   8   3   8  21   3  25    63    0    0   2.206     73  0.29
  239  471 A  13  44  37   5   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    63    0    0   1.201     40  0.70
  240  472 A   0   3   2  95   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.222      7  0.97
  241  473 A   2  24   0   6   0   0   6   3   3   0   3  10   2   0  27   5   8   0   0   2    63    0    0   2.141     71  0.11
  242  474 A   0   5   0   0   0   0   0   0  11   0  21   2   2   2   8  11  17  10   5   8    63    0    0   2.232     74  0.22
  243  475 A   0   0   0   0   0   0   0   0   0   0   2   3  95   0   0   0   0   0   0   0    63    0    0   0.222      7  0.93
  244  476 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.000      0  1.00
  245  477 A   2   3   0   2   0   0   0   0   8   0  11   2   0   8  13  24  14   2  10   3    63    0    0   2.234     74  0.24
  246  478 A   2  10   2   0   5  13   0   0  18   3   3   3   0   2   0  11   5  15   2   7    61    0    0   2.415     80  0.06
  247  479 A   8   3   0   2   0   0   0   0   0   0   8   2   2   0   3   2   2  20  15  34    61    0    0   1.940     64  0.34
  248  480 A   0   2   0   0   0   0   0   0   7  80   3   0   0   2   2   2   0   3   0   0    61    0    0   0.848     28  0.70
  249  481 A   3   3   2   2   0   2   0   0  11   0  13   3   0   2   3  13   2  25   2  15    61    0    0   2.261     75  0.23
  250  482 A   2   2   0   2   0   0   0   3   8   0   0   5   0   0   8  11  10  15   7  28    61    0    0   2.166     72  0.31
  251  483 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0    61    0    0   0.000      0  1.00
  252  484 A   0   0   2   0   0   0   2   0   0  93   0   3   0   0   0   0   0   0   0   0    61    0    0   0.310     10  0.86
  253  485 A   0   0   0   0   0   0   0   0   7   2  35  33   0   2   2   5   0   7   2   7    60    0    0   1.698     56  0.35
  254  486 A   0   0   0   0  90   0   0   0   2   8   0   0   0   0   0   0   0   0   0   0    60    0    0   0.370     12  0.71
  255  487 A   0   2   2   0   0   0   0   5  18   5   8  15   0   2   7   2   3  25   0   7    60    0    0   2.196     73  0.26
  256  488 A   3   0   2   0   2   0  12   3   3   0   7  12   2   3   0   3  12  23   0  13    60    0    0   2.312     77  0.17
  257  489 A   7  65  23   2   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0   0    60    0    0   0.982     32  0.73
  258  490 A  17  10   2   0   0   0   5   0   3   0   2   5   0  10  19   5  14   5   2   0    58    0    0   2.300     76  0.11
  259  491 A   2   2   0   4   0   5   0   0   4   0  18   4   4   2   0  12  18  21   2   5    57    0    0   2.260     75  0.19
  260  492 A   9   2   0   4  11   0   2   0  11   0   7   4   2   0  18  16   5   7   2   4    57    0    0   2.448     81  0.08
  261  493 A   2  74   7   0  14   0   2   0   0   0   0   0   0   2   0   0   0   0   0   0    57    0    0   0.900     30  0.81
  262  494 A   0   0   0   0   0   0   0   8   8   0   8   8   0   0   0   0   4  46   4  15    52    0    0   1.685     56  0.47
  263  495 A   0   2   0   0   0   0   0   0  10   2   8  14   4   0   6   6   2  10   4  31    49    0    0   2.152     71  0.25
  264  496 A   7  13  11  15  20   0   9   0   2   2   0   7   0   0   0   0  11   2   2   0    46    0    0   2.255     75  0.22
  265  497 A   3  43   5   3  38   0   8   0   0   0   0   0   0   0   0   0   0   0   0   0    37    0    0   1.287     42  0.74
  266  498 A   0   0   0   0   0   0   0   0   4   4   0  15   0  15  11   0  11  22   4  15    27    0    0   2.037     68  0.29
  267  499 A   0   0   0   0   0   0   0   4  17   0  21   4   0   0   0   0   0   8   8  38    24    0    0   1.672     55  0.39
  268  500 A   0   0   0   0   0   0   0   6  25   0  44  25   0   0   0   0   0   0   0   0    16    0    0   1.228     40  0.42
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     7    56    56     2 gKGr
     8   206   206     1 dLm
    12   187   187     2 nHYf
    13    99   209     1 rGa
    13   153   264     1 rVf
    13   157   269     3 dNEDn
    19    69   117     1 iVe
    21    25    47     3 gRLRv
    21    44    69     2 tEKq
    21   155   182     4 eSSSDp
    22    23    32     5 gEVLKAe
    22    47    61     2 pREe
    22    63    79     1 pLh
    22   101   118     9 sYGNGRQWTAa
    22   159   185     1 nCr
    25    28    77     5 aEAFGLh
    25    47   101     2 tEQe
    25    63   119     1 gKh
    25   100   157     2 rPVk
    25   101   160     9 kDYDDVMEPAe
    25   156   224     4 dVHNVd
    26    12    32     3 gELNl
    26    31    54     2 tTPd
    26    58    83     1 cMr
    26   140   166     2 pEKe
    27   221   221     1 kLc
    28    25    58     5 aNASKLp
    28    44    82     3 kRKPe
    28    60   101     1 gKh
    28    97   139     6 sGPNDSSr
    28    98   146     6 rEHSALEy
    29    27    34     4 aEAVGi
    29    46    57     2 tDSe
    29    62    75     1 gEh
    29    73    87     2 cTKg
    29    99   115     6 rDVFEATw
    29   100   122     8 wSPPTEKPDe
    29   154   184     1 rDi
    30    19    19     5 aEAEDIc
    30    38    43     2 aAKe
    30    54    61     1 gPh
    30    91    99     2 rTHq
    30    92   102     9 qTYYNYSTDSe
    30   150   169     1 dSa
    31    19    19     5 aTVENLs
    31    38    43     2 gLDe
    31    54    61     1 gRh
    31    91    99     6 rTVYHQSk
    31    92   106     5 kAFPTSr
    32    12    13     5 gSVREAq
    32    34    40     3 iASSd
    32    61    70     6 sLRSRAKg
    32   145   160     1 sGd
    32   216   232    18 pPECMEDVLTLPLHPSQGLp
    32   218   252     1 rPs
    33    19    38     6 gAAKNILs
    33    38    63     2 tDQe
    33    91   118     4 rPTTMq
    33    92   123     1 qPp
    33   128   160     3 nCLVs
    33   147   182     4 dIYKNd
    34    21    29     5 gQVYLGe
    34    26    39     8 gIDYRRPSAi
    34    45    66     2 tESe
    34    61    84     1 gSh
    34    72    96     2 cTKg
    34    98   124     6 rDIYDPAw
    34    99   131     8 wCAPSEDHDv
    34   154   194     4 dVYKNe
    35    13    19     2 aQLr
    35    32    40     1 sQs
    35    48    57     1 hQe
    35    51    61     7 nGGLGESNi
    35    86   103     2 nVDq
    35   140   159     1 rDv
    35   144   164     4 tTQYVr
    35   193   217     1 pCy
    35   196   221     3 gRIQl
    36    27    27     2 aKLr
    36    46    48     1 sQs
    36    65    68     7 nSNVRASNi
    36    99   109     1 kNr
    36   100   111     1 rDg
    36   154   166     1 rDv
    36   158   171     4 sTQYVk
    36   207   224     1 pCf
    36   210   228     3 dKVHv
    37    23    44     4 gVVHKg
    37    28    53     8 gQDSIDNGEg
    37    47    80     3 ySKNk
    37    63    99     1 gSh
    37   100   137     3 rEPNk
    37   101   141     6 kRNIDPVy
    37   156   202     4 dVYRYg
    37   180   230     2 gEVp
    38    26    26     2 gEVr
    38    45    47     2 sDSd
    38    61    65     1 gWh
    38    98   103     6 sAELTSDs
    38    99   110     9 sEYENQPVPLs
    38   154   174     4 dIYESs
    39    26    32     7 aSFRRVVDg
    39    45    58     2 gEGe
    39    61    76     1 rQh
    39    99   115    11 kVYMSNMLRDSMy
    39   154   181     4 dIYERg
    39   178   209     1 eGr
    40    15    73     2 nDKk
    40    23    83     5 gAVYLGk
    40    27    92     6 gKSLAHKd
    40    28    99     8 dANSPLGINl
    40    47   126     2 dEMs
    40    63   144     1 gYh
    40    99   181    14 rCKYMMKLDDLGINYh
    40   100   196     3 hDPPe
    40   101   200     7 eNENYDTNm
    40   155   261     1 rYi
    41    27    30     6 gRVHGLGt
    41    46    55     2 sDRe
    41    62    73     1 kPh
    41    99   111     1 eIk
    41   100   113     2 kPKt
    41   155   170     4 dVSNEd
    41   179   198     1 gGe
    41   226   246     2 pTHv
    42    15   122     2 dDQk
    42    23   132     5 gSVYKGr
    42    27   141     6 gIAKGNKn
    42    28   148     8 nAQSTLGINl
    42    47   175     2 dQLs
    42    63   193     1 gYh
    42    99   230    12 rCAYMIKLTEMGId
    42   100   243     4 dYDEPn
    42   101   248     8 nLNEKIDQDl
    42   155   310     1 rYi
    43    28    42     2 gRLr
    43    47    63     1 rRc
    43    63    80     1 hEn
    43    66    84     8 eEENTGYPNi
    43   155   181     1 hDv
    43   159   186     4 eTTYVs
    43   208   239     1 pSy
    43   211   243     3 rQRQl
    44    27    39     2 aTLt
    44    46    60     2 cEDd
    44    62    78     1 gAh
    44    73    90     1 cTv
    44    99   117     3 rEEDn
    44   100   121     8 nSDEPRDEIy
    44   155   184     4 dIYNRg
    44   179   212     1 gEv
    45    44    48     3 fSGDa
    45    97   104     4 hNQLDr
    45   117   128     2 sCKp
    45   220   233     1 iPp
    46    21    21     5 gILVDEk
    46    40    45     2 sEVq
    46    67    74     1 cIe
    46    93   101     5 kLVEANn
    46    94   107     1 nPq
    46   149   163     4 dLFPMd
    47    20    20     5 gVVKKAk
    47    25    30     4 pEEEKg
    47    44    53     2 tESe
    47    60    71     1 gDh
    47    97   109     6 rSVVEYEn
    47    98   116    17 nTENKIHSYENVTEKTQGa
    47   153   188     4 dVYESg
    47   225   264     1 sCc
    48    20    20     5 gVVKKAk
    48    25    30     4 pEEEKg
    48    44    53     2 tESe
    48    60    71     1 gDh
    48    97   109     6 rSVAEYEn
    48    98   116    17 nTENKIHSYENVTEKTQGa
    48   153   188     4 dVYESg
    48   225   264     1 sCc
    49    26    26     3 gQLSn
    49    45    48     1 aQa
    49    61    65     1 qEg
    49    64    69     7 eNPVRCSNi
    49    98   110     4 rNGDAr
    49   148   164     1 rDi
    49   152   169     4 dSVYMh
    49   201   222     1 pVy
    49   204   226     3 gPLRp
    50    26   350     4 mADAVg
    50    27   355     3 gIDKe
    50    46   377     2 tDKd
    50    62   395     1 gKh
    50    99   433     2 rPPg
    50   100   436    12 gMDYSFDTCKIPDe
    50   154   502     1 rDv
    50   157   506    42 nIDYYKKTTNVSSPEGDESSRVHRDSLNALCLQPLSEQSVLCFp
    50   158   549     6 pFGTLPLi
    51    23    40     5 gQVLRAe
    51    28    50     8 mSAFKPRDKa
    51    40    70     1 rRs
    51    47    78     3 aDESd
    51    63    97     1 gEh
    51   100   135     6 rEVFEPTw
    51   101   142     8 wTKTNPDPEa
    51   156   205     4 dIYQDd
    52    19    26     4 aKAKGl
    52    38    49     2 dKAv
    52    91   104     3 tNEId
    52    92   108     6 dLGQPGVp
    52   148   170     3 dFMRd
    52   219   244     6 nAVLLNQp
    52   221   252     1 sFa
    53    15    15     3 aTLAh
    53    34    37     2 dISa
    53    53    58     1 dNv
    53    87    93     3 rAESk
    53    88    97     5 kLNRTVl
    53   164   178     1 eAl
    53   192   207     1 gMe
    53   212   228     1 qLc
    54    28    42     2 aNLd
    54    47    63     1 kLc
    54    66    83     8 kGYNPRKSNi
    54   152   177     1 rDv
    54   156   182     4 tAQYIp
    54   205   235     1 pMy
    54   208   239     3 nTPQp
    55    28    42     2 aNLv
    55    47    63     1 kLc
    55    66    83     8 kGYNPRKYNi
    55   152   177     1 rDv
    55   156   182     4 tAQYIp
    55   205   235     1 pMy
    55   208   239     3 nTPQp
    56    49    49     1 dDh
    56    60    61     6 fVEVKDEg
    56    86    93     6 rGLVDNGk
    56    87   100     5 kSQLPKi
    56   221   239     1 kMi
    57    26    44     4 kAEAVg
    57    27    49     2 gVKd
    57    46    70     2 nAAa
    57    62    88     1 gAh
    57    73   100     2 cTKt
    57    98   127    41 hRNNFVNQVDKLGNLLIDAAIQEINTAAGMNRFYEYEPPVSFg
    57    99   169     3 gVCQk
    57   100   173     8 kDPDSNFYGm
    57   154   235     1 rKm
    57   230   312     1 dFa
    58    13    19     3 aRWQq
    58    32    41     2 qTGr
    58    48    59     1 gRh
    58    59    71     2 sIEp
    58    85    99     1 aEk
    58    86   101     1 kEe
    58   122   138     7 nVLVFSLDp
    58   140   163     1 iMa
    58   144   168     6 gYGESRAa
    58   196   226     1 aIt
    59    27   441     2 eATa
    59    28   444     3 aINLr
    59    47   466     2 kADe
    59    63   484     1 gTh
    59    99   521    58 vRQEASKLRKRNANYTSCRPITNRTNSTSSPKSQSVNYIELKASSQTIDMPQEDSSGHIn
    59   100   580     6 nGIRQPHp
    59   101   587    17 pSFAETTYTIVEDEDAFEy
    59   228   731     1 eIc
    60    26   613     4 nATAYg
    60    27   618     1 gIs
    60    46   638     2 dSSe
    60    62   656     1 gSh
    60    98   693    58 kREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSRDVQIHPHSDPISGLHGNSFHSEDe
    60    99   752     6 eIEYENQk
    60   100   759     8 kRLEEEEDLn
    60   154   821     1 rDi
    60   158   826     5 dSNYVVr
    60   210   883     1 gIp
    60   229   903     4 pFYATe
    61    26   627     4 nATAYg
    61    27   632     1 gIs
    61    46   652     2 dSSe
    61    62   670     1 gSh
    61    98   707    58 kREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDe
    61    99   766     6 eIEYENQk
    61   100   773     8 kRLEEEEDLn
    61   154   835     1 rDi
    61   158   840     3 dSNYv
    61   210   895     1 gIp
    61   229   915     4 pFYATe
    62    28    34     5 gTAYGLs
    62    47    58     2 rSSe
    62    65    78     2 hLNi
    62    73    88     1 cTk
    62    98   114    43 nRESFLNPKPEKSNKKELDIFGINPADESSRRIEVSSGIFRRHAa
    62    99   158     6 aSPGLSVc
    62   100   165    17 cLSKPDGEMDQLLSDNMSe
    62   154   236     1 rDi
    62   210   293     1 gMi
//