Complet list of 2brg hssp fileClick here to see the 3D structure Complete list of 2brg.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      2BRG
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-09-08
HEADER     DRUG DESIGN, FURANOPYRIMIDINE, MOLECULA 2005-05-12 2BRG
COMPND     SERINE/THREONINE-PROTEIN KINASE CHK1
SOURCE     HOMO SAPIENS
AUTHOR     Foloppe, N.; Fisher, L.M.; Howes, R.; Kierstan, P.; Potter, A.; Robert
SEQLENGTH   257
NCHAIN        1 chain(s) in 2BRG data set
NALIGN       70
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : CHK1_RAT            0.96  0.97    1  258    7  269  263    1    6  476  Q91ZN7     Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1
    2 : G3UYB1_MOUSE        0.95  0.96    1  258    7  269  263    1    6  432  G3UYB1     Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=2 SV=1
    3 : L5KGZ5_PTEAL        0.95  0.96    1  258    7  269  263    1    6  476  L5KGZ5     Serine/threonine-protein kinase Chk1 OS=Pteropus alecto GN=PAL_GLEAN10007646 PE=4 SV=1
    4 : F6UDX2_MONDO        0.92  0.95    1  258    7  269  263    1    6  476  F6UDX2     Uncharacterized protein OS=Monodelphis domestica GN=CHEK1 PE=4 SV=1
    5 : F6UR87_ORNAN        0.92  0.95    1  258    7  269  263    1    6  476  F6UR87     Uncharacterized protein OS=Ornithorhynchus anatinus GN=CHEK1 PE=4 SV=1
    6 : G3WYR6_SARHA        0.91  0.95    1  258    7  269  263    1    6  476  G3WYR6     Uncharacterized protein OS=Sarcophilus harrisii GN=CHEK1 PE=4 SV=1
    7 : K7GCA8_PELSI        0.89  0.94   17  258    1  247  247    1    6  454  K7GCA8     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis GN=CHEK1 PE=4 SV=1
    8 : A1E253_STRPU        0.68  0.87    1  254    7  265  259    1    6  468  A1E253     Checkpoint kinase 1 OS=Strongylocentrotus purpuratus PE=2 SV=1
    9 : G3QBM7_GASAC        0.68  0.89    1  257    7  268  262    1    6  474  G3QBM7     Uncharacterized protein OS=Gasterosteus aculeatus GN=CHEK1 PE=4 SV=1
   10 : E9FYX6_DAPPU        0.59  0.80    1  258   19  280  264    4    9  489  E9FYX6     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_43327 PE=4 SV=1
   11 : B3MKM1_DROAN        0.57  0.82    1  253   30  288  261    6   11  519  B3MKM1     GF14005 OS=Drosophila ananassae GN=Dana\GF14005 PE=4 SV=1
   12 : B4LVK4_DROVI        0.57  0.81    1  253   16  274  261    6   11  509  B4LVK4     GJ22747 OS=Drosophila virilis GN=Dvir\GJ22747 PE=4 SV=1
   13 : I1FK21_AMPQE        0.53  0.69    1  256   20  299  280    3   25  453  I1FK21     Uncharacterized protein OS=Amphimedon queenslandica PE=4 SV=1
   14 : J9K6R9_ACYPI        0.52  0.75    1  257    7  269  264    4    9  451  J9K6R9     Uncharacterized protein OS=Acyrthosiphon pisum PE=4 SV=1
   15 : A9PJA4_9ROSI        0.40  0.67    3  201   18  223  206    1    8  286  A9PJA4     Putative uncharacterized protein OS=Populus trichocarpa x Populus deltoides PE=2 SV=1
   16 : G7K7R1_MEDTR        0.39  0.64    3  256   13  270  262    3   13  338  G7K7R1     CBL-interacting protein kinase OS=Medicago truncatula GN=MTR_5g088350 PE=4 SV=1
   17 : O94194_PICAN        0.38  0.64    7  223   21  249  230    5   15  249  O94194     Checkpoint protein kinase Chk1 (Fragment) OS=Pichia angusta GN=Chk1 PE=3 SV=2
   18 : G0NWI4_CAEBE        0.37  0.56    9  258   12  268  259    5   12  299  G0NWI4     Putative uncharacterized protein OS=Caenorhabditis brenneri GN=CAEBREN_07770 PE=4 SV=1
   19 : D2VGP7_NAEGR        0.36  0.62    1  258    7  265  265    4   14  336  D2VGP7     Predicted protein (Fragment) OS=Naegleria gruberi GN=NAEGRDRAFT_33859 PE=4 SV=1
   20 : E3WPS2_ANODA        0.36  0.60    1  255   51  305  261    4   13  342  E3WPS2     Uncharacterized protein OS=Anopheles darlingi GN=AND_03938 PE=4 SV=1
   21 : F5C0G2_SOLCH        0.36  0.57    1  258    3  265  267    5   14  339  F5C0G2     Serine/threonine protein kinase OS=Solanum chacoense GN=SnRK2 PE=2 SV=1
   22 : G0UYB1_TRYCI        0.36  0.60    4  254   11  260  257    4   14  273  G0UYB1     Putative serine/threonine kinase OS=Trypanosoma congolense (strain IL3000) GN=TCIL3000_10_11590 PE=4 SV=1
   23 : M5FS73_DACSP        0.36  0.58    1  258   34  302  270    5   14  307  M5FS73     Pkinase-domain-containing protein OS=Dacryopinax sp. (strain DJM 731) GN=DACRYDRAFT_89774 PE=4 SV=1
   24 : B3RGD9_ARTSF        0.35  0.60    1  258   12  270  266    5   16  313  B3RGD9     Protein kinase AMPK alpha subunit 2 OS=Artemia franciscana GN=AMPKalpha2 PE=2 SV=1
   25 : C6TDG2_SOYBN        0.35  0.56    1  258    3  265  267    5   14  336  C6TDG2     Putative uncharacterized protein OS=Glycine max PE=2 SV=1
   26 : F4ZC51_HORVD        0.35  0.55    8  258    1  256  260    5   14  334  F4ZC51     Snf-related protein kinase 2.6 (Fragment) OS=Hordeum vulgare var. distichum GN=SnRK2.6 PE=2 SV=1
   27 : I1I692_BRADI        0.35  0.55    1  258    3  265  267    5   14  342  I1I692     Uncharacterized protein OS=Brachypodium distachyon GN=BRADI3G33690 PE=4 SV=1
   28 : M2MPP6_9PEZI        0.35  0.52    1  203   28  269  242    4   40  294  M2MPP6     Uncharacterized protein (Fragment) OS=Baudoinia compniacensis UAMH 10762 GN=BAUCODRAFT_49472 PE=4 SV=1
   29 : Q9ZNW3_TOBAC        0.35  0.57    1  258    3  265  267    5   14  339  Q9ZNW3     PK11-C1 OS=Nicotiana tabacum GN=PK11-C1 PE=2 SV=1
   30 : A8XAS4_CAEBR        0.34  0.57    1  250   29  284  258    8   11  295  A8XAS4     Protein CBG10240 OS=Caenorhabditis briggsae GN=CBG10240 PE=3 SV=1
   31 : C4IZW2_MAIZE        0.34  0.55    1  258    3  269  271    5   18  337  C4IZW2     Uncharacterized protein OS=Zea mays PE=2 SV=1
   32 : D2VBQ8_NAEGR        0.34  0.59    1  256    2  263  264    3   11  269  D2VBQ8     Predicted protein (Fragment) OS=Naegleria gruberi GN=NAEGRDRAFT_3132 PE=4 SV=1
   33 : E9ARK2_LEIMU        0.34  0.58    1  255    8  261  261    4   14  271  E9ARK2     Putative serine/threonine kinase-like protein OS=Leishmania mexicana (strain MHOM/GT/2001/U1103) GN=LMXM_18_0640 PE=4 SV=1
   34 : F1LUA8_RAT          0.34  0.58    2  252   19  265  256    6   15  298  F1LUA8     Protein RGD1564651 OS=Rattus norvegicus GN=RGD1564651 PE=4 SV=2
   35 : G0UYB0_TRYCI        0.34  0.58    1  255    7  262  261    4   12  274  G0UYB0     Putative uncharacterized protein OS=Trypanosoma congolense (strain IL3000) GN=TCIL3000_10_11580 PE=4 SV=1
   36 : K4ACC4_SETIT        0.34  0.56    1  258    3  265  267    5   14  333  K4ACC4     Uncharacterized protein OS=Setaria italica GN=Si036531m.g PE=4 SV=1
   37 : M4CYQ7_BRARP        0.34  0.54    1  258    2  270  273    6   20  370  M4CYQ7     Uncharacterized protein OS=Brassica rapa subsp. pekinensis GN=Bra009354 PE=4 SV=1
   38 : Q86S44_CAEEL        0.34  0.60    1  254   16  280  269    9   20  324  Q86S44     Protein R02C2.6 OS=Caenorhabditis elegans GN=CELE_R02C2.6 PE=4 SV=1
   39 : A8WM70_CAEBR        0.33  0.57    1  256   10  265  261    5   11  296  A8WM70     Protein CBG00041 OS=Caenorhabditis briggsae GN=CBG00041 PE=3 SV=1
   40 : I1GSA7_BRADI        0.33  0.54    1  258    2  277  280    6   27  354  I1GSA7     Uncharacterized protein OS=Brachypodium distachyon GN=BRADI1G21310 PE=4 SV=1
   41 : M7Z8Y7_TRIUA        0.33  0.51    1  258   21  296  280    6   27  374  M7Z8Y7     Serine/threonine-protein kinase SAPK10 OS=Triticum urartu GN=TRIUR3_14892 PE=4 SV=1
   42 : Q4E5I0_TRYCC        0.33  0.58    1  255    8  261  261    4   14  278  Q4E5I0     Serine/threonine protein kinase, putative OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511277.140 PE=4 SV=1
   43 : B9H709_POPTR        0.32  0.55    1  258    2  269  272    7   19  343  B9H709     Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_716471 PE=4 SV=1
   44 : D6WSN9_TRICA        0.32  0.54    1  255   35  295  264    4   13  327  D6WSN9     Putative uncharacterized protein OS=Tribolium castaneum GN=TcasGA2_TC010125 PE=4 SV=1
   45 : F4NRC2_BATDJ        0.32  0.57   12  256   17  279  263    9   19  302  F4NRC2     Putative uncharacterized protein OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_18153 PE=3 SV=1
   46 : F7EN76_RAT          0.32  0.57    1  257   12  265  260    5   10  277  F7EN76     Protein RGD1566251 OS=Rattus norvegicus GN=LOC300308 PE=4 SV=1
   47 : F8W3F0_DANRE        0.32  0.57    3  254   34  285  260    4   17  285  F8W3F0     Uncharacterized protein OS=Danio rerio GN=si:ch211-117c9.1 PE=4 SV=1
   48 : G0U4A0_TRYVY        0.32  0.57    1  255    8  261  261    4   14  273  G0U4A0     Putative uncharacterized protein OS=Trypanosoma vivax (strain Y486) GN=TVY486_1013060 PE=4 SV=1
   49 : G3NKP8_GASAC        0.32  0.54   15  253   23  266  248    5   14  266  G3NKP8     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=CAMK1D (1 of 2) PE=4 SV=1
   50 : M1CH83_SOLTU        0.32  0.54    1  241    3  248  247    3    8  253  M1CH83     Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400026211 PE=4 SV=1
   51 : Q3SDY2_PARTE        0.32  0.52    2  256   15  272  267    7   22  323  Q3SDY2     CAMP-dependent protein kinase, catalytic subunit 2-3 OS=Paramecium tetraurelia GN=PKAc2-3 PE=4 SV=1
   52 : Q3SDY3_PARTE        0.32  0.52    2  256   15  272  267    7   22  323  Q3SDY3     CAMP-dependent protein kinase, catalytic subunit 2-4 OS=Paramecium tetraurelia GN=PKAc2-4 PE=4 SV=1
   53 : B7G6F9_PHATC        0.31  0.53    1  253    3  272  275    7   28  273  B7G6F9     Predicted protein (Fragment) OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_14702 PE=4 SV=1
   54 : E4Y0E4_OIKDI        0.31  0.56    1  253   23  281  264    8   17  281  E4Y0E4     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_474 OS=Oikopleura dioica GN=GSOID_T00012261001 PE=4 SV=1
   55 : F1A0D6_DICPU        0.31  0.57    3  257    2  262  266    7   17  290  F1A0D6     Myosin light chain kinase (Fragment) OS=Dictyostelium purpureum GN=DICPUDRAFT_157928 PE=4 SV=1
   56 : G0KVQ2_PINFU        0.31  0.54    2  255   23  281  265    8   18  335  G0KVQ2     Calcium/calmodulin-dependent protein kinase I OS=Pinctada fucata PE=2 SV=1
   57 : H2TJC9_TAKRU        0.31  0.53    9  253   21  272  257    9   18  278  H2TJC9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066536 PE=4 SV=1
   58 : M3D857_9PEZI        0.31  0.50    1  256  220  524  305    6   50 1094  M3D857     Pkinase-domain-containing protein OS=Mycosphaerella populorum SO2202 GN=SEPMUDRAFT_147895 PE=4 SV=1
   59 : Q3SDY0_PARTE        0.31  0.52    2  256   15  272  267    7   22  323  Q3SDY0     CAMP-dependent protein kinase, catalytic subunit 2-1 OS=Paramecium tetraurelia GN=PKAc2-1 PE=4 SV=1
   60 : D7U7L2_VITVI        0.30  0.54    1  256   16  271  263    4   15  281  D7U7L2     Putative uncharacterized protein OS=Vitis vinifera GN=VIT_15s0048g01730 PE=4 SV=1
   61 : E1Z5D3_CHLVA        0.30  0.50    1  246    4  245  255    5   23  292  E1Z5D3     Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_138144 PE=3 SV=1
   62 : F4NWT6_BATDJ        0.30  0.57    1  255    2  255  263    8   18  265  F4NWT6     Putative uncharacterized protein (Fragment) OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_5119 PE=4 SV=1
   63 : G3SYJ9_LOXAF        0.30  0.56    1  257    8  267  266    8   16  267  G3SYJ9     Uncharacterized protein OS=Loxodonta africana GN=LOC100667703 PE=4 SV=1
   64 : H0W2E5_CAVPO        0.30  0.53    1  254   12  263  263    8   21  278  H0W2E5     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
   65 : H0WDM8_CAVPO        0.30  0.53    1  254   12  263  263    8   21  278  H0WDM8     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
   66 : H2KQ11_CLOSI        0.30  0.50    1  254   23  296  279    9   31  359  H2KQ11     Calcium/calmodulin-dependent protein kinase I OS=Clonorchis sinensis GN=CLF_103015 PE=4 SV=1
   67 : H2TJD0_TAKRU        0.30  0.53   10  253   27  277  256    9   18  283  H2TJD0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101066536 PE=4 SV=1
   68 : IPL1_ENCCU          0.30  0.55    1  256    8  265  265    6   17  272  Q8SRL5     Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1
   69 : K3YSX4_SETIT        0.30  0.47    1  258    2  310  313    8   60  410  K3YSX4     Uncharacterized protein OS=Setaria italica GN=Si017369m.g PE=4 SV=1
   70 : R0LJW3_ANAPL        0.30  0.57    1  257   10  270  266    7   15  270  R0LJW3     Testis-specific serine/threonine-protein kinase 3 (Fragment) OS=Anas platyrhynchos GN=Anapl_08980 PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    7 A E              0   0  163   53   47  EEEEEE DQEEEEE    GGE GGE EGENEGG DEDDSEDGDH S G E  QN   G DGGNEED DEN
     2    8 A D        -     0   0   93   58   68  DDDDDD GDGGGGG    NKK PHR RDKKRQQNQRKSERRERG Q E KDDDN K DDDPNGDDR RRG
     3    9 A W        -     0   0   51   62   10  WWWWWW WWWWWWWYY  YYY YYY YYYFYYYYYYYYYYYYYY YFY YYYYYFY YYFYYYYYY FYY
     4   10 A D  E     -A   21   0A  69   63   62  DDDDDD DDDTTENEE  RKEQLVE EIEEEQTKVEEEQEEFEI RET EEEDKED IEEETQDDK EEQ
     5   11 A L  E     +A   20   0A  83   63   38  LLLLLL FLMLLFILV  LLLLLLP ALLPALLMLAVFIVLLIL VVL LVVIIFF LVILLLMMI ILL
     6   12 A V  E     -     0   0A  89   63   78  VVVVVV VVIAAMVGG  GLLGLGL LGLILYGLGLVIRIVGMG VLG LFFRSKR GFGISGLLI GLG
     7   13 A Q  E     -A   19   0A 103   64   64  QQQQQQ QQQQQQQRRK KKKNQEK KSKRKQKNQKKESKKKKK FEK KQQDHEK QQKRQKFLS RKK
     8   14 A T  E     -A   18   0A  58   65   65  TTTTTT TTTTTTTTTT TTEKTTEDETEKETQTKEDNSDDKNT FTK ETTVVET TTPDTTPPR LDT
     9   15 A L  E     -     0   0A  68   67   18  LLLLLL LLLLLLLLIILLILILLLILLLLLLILLLLLLLIIII LLL LLLLLLLLILLIIILFL LII
    10   16 A G  E     -A   17   0A  29   68    1  GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGG GGGGGGGGGGGGGGGSGGGGG
    11   17 A E  E     +A   16   0A 157   68   70  EEEEEE EEEEEEEEEHEEKHSEVASAETKAKSKAATEKSSSSS QRS ATTSTRTQETRSQEAEDQRSE
    12   18 A G        -     0   0   47   69    0  GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGG
    13   19 A A  S    S+     0   0   95   68   67  AAAAAA AAAAAATTTGSSNNNETNNNENTNNNNSNNSANNNNSASTN NSSTAAAAESKNC.HNGAKNT
    14   20 A Y  S    S-     0   0   96   69   16  YYYYYY YYFYYYFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFYNYYF FFFVFFFTFFFFFYFFFTFFY
    15   21 A G  E     - B   0  34A  25   70   32  GGGGGG GGGGGGGAAGGGAGSGGGGGGGGGSSSSGGAGGGSGAAGGSSGGGGSSSSGGGGGSAACSGGS
    16   22 A E  E     -AB  11  33A  59   70   79  EEEEEE EEEEEEEKKVKKKVTKKVVVKVEVKKVTVVEEVVTVTTRKVEVRRQEVEVKRRVKKKTEVQVK
    17   23 A V  E     -AB  10  32A  43   71   29  VVVVVVVVVVVVVVVVVVVVAVVVAAAVAVAVVVVAAVVAAVTVVVVVVAVVVVVVVVVVAVVVVVVVAV
    18   24 A Q  E     -AB   8  31A  37   71   68  QQQQQQQKRKKKKKKKKFKKRRKKRRRKRWRKRKRRRVSKRRKRRRKHVRKKLKYVYKKYKKKVVFYWRK
    19   25 A L  E     -AB   7  30A  14   71   39  LLLLLLLLLLLLLLFFSLLLLLLILLLMLLLYLRLLLLMLLQLMLLRLMLLLRLLLRMLLLIELLKRLLE
    20   26 A A  E     -AB   5  29A   1   71   61  AAAAAAAALLLLALAAAVAAVAGGAMVGVVVGGAAVLVIVMCVALAAAAVAAAAGACGAACGATTACAMA
    21   27 A V  E     -AB   4  28A  23   71   88  VVVVVVVVVVIIVMRRVEEKKTLEKRRWKRRQTFTRRARRRTRHTWVTRKRRIEVEEWRRRYFEEKERRL
    22   28 A N        -     0   0    6   71   58  NNNNNNNNNNNNHNNNFNHHDDHHDNDKDQDDDHDDHKTDNDDSHHEDEDNNHHNDEKNEAHSHHDEENS
    23   29 A R  S    S+     0   0  161   71   68  RRRRRRRRRARRKQVSETEVKAEQKRKKKKKMPVAKKVRVRARERRRPKKKKRKRKKKKIKKKVVLKRKL
    24   30 A V  S    S+     0   0  110   71   77  IIRRRRRSQKQQENEEKTSPKQELKARDKARNQPQQDGTRAKCRKRQEAKQQQEQAEDQKDLKSCQEEEK
    25   31 A T  S    S-     0   0   90   71   53  TTTTTTTTTTTTSNTTndTTTgWTTDTSTsTDgTgTTtSTDgTHdTYgTTTTTTTeTSTSSTHTTTTKTH
    26   32 A E        +     0   0  147   70   79  EEEEEEEQEGGGKHGGssGNKwGKGGKTKnKGwCwKKn.KGwKNvQGwGKNNGKKgQTNKGGQGGGQGKQ
    27   33 A E        -     0   0  128   71   76  EEEEEEEEEEEEECEEKRHKEAEHEQEVEYETATAEEKREQAEMAAKAKEKKHKQHKVKYEQRMMRKFEK
    28   34 A A  E     +B   21   0A  43   71   85  AAAAAAAAAAAACFNAVKKELVEKLLLQLLLTITVLLMFLLVFNNLTAMLYYELKLAQYVLQKLLFAILK
    29   35 A V  E     -B   20   0A   6   71   51  VVVVVVVVVVVVVVVVIMVVLKVVVVSVFCVWKVKVVFCFVKFVKVVKVLVVRAYVFVVVVVVVVVFVVV
    30   36 A A  E     -BC  19  73A  13   71   16  AAAAAAAAAAAAAAAAAAAAAIAAAAAAAAAAIAVAAAAAAIAALAAIAAAAAAAAAAAAAAAAAAAAAA
    31   37 A V  E     -BC  18  72A   2   71   30  VVVVVVVVVMMMVMILVMVIVIVVVVVIVIVIVVIVMMMVVIVVYIIIIVLLVIIILILLVVIVVILLMI
    32   38 A K  E     -BC  17  71A  16   71   13  KKKKKKKKKKKKKKKKKKKKKDKKKKKKKKKKDKDKKKKKKDKKAKKDKKKKKKKKKKKKKKKKKKKKKK
    33   39 A I  E     -BC  16  70A  24   71   77  IIIIIIIIVVMMITIIFKIIYKLIYYYLYYYIKIKYYEEFYKFIITSKCYSSICVCVLSVFIIVVRVIYI
    34   40 A V  E     -BC  15  69A  14   71   41  VVVVVVVLIIVVMILLVMLIITMLIIIIIVIIRLTIIIFIIGFVKVIAIILLIIIILILIIVILLVLIII
    35   41 A D  E     - C   0  68A  79   71   68  DDDDDDDHDDDDHDDDHLNDERRNEEQREPEDRQREESSEERESEERRPEKKKPNDKRKFEDDQQDKPPD
    36   42 A M              0   0  123   71   73  MMMMMMMLTLLLLLKKLFRKRLRRRRRKRGRRLNLRRIKRRLRKFIKLKRKKIRKRKkKKRKKKKrKIrK
    37   43 A K              0   0   95   71   78  KKKKKKKDSKKKDQEEDKQTGRGQGGGEGSGKKNGGGVEGGRGFRSERKGAAKRSKTgAAGIMEEqTKlK
    38      ! !              0   0    0    0    0  
    39   50 A E              0   0  172   71   69  rrrrrrrkqkkkgnkkmekqkknkkenakrkmkkkkrgkheqeskkrkakeesvegvneqehgkkkveke
    40   51 A N     >  +     0   0   74   71   80  nnnnnnnsntssctqqmskknqkknnnknhnqqvqnnsmnnqhfythqsnqqalnsgkqqnafaakgqnf
    41   52 A I  H  > S+     0   0   11   71   37  IIIIIIIVVVVVLVIILEILVMVIVVVIVTVLMTLVVIAVVMVLIIIMIVVVSILLIIVLVLIIIIIIVI
    42   53 A K  H  > S+     0   0  150   71   81  KKKKKKKRKKRRKKKKACRYQLERQQQYQNQRLSFQAKKQQLQPKRQLEQDDSNKDDYDKEVQIIKDRAQ
    43   54 A K  H  > S+     0   0   86   71   40  KKKKKKKKKKKKKKRRRRRRRRRRRRRRRRRRRRRRRRNRRRRRKGRRNRHHANMNRRHRRRRRRKRRRK
    44   55 A E  H  X S+     0   0    3   71   36  EEEEEEEEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEVIEEEEVVTEEEKEVEEEFEELKEEF
    45   56 A I  H  X S+     0   0   11   71   32  IIIIIIIVVVVVLAIIAHIVIVIIIIIIIIIIVAVIICFIIVIIILIVIIIILIVIIIIMIILVVMIIIL
    46   57 A C  H  < S+     0   0   71   71   89  CCCCCCCCCCCCrASAFEKRIAEQIIISIsIAAREIIseMIAMEssEAAInnqNDSvSnEiEpSSyvEIp
    47   58 A I  H >X S+     0   0    5   71   62  IIIIIIIIVVIIiITTIHIINIVNNNNINhNIIIANNrvNNVNVitIIVNiiiVIVvIiIhTiIIivINi
    48   59 A N  H 3< S+     0   0    4   71   78  NNNNNNNHHHQQMHMMQLLMHMLLHHHLHLHMMMMHHLGHHMHVSLTMLHLLLLLLLLLQRWVLLMLHHV
    49   60 A K  T 3< S+     0   0  120   71   60  KKKKKKKRKRKKKSKKRSKKRRKKRRRRRTQKRKRQRSSRRRRKSESRRRGGQRKRLRGTMRRKKRLSRG
    50   61 A M  T <4 S+     0   0   90   71   84  MMMMMMMMMMMMMRLLERLMSSKLSSAESCSLSSVSSKTSSSSGSSSSKSNNSKKKRENSLQTDDARNSR
    51   62 A L     <  +     0   0   17   71   28  LLLLLLLLLLLLLLIICIFLLILFLLLLLHLLLLLLLSHLLLLLMLLLILLLLIVLLLLLSMLLLLLLLL
    52   63 A N        +     0   0  123   71   72  NSNNNNNGKNQQRNRKRGRDRKKRRRRQGGRSRSKRKRKRRRKKHNVKKRSSAKNSSQQCGRDQQESKRD
    53   64 A H    >   -     0   0   37   71    7  HHHHHHHDHDHDHHHHHHHHHHHHHHHHHHHHQHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
    54   65 A E  T 3  S+     0   0  132   71   54  EEEEEEEPAPTPDSPPPEPPPKPPPPPPPQPRQPKPPLQPPEPPVPPREPPPPPPNPPPPPPKPPPPPPK
    55   66 A N  T 3  S+     0   0   12   71   26  NNNNNNNHNGNHNSNNNNHNNNNHNNNNNNNHNNNNNNNNNNNNNNNNNNFFYNNNNNFNNNNNNNNNNN
    56   67 A V  B <  S-e  135   0B   2   71   14  VVVIIIIIIIIIVIVVVLIIIVIIIIIIIVIVVIIIIMVIIIILVIIIIIVIIIIIIIIVIIIIILIIII
    57   68 A V        -     0   0    8   71   23  VVVVVVVIVILLVIVVIVIVVIVIIIIVIIVIVIIVIICVIVVIMIIIVVVVVIIVIVVLVTIIIVILII
    58   69 A K        -     0   0  108   71   55  KKKKKKKRRRRRRKRRQKRKRDRKRRRRRRRRKKGRRHERRARRESRDARNNQEAQQRNRRQRQKKQRRR
    59   70 A F  E     +D   73   0A  31   71   23  FFFFFFFFFFFFFYMLLMLLFLLLFFFLFIFLLLFFFLIFFLFFTLLLLFFFLLLLLLFLFLVLLLLMFV
    60   71 A Y  E     -     0   0A 117   71   85  YYYYYYYYFYFFFYYYILYFKHYYKKKHKHKRQYRKKFFKKRKLIYYHEKEEYLKLKHEYRYYLLYKYKY
    61   72 A G  E     -D   72   0A  19   71   42  GGGGGGGGGGGGGGEEDGEQEDDQEEEEESEEEHDEEEAEEDEQDEEDDEGGDEEDEEGGEEEEEDEGEE
    62   73 A H  E     -D   71   0A  76   71   73  HHHHHHHHHRKKEQVVFVVVVVVVVVVFVHVVVVFVAIMTVVVALVVVIVFFVFLVIFFWVVMVVLIHVM
    63   74 A R  E     -D   70   0A  93   71   87  RRRRRRRRRRRRRRMMGVIILLIILICILQCLLVKCSRTYIMLIILFLYLCCYYFFFVCFFLLSSVFFSL
    64   75 A R        +     0   0  189   71   85  RRRRRRRKKESSAHAGATEEVEESLLLEVMLQQEELFTEALELERIEEEVQQVDDDEEQHLCEEEDEHRE
    65   76 A E    >   -     0   0  118   71   69  EEEEEEEEENQQCSSSDITTTSTTTTTTTITSSTTTVNEKTSTTDTSSSTDDSNTDTTDDTTSNNETDSS
    66   77 A G  T 3  S-     0   0   88   71   74  GGGGGGGGGGGGGVKRTKSEPTDPPPPEPRPPSRDPNPNMPNPTEGRTSPPPTQPKDEPSSEASSTDKgA
    67   78 A N  T 3  S+     0   0   92   71   73  NHNNNNSSTNNHKDTTNTTKSNKTTTTRSDTSNESTwEGsTNTHHTENNSRRTSQATRRETSDTTDTDgD
    68   79 A I  E <   -C   35   0A  39   71   88  IIIIIIIITFVVITKKWTETHHYDHHHHHDHNHTNHhNLhHHHRnGRHHHYYAHKHDHYRHKgCCQDNhg
    69   80 A Q  E     -C   34   0A  12   71   75  QQQQQQQQMEEEHYIIVSILLYIILLLMLCLIYTYLLYPLLYLVwVIYLLLLIILVIMIILIiMVIIILi
    70   81 A Y  E     -CD  33  63A  51   71   67  YYYYYYYYYFYYYYYYWCFYAYGFAAAGALAYYYYAAQRAAYAYCHVYYAYYYYYYAGYFGYYFFYAYAY
    71   82 A L  E     -CD  32  62A   0   71   28  LLLLLLLLLIIILIIIFILLILIMIIIIIIIILLLIILLIILIIEFMLLILLLLLLLILLIMLLLLLLIL
    72   83 A F  E     +CD  31  61A  17   71   41  FFFFFFFFFFFFFFVVAYVVVVIIVVVVVVVVVVVVVIFVVIVIVIVVIVVVVVVVVIVIAVVVVVVIVV
    73   84 A L  E     -CD  30  59A  24   71   11  LLLLLLLVLLLLLLLLMLMMMLLMLMMLMEMLLMLMMLLMMLMMMLMMMMLLMMMMLLLLMMMLLMLLMM
    74   85 A E        -     0   0   23   71    5  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEESEEEEEEEQEEQEEEEEEEEEEEEEEEEEEEEE
    75   86 A Y        -     0   0   73   71   28  YYYYYYYYYYYYYYFFLYHYYFYYYYYYYYYLLYFYYYMYYYYYYYYFLYFFLLLLLYFYYYLYYLLYYL
    76   87 A C    >   -     0   0   15   71   56  CCCCCCCACAAAVAVVGIVAAVAVAAAAAAAVVAVAAAAAAVAACAAVVAVVLVVVVAVCACAAAAVAAA
    77   88 A S  T 3  S+     0   0   62   71   64  SSSSSSSSTSAADSTTSAGSASSSSSASANATTSSASDYASPAEAPSSSASSPTTTTSSYSKECRETGAE
    78   89 A G  T 3  S-     0   0   18   71   18  GGGGGGGGGGGGGGGGNGGGGGGGGGGRGNGGGEGGGGCGGGGNGGGGGGGGGGGGGGGGGGGggGGKGD
    79   90 A G  E <   -F  127   0B  29   71    8  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGllGGGGG
    80   91 A E  E >   -F  126   0B  70   71   15  EEEEEEEEEEEEEEEEEEEEEEEEEEEEETEEEEEEEDDEEEESDNEEEEEEDEEEEEEEEEDQQEEEED
    81   92 A L  G >> S+     0   0    0   70   12  LLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLL.LLLLLLLLLLLLLLLLLLLLLLMVRRLLFLI
    82   93 A F  G >4 S+     0   0   97   71   17  FFFFFFFFFFFFFFFFFRFFFFFFFFFFFHFFFQFFFFLFFFFLFGYFFFFFFFFFFFFYFFFFFFFFFF
    83   94 A D  G <4 S+     0   0  120   71   41  DDDDDDDDDDDDDDDDDGDDGDDDEEQDASEDDDDEEESEEDEENKEEDGTTDDDDDDTRDDDIIDDKDD
    84   95 A R  G <4 S+     0   0   90   71   67  RRRRRRRRRRRRRRKKKKYYRKHYRRRYRRKRKRKKRKTRRKRIKLYKRRYYRRKRRYYERYCKKRRFRC
    85   96 A I  S << S-     0   0   22   71   15  IIIIIIIIIIIIIIIIIIILIIIIIIIIIIIIIIIIIIRIIIIIIIIIIILLIIIIIILLIIVFFIILIV
    86   97 A E  B >>  -H   90   0C 113   70   91  EEEEEEEEEEEEEEAVE.VVCVLVCCCLCCCVVIVCCNTCCVCRMSQVVCRRVVVVVLRRVVLAAIVSCL
    87   98 A P  T 34 S+     0   0  102   71   77  PPPPPPPPPPPPPPSNPKKASAAKTNTNSSSKAQATTQYSNQSKHEDAESSSDEEQENSKKKNEEKEDSR
    88   99 A D  T 34 S+     0   0  100   71   79  DDDDDDDDDDDDDDKHDKRHAAHHAAAHAGAAAAAAAHGTALADIEKAKAIIKKKKRHITAHGTTRRRAE
    89  100 A I  T <4 S-     0   0   92   71   71  IIIVVVIVVVVIHVGGLNGGGKRGGGGRGYGKKGKGGGDGGKGSGGQKGGGGGGGGGRGGNgGQQGGGGG
    90  101 A G  B  <  -H   86   0C   4   70   88  GGGGGGGGGGGGGGRRGGRKRRYKRRRYR.RRRSRRRGGRRRKYFPRRFRRRISSSYYRYRdPKKKYgRP
    91  102 A M        -     0   0   24   71   40  MMMMMMMMMMMMMMLMVMLMFFLLFFFLFLFFFLFFFLMFFLFISLLFYFLLYYYYYLLLFDLLLFYfFL
    92  103 A P     >  -     0   0   75   71   71  PPPPPPPQVPPPEPKGDSSKSDRKSSSKSTSDDEDSSGPSSDSDGPSNTSDDTSSTSKDTSTPGECSGSP
    93  104 A E  H  > S+     0   0   48   71   37  EEEEEEEVEQQQPLEEELEEEEEEEEEDEIEEEDEEESVEEEEEDEEEEETTEEEEEDTEEKEEEEEEEE
    94  105 A P  H  > S+     0   0   56   71   78  QQQQPQPTKVHHGSDPDQSKDPKHDDDPDDDCPSPDADQNDSDIEEDPMDSQTRLKRPQKDLSEERRKDH
    95  106 A D  H  > S+     0   0   77   71   59  DDDDEDDEEEEELDEEVKEEETDEEEEQELEQTETEEEYEETEREKETDEHHQDDDDAHQEERRRDDEER
    96  107 A A  H  X S+     0   0    0   71   17  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAVSCAAASAAAAAAASIAAAAAAAAAAAAAAAACAAAAATAA
    97  108 A Q  H  X S+     0   0   17   71   63  QQQQQQQHHQQQQRRRQKRRRRCRRRRRRQRRRRRRRHQRRRRRHKRRSRAARSASARGARRKRRAASRK
    98  109 A R  H  X S+     0   0   82   71   89  RRRKKKKRRRRRHKKRFFKAFRKRYFYRFRYKRKRYYRKFFQFKCKHRRFFFQENYHRFTYRALLVHLYA
    99  110 A F  H  X S+     0   0    7   71   34  FFFFFFFFLYYYFFYYYYFKFYLFFFFLFYFYYIYFFYYFFYFWLMFYLFYYVLLLVLYYFILIIIVYFL
   100  111 A F  H  X S+     0   0    0   71   27  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFIFAAMSIIIFAIFFFFFIIIFF
   101  112 A H  H  X S+     0   0   57   71   71  HHHHHHHSQKTTLKQQKRQRQQAQQQQAQKQHHVQQQKRQQHQRRGRQRQSSRCRKKASAQRRRRAKRQH
   102  113 A Q  H  X S+     0   0   27   71   11  QQQQQQQQQQQQQEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRQKQQQQSQQQEEQQQQQ
   103  114 A L  H  X S+     0   0    0   71   19  LLLLLLLLLLLLLLLLLLIILLLILLLLLLLLLILLLLLLLLLLLVILVLVVLIIVILVLLIMLLMIVLL
   104  115 A M  H  X S+     0   0    0   71   40  MMMMMMMIIILLLIIIIVIVIIIIILLVIIIIIVIIIIILLIIVLVTILIAALLVLLVATIVVLLLLMIV
   105  116 A A  H  X S+     0   0   38   71   64  AAAAAAAGAAASQANNNDSSSASSSSSSSASSAHASCDASSASDESSADSSSAESQESSQSDEEESELCE
   106  117 A G  H  X S+     0   0    0   71   34  GGGGGGGGAGGGGGAVAGGAGGGGGGGGGGGGGAGGGGGGGGGAGAAGGGIIAAAAAGIAGAAAAGAAGA
   107  118 A V  H  X S+     0   0    2   71   21  VVVVVVVVVVILLVVVVLVVVVVVVVVVVLVIMVVVVLLVVIVVVIVVVVFFVVVVVVFLVVIVVVVLVI
   108  119 A V  H  X S+     0   0   51   71   85  VVIVVVVEESNQEEDDSHEQSHWDSSSGSRSHYQHSDRESSYSDGRHHNSEEHQKQAGEAAARQQRATSR
   109  120 A Y  H  X S+     0   0   49   71   10  YYYYYYYYYYYYYYYYFFYYYYYYYYYYYYYYYYYYYFHYYYYYYYYHYYYYYYYYYYYYWKYYYYYYYY
   110  121 A L  H ><>S+     0   0    2   71   80  LLLLLLLLLLLLLLCCILCCCCICCCCLCICCCCCCCIVCCCCCMCCCLCLLLLLMLLLCCCCCCMLMCC
   111  122 A H  H ><5S+     0   0    7   71    2  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHKHH
   112  123 A G  H 3<5S+     0   0   53   71   65  GGGGGGSKNSQQSNSSSQRQTSQRSSSKAESESDSSSEGSSSsESSQSSTSSESSGEKSEREGDDAEEFG
   113  124 A I  T <<5S-     0   0   59   71   86  IIIIIIIKARRRRNRRKNYKMKKHMMMKMKMQKHKMLELMMKlRVLNKLMKKsLSKNKKKEKCSSANCMC
   114  125 A G  T < 5S+     0   0    1   71   51  GGGGGGGGGGGGGGGGGHMREGKMEQEGEGEGGHGEQGGQQGqGGDGGGENNnGNGGGNHGNGGGGGNQG
   115  126 A I  E   < -I  143   0D   0   71   24  IIIIIIIVIIIIVIVVVVVIIFIVIVIIIIIVFIFIIVVIVFIVVIVFIIIIVIIVVIIVVFVIIYVVIV
   116  127 A T  E     -I  142   0D   1   71   69  TTTTTTTTTAAAAAYYAVVICAVVCCCVCVCSAAACCTACCACVAVVAVCIVVVVVVVIICVAIIVVICA
   117  128 A H        -     0   0    2   71    7  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHYYHHHHHHYHHHHHHHHHHH
   118  129 A R        +     0   0   28   71   13  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRHRRRRRRRRLRRRRRRRRRRRRRRRRRRRRRRRRGGRRRRR
   119  130 A D        +     0   0   22   71    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   120  131 A I        +     0   0    3   71   21  IIIIIIILIILLILLLIILLLLLLLLLLLILLLILLLIILLLLILILLLLLLLLLLLLLILLLLLILILL
   121  132 A K    >   -     0   0   40   71    0  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
   122  133 A P  G >  S+     0   0    1   71   59  PPPPPPPPPPPPPPPPPPPALPLPLLLLLPLPPAPLLPPLLPLCPPLPPLPPPPPPPLPPLLCPPPPPLC
   123  134 A E  G 3  S+     0   0   60   71   17  EEEEEEEEEEEEEEEEEQEEEEEEEEEEEREEESEEEELEEEEEEQEEEEEEEEEEEEEEEEEAAEEEEE
   124  135 A N  G <  S+     0   0   15   71    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   125  136 A L  E <   - G   0 135B   1   71   48  LLLLLLLLILLLILLLLLLLTLLLTTTLTLTLLILTTLLTTLTLLIILLTLLILLLLLLLTVAIIILLTA
   126  137 A L  E     -FG  80 134B  34   70    1  LLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL.LLLLLLL
   127  138 A L  E     -FG  79 133B   0   71   21  LLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLILLLLILLLLLLILLYLIILYLYYLILLMLMMFYLLL
   128  139 A D    >   -     0   0   14   71   48  DDDDDDDDDDDDDDDDDTDDDDDDDDDDDSDDDNDDDTKDDDDNDDDDFDAACMKYADADDTLDDEAGDQ
   129  140 A E  T 3  S+     0   0  140   71   71  EEEEEDEEDAEEGEAAKENSGARSGGGRGVGDAHAGGKTGGAGTNGKASGDDTSSSDRDHGDQRRRDSGG
   130  141 A R  T 3  S-     0   0  178   70   83  RRRRRRRHKNHHYYSYSLDESTNNNSSNSDSKNKTSSSDSSNNEAEDNP.DDSPKPLNDERDGEEPLDSH
   131  142 A D    <   +     0   0   52   71   74  DDDDDDDDDDDDDGGGGDFMPGRLPTPKANPDGGGPPGGETGTYGGLGHSGGDDEDSKGGPLFGGTSNPT
   132  143 A N        -     0   0   27   71   80  NNNNNNNNNNNNVNFNNDQNsENHsatNsVtVTNEtaITaaTvEqNTMdPYYndnvlHYRaNNHHdlQaV
   133  144 A L  E     - G   0 127B   1   70   31  LLLLLLLLLLVILLLLLLVIlLVVllvIvLvLLILvlLLllLvIlIVLiSLLiivilILLlILPPllLl.
   134  145 A K  E     - G   0 126B  18   71   24  KKKKKKKKKKKKKKKKKKKKKKIKKKKIKKKKKKKKKKKKKKKKKKKKMPKKKMAMKIKKKKKKKLKKKK
   135  146 A I  E     -eG  56 125B   2   71   22  IIIIIIIVLIIIIIVVLIIIIIIIIIIIIIIIILIIIIIIIIILILLIIRLLLLIIIILIILLLLIIIIL
   136  147 A S        +     0   0   19   70   59  SSSSSSSSTSSSSSSSTAAACSTACCCTCACSSGSCCASCCSCSTIA.SLTTTSASATTACITSSTAACT
   137  148 A D        -     0   0   37   70    2  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DKDDDDDDDDDDDDDDDDDDDD
   138  149 A F    >   +     0   0    2   70    1  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF.FIFFFFFFFFFFFFFFFFFFFF
   139  150 A G  T 3  S+     0   0   16   70    2  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG.GCGGGGGGGGGGGGGGGGGGGG
   140  151 A L  T 3  S+     0   0   54   71   43  LLLLLLLLLMMMLLLLLLLFYLFLYYYFYCYLLLFYYFLYYLYFTQLSLDFFLLLLLFFWYFFLLLLWYF
   141  152 A A    <   +     0   0    2   71   45  AAAAAAAAAAAASASSASSSSGASSSSASSSSSACSSASSSSSASASDSFAAASSSSAASSTAAASSASA
   142  153 A T  E     -I  116   0D  23   69   76  TTTTTTTTTTTTTTAASTNNK.NNKKKNKSKANTSKKTVKK.KRAINFKGKKKKKKKNKVKRKFFRKVKK
   143  154 A V  E     +I  115   0D  46   69   85  VVVVVVVVMVMMVMLLVFIES.RMSSSTSRCLLKSSSMKSS.SGVKRGMYVVTMITITVQSDVRREIYSL
   144  155 A F        +     0   0    0   69   83  FFFFFFFFFFFFFFPSFYMFG.FMASAFGFACQVKASHFSS.AHFCYLESVVILIEIFVSAYLFFIINSL
   145  156 A R  E     +J  150   0E  65   69   90  RRRRRRKRRrrrRlQQKRHTl.ESlvlnlrfVQvDlirIvv.vmrKMGGKEEDyGEDdETVePllQDAlP
   146  157 A Y  E >  S+J  149   0E 135   63   70  HHHHHHHHFqkkHgQQknD.hNHDhhhdhyhgDqDhhnDhyNhkq.RNTS..EdQ.Dg.N.tKqq.DDhR
   147  158 A N  T 3  S-     0   0  145   28   84  NNNNNNNQK...L.VVnd...R.....h...gV.S...D.IL.Ne..R.G.......H............
   148  159 A N  T 3  S+     0   0  146   37   75  NNNNNNGGGGGGGGRRGG...QK....R.G.DL.E..GE.AQ.GK..Q.L.......R....S......G
   149  160 A R  E <   -J  146   0E 188   39   75  RRRRRRRKRRKRRKEDSE.P.QA....R.K.SL.S..AG.PQ.QEP.Q.L.......R....R......R
   150  161 A E  E     -J  145   0E  74   47   63  EEEEEEEEEEEEERDDKEGG.DDG...G.L.KQ....EE.ED.APGGDGH...TSSQG....R...Q..Q
   151  162 A R        -     0   0  134   64   84  RRRRRRRRRRRRRRGGRKASSVDESSSDSKSKT..SSQKSVFSPHTRVDSGGQAVGVDG...E..PVKSE
   152  163 A L        -     0   0   74   68   74  LLLLLLLLLHLLKKLLMMFKQLLFQQKLQLKMIKVKRMLQLLQLKLCLVQRRGMVITLRK.LL..KTRKL
   153  164 A L  B     +K  173   0F  16   69   68  LLLLLLLLLLLLLLLLCLLLPLMLPPPMPIPL.LFPPLWPLLPSLLLLMPTTLLMMMMTR.LSEEMMRPS
   154  165 A N        +     0   0  103   69   83  NNNNNNNGSDDDTDHHTDKDKQVRKKKQKTKT.AEKKNVKKQKEHSDHAKYYRQAAKQYR.DQVVMKMKR
   155  166 A K  S    S-     0   0  100   69   62  KKKKKKKKRKKKRKTTTGTTSTTTSSSTSQST.GKSSARSKTSTGRTTTSTTTTTTTTTT.TTTTTTTST
   156  167 A M        +     0   0  123   69   88  MMMMMMMCLRRRCKTTAFSFTVSSTTTSTATT.FATTYPTEVAFVHFVATLLFAAAVSLM.YFAANVFTF
   157  168 A C        +     0   0   23   70   38  CCCCCCCCCCCCCCCCCWCCVCCCVVVCVVVCCCMVVCAVYCVCCCCCCVCCCCCCCCCC.CCCCCCCVC
   158  169 A G  S    S-     0   0   32   70    1  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGdGGGGGGGGGGGGGGGGGGG.GGggGGGGG
   159  170 A T    >   -     0   0   31   71   31  TTTTTTTTTTTTTTTTSTSSTTSSTTTSTTTTTTTTTSTTkTTSSTSTTTTTTTTTTSTTFSSttTTTTS
   160  171 A L  G >  S+     0   0   85   71   66  LLLLLLLPLLLLPIPPPRPPPPPPPPPPPTPPPLPPPPPPLPPYQRPPPPPPPPPPPPPLDSTLLVPMPM
   161  172 A P  G 3  S+     0   0   31   71   71  PPPPPPPPPPPPPPNNPPNPANCNAAACAKANNPNAAPAAPNAAPDLNGAEEQGSGGCEDSAAQQDGEAA
   162  173 A Y  G <  S+     0   0   10   71    7  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYFYYYYYYYYYYAYYYYFYYYYYYYYYYYYYYQYYYYYYYYY
   163  174 A V  S <  S-     0   0    9   71   65  VVVVVVVVVIVVILVVLGAAIVAAIIIAIWIVVCIIIIWITVIAINAVVILLFVVVCALLPAAAASCLIA
   164  175 A A    >>  -     0   0    0   71   15  AAAAAAAAAAAAAAAAASAAAAAAAAAAAPAAAAAAAACANAASAASAAAAAAAAAAAAAKAAAAAAAAA
   165  176 A P  H >> S+     0   0    0   71    2  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP
   166  177 A E  H 3> S+     0   0    5   71    5  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEELEEEEEEEEEEEEEEEEEEETEEEEEEEEE
   167  178 A L  H <4 S+     0   0    9   71   37  LLLLLLLVLVVVVVVVVMVLVVLVVVVLVCVVVLTVVVGVFVVIELIVVVIIVIVVILIMVIVLLLIMVV
   168  179 A L  H << S+     0   0   55   71   22  LLLLLLLLLLLLYLILVFIFLLVILLLVLFLLLLLLLLMLFLLLWVILLLLLLLLLLVLVLVLFFLLVLL
   169  180 A K  H  < S+     0   0   91   71   87  KKKKKKKKSCQLSSNNSKTQSMISSLSVSGSMMQNSSTVSDMSKDLNVASLLHLNARVLESSQLLKRNSQ
   170  181 A R     <  -     0   0  110   71   76  RRRRRRRRQRKKGCNDQMGGREsGRKRsRRREEAGRRGHREEKGtRGEQRNNrQAQGsNNRGGQKsGNRG
   171  182 A R  S    S+     0   0  212   56   68  KKKKKKKKT...ALKRKEKRKRgKKKKgKYKKREGKRIKR.RKIhELR.K..r....g..KKIKNk..RV
   172  183 A E  S    S+     0   0   74   69   76  EEEEEEEEEKPPEPGG.ALKEGALEEELEAEGGKYEEDYE.GEPEPPGKEKKGQTQNLKKQKPKKSNDEP
   173  184 A F  B     -K  153   0F   4   70   54  FFFFFFFYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYIY.YYYYYYYPYGGRPGPAYGAYYHYYGAIYH
   174  185 A H     >  -     0   0   87   70   76  HHHHRHHHKAHHYQDDDRADDNVADDDTDHDDNEDDDRDD.NDQFDHNYDHHYYYYYTHHDLDQQYYHDD
   175  186 A A  H >> S+     0   0    0   71   38  AAAAAAAAAAAAAAGGPGGGGGGGGGGGGAGGGGVGGGGGMGGPPGGGSGGGGGDGGGGDGGSGGGGDGS
   176  187 A E  H 3> S+     0   0   63   71   79  EEEEEEEEQEQQEEAAEPPPKLSPKKKRKQKKLLFKKPEKKLKQTKPLKKKKKKKKPRKYEPKPPPPSKC
   177  188 A P  H 3> S+     0   0   26   71   81  PPPPPPPPPPPPPPKTPPEEISAEIIVKIPVKSPAVHAAVISIFKSESAIAAEAEEEKAAIEKPPEEGMK
   178  189 A V  H X S+     0   0    0   71    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   182  193 A S  H 3X S+     0   0    5   71   16  SSSSSSSSASSSSASSSSSSSSSSSSSSSSSSSSSSSSSSSSSSASSSSSTTSSSSSSTTSSSSSSSCSS
   183  194 A C  H 3X S+     0   0    0   71   70  CCCCCCCCCCCCCCCCCACLCCCCCCCCCACCCLCCCAACCCCMCLLCICLLAIIIVCLLCLMLLIVLCL
   184  195 A G  H X S+     0   0    0   71   48  TTTTTTTVTVIVVVFFFVYYYYYYYYYYYYYYYFYYYIVYYYYFYYYYYYYYYYYYYYYYYFYFFYYYYY
   189  200 A A  H >X S+     0   0    4   71   71  AAAAAAAAAATTASVVVYATVVAAVVVAVYVVVLVVVAEVVVVAAFAVIVEEIIIIIAEEVTVEEIIEVA
   190  201 A M  H 3< S+     0   0    0   71   11  MMMMMMMMMMMMLMLLLMLLMMMLMMMMMMMMMMMMMMMMMMMMMFLMLMMMLLLLLMMFMIMMMLLFML
   191  202 A L  H << S+     0   0   15   71   25  LLLLLLLLLLLLLLMVLLLVLLLLLLLLLVLLLVLLLILLLVLVLTVLLLNNLLLLLLNLLLLVVLLLLL
   192  203 A A  H << S-     0   0    0   71   66  AAAAAAAAAAAASAAATSCSVAACVVIAVAVSASAVVAIVVAVYSTYACVAASCCCCAAYVCCAACCMVC
   193  204 A G  S  < S+     0   0   13   71   10  GGGGGGGGGGGGgGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGKGGGGGGGGGGGgGGGGGAGGGgGGA
   194  205 A E  S    S-     0   0   61   71   92  EEEEEEEEEEEEkEYYQKKSAKYTAASYAESHRSKSAADAARARNYSKYAIITYFYeYIVAYSVVYeKAR
   195  206 A L        -     0   0   69   71   72  LLLLLLLLLLLLLLLLILLLYLLLYYYLYVYFLLLYYVVYYLYLLLMLPYDDPPPPPLDPYLLRRPPTYL
   196  207 A P  S    S+     0   0    7   71   14  PPPPPPPPPPPPPPPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPPPFPPPPPPPPPFPPP
   197  208 A W        -     0   0    3   71    6  WWWWWWWWWWWWWWFFWWFFFFFFFFFFFWFFFFFFFWWFFFFFWFFFFFFFFFFFFFFFFFFFFFFFFF
   198  209 A D  S    S-     0   0  121   71   51  DDDDDDDDDDDDDDEDEEDDEEDDEEEDENESEREEEEEEEEEDKRDEYESSDYYYDDSEEDDSSYDEED
   199  210 A Q        -     0   0   66   70   57  QQQQQQQEQVQQSMEDMAEGD.DDDDDDDADADGDDDQEDDDDDIGGDDDDDVDGDPDDADEDGGSPSDD
   200  211 A P        +     0   0    0   70   67  PPPPPPPPPPPPPPSPPADAP.DEPPPDPAPDRNRPPAPPPRPTAKTREPEEQEDERDEEPETTTVRKPT
   201  212 A S  S >  S-     0   0   18   70   69  SSSSSSSTTSSSSSNNHTNTE.PHEDEPESESNSNENDTVDNDNQTNNNEDDSSTNGPDSANDKKNGNDN
   202  213 A D  T 3  S+     0   0  104   70   79  DDDDDDDYENAAYD LEDILDDSVDEDADEDIMFPDDHEEEMGYVIYMDDPPEDVDDAPQDDITTQDRDI
   203  214 A S  T 3  S+     0   0  114   70   80  SSSSSNSSSDNSES MELPKPRNPPPPNPKPQNVRPPFKPPNPRSNSKSPMMGAPSQNMSPAPEEDQNPP
   204  215 A C    X>  -     0   0   11   69   95  CCCCCCCCCCCCCD EDSTEKSPTRKR KCREVESKKDEKKAKDNDIQKKAAINEVYPADRIKLLDYMKQ
   205  216 A Q  H 3> S+     0   0  116   67   85  QQQQQQQKQPVAPE LtLLLnMdLnnn nYnLLI.nniLnn.nLEVLLLnIIDLILMeITnIMMMnMrnM
   206  217 A E  H 3> S+     0   0   92   43   85  EEEEEEEEELEEED .r...tKi.ttt tNt.L..ttrQtt.t.H..LFt..A....i..t....i.at.
   207  218 A Y  H <> S+     0   0    1   54   63  YYYYYYYYYYFFYY .YEF.IHN.III IYI.G..IIYYII.I.Y..FEIYYVFFFYNYFI....KYYI.
   208  219 A S  H  X S+     0   0   20   60   93  SSSCCCCCSTIIRK .YYKRGLL.GQS GNSFK.LSQCETQLGVAE.RQGQQAEEQSLQKQ....KSKG.
   209  220 A D  H  <>S+     0   0   23   64   85  DDDDDDDDDSNNEL .MVKERLLFRRR RRRK.KLRRSTRRLRKME.IIRKKNQQQRLKRRHL..QRKRL
   210  221 A W  H ><5S+     0   0   10   67   86  WWWWWWWWWWWWWW YELIRIAYRIII IWIK.WEIIFWIIAIQYR.ELIIISIIIIYIIIKWKKIIIIC
   211  222 A K  H 3<5S+     0   0   66   68   75  KKKKKKKLLKKKCK KKWKVMRKKILL MKLI.QKLMRLLLKLVLIKRKMLLTKMLLKLMMKQNNMLNVQ
   212  223 A E  T 3<5S-     0   0  114   69   85  EEEEEEEDQEDDST KKTELSIYIGSG SLGKIIVGARMSSISTKTEGASKKLKEKNYKKSIQAASNSSQ
   213  224 A K  T < 5 +     0   0  155   69   89  KKKKKKKKKCNNQT IGNCRAEIKIVV AHVNEIKVINNVVEVNKTQEDAGGQAAACIGVVKQLLGCLIQ
   214  225 A K    > < +     0   0   53   69   77  KKKKKKKKKQDDND SEGSGQRVSQQQ QQQGRSAQQGDQQRHKRGIYYQKKFENSDVKDKEKKKTDKQK
   215  226 A T  T 3   +     0   0   40   69   94  TTTTTTIMTIhrCy sVVYKHGsgYYY YtYEGaGYYRDYYGYVeTrAeHVVPyfyysVLYlgggyyYYg
   216  227 A Y  T 3  S+     0   0  148   66   94  YYYYYYYHYTqqFn dLRTYSEtfSSS SnSYDfESK..ASESVgYgMdSKK.fyffpKSSysyyffTQs
   217  228 A L  S <> S-     0   0   57   67   78  LLLLLLLLLRTTFH FIRIRIYLPIII IKINYRFII..VIYIFVTLVAIFFTDPDVLFFFEFQQHVIIL
   218  229 A N  T  4 S+     0   0   75   67   77  NNNTPTPSPLQQTS TSEPIPNTIPPP PQPPQVIPPK.PPQPPPIY.PPPPASESSTPPPFPFFHSPPP
   219  230 A P  T >4 S+     0   0    5   68   82  PPPPPPPPPPttPP CPPSPDMFPDDD DvDFMPMDDgMDDMDKQPK.YDKKQpeppFKSAPTPPppEER
   220  231 A W  G >4 S+     0   0    8   56   72  WWWWWWWWWWwwWW PWW..YAP.YYY YcYPI.LYYwDYYVYEF.T.WY..WwwwwP.NN.H..ww.YH
   221  232 A K  G 3< S+     0   0  139   64   92  KKKKKKKKKTSSSN PNS.FVRDDVVI VVVERPRVVSWVVRVPLTPRDV..WDGDDE.PLDLQQDD.VL
   222  233 A K  G <  S+     0   0   66   69   79  KKKKKKKKKKKKKK WKKHYRHYYRHR RKRYHHQRHRDRHHRKKHNQDRTSGESDEYSHHFGHHHETHG
   223  234 A I  S <  S-     0   0   11   69   35  IIIIIIIIIILLIL LIMVMIIVLVIV INVFIVVVIMIIIVVVYLIVIIFFVIIIVVFVLLIFFIVIIV
   224  235 A D     >  -     0   0   79   68   50  DDDDDDDDQDDDSD S HSSTSSNSSS SNSSSSSSSSDSSSSSPSPSSTDDSSSSSTDSSSSSSSSSSS
   225  236 A S  H  > S+     0   0   84   68   81  SSSSSSSTPTTTNN F EQTPDEKSSS AESSDIESQQDMSEILSGSDDPKKPDKDLPKARNAKKKLSQR
   226  237 A A  H  > S+     0   0    1   68   71  AAAAAAATMLLLEL S EEDDTGSDED DEDDPDADEQDEEAEMGQESSDNNASPSNHNEEEEEESNNDE
   227  238 A P  H  > S+     0   0    0   68   65  PPPPPPPPPAAAPA A TACCAATCCC CICAAIVCCVVCCVCCPLAAACAAAAAAAAAACSCVVAAACC
   228  239 A L  H  X S+     0   0   20   68   82  LLLLLLLLLLIILL R IKEKKRVRRR KQRKKFKRKIFRRKKKCECRKKKKQKKKKRKKLKQQQKKSRQ
   229  240 A A  H  X S+     0   0   44   68   67  AAAAAAAASSSSAS K DDVNDHNNDR NKRDDNDRHSDHDDHAQNSDDNSSDDDDDDSNDDDSSNDDQD
   230  241 A L  H >X S+     0   0    0   68   10  LLLLLLLLLLLLLL L FLLLLLLLLL LTLLLVLLLLLLLLLLILLLFLLLLFFFLLLLLLLLLFLFLL
   231  242 A L  H 3X S+     0   0    0   68   27  LLLLLLLLLLLLLV I LILLILLLIL LLLIVIVLLLLLIILILIIIILVVIIIIVLVIIILIIIVILL
   232  243 A H  H 3< S+     0   0   75   68   79  HHHHHHHRSRRRKR T KQKSAGCSAS SGSRAVKSSRESAATNYHESSSKKRKNSSRKSSSKKKASSSK
   233  244 A K  H << S+     0   0   80   68   53  KKKKKKKKKKKKKK R KKKRRIHRKQ RRQRRERQRKRRKRRKKQWRCRHHRHKHKRHRRKRGGSKRRR
   234  245 A I  H  < S+     0   0    0   68   33  IIIIIIIILVVVLI I MIFIMMMIII IVIMMMIIIIIIIMIICIMILILLLLLLLILLIFLLLLLLIL
   235  246 A L  S  < S+     0   0    6   68   13  LLLLLLLLLLLLLL L LLLFLLLFFF FLFLLLLFFLLFFLFLIFLLMFLLLMLMILLLFLLLLLILFL
   236  247 A V        -     0   0   39   68   68  VVVITITTLMAART D NVVVVVQVVT VEVVTMVVVLEVVTVADTTVEVVVVEVEVVVVDIENNKVVVE
   237  248 A E  S    S+     0   0   66   67   78  EEEEEEEEAPTSPP P PVLAVPVAGA ATAVVIVST.VAGVAPPVVVKAAAAKVKLPAKGIPPPPLLAP
   238  249 A N  S >> S-     0   0   73   68   54  NTNNSNSTSLSSGT N CDNNNDDDND NDDNDNNDNQDNNDDLDSKDDNDDDSDEDDDDGDDDDDDSND
   239  250 A P  T 34 S+     0   0   16   68   36  PPPPPPPPPPPPPP P VPPPPPPPPP PPPPPPPPPATPPPPKPPVPPPLLPPVPPPLSIPMPPPPPPM
   240  251 A S  T 34 S+     0   0  104   68   77  SSSGTGVADGGGSF M EVSSKKMAAS SCSDRSESAEPEAKEAVEEEESSSALTKRRSSASTSSERGAI
   241  252 A A  T <4 S+     0   0   64   68   74  AAVSASAKAKTAKK T DQKKKYKKTK KQKFKRNKKLEQTKKRKMDKKKKKAKKRQRKKMNLMMEQDKM
   242  253 A R  S  < S-     0   0   10   67    5  RRRRRRRRRRRRRR R RRRRRRRRRR RRRRRRRRRRRRRRRIRRRRR RRRRRRRRRRKRRRRRRRRR
   243  254 A I        -     0   0   19   67   75  IIIILIIIIYLLYY I AAAIIAAIII IAIIIPIIIAAIIIIRPPAIF YYWFLFLAYLEIPPPALMIP
   244  255 A T     >  -     0   0   71   67   45  TTTTTTTTTTTTTD T TTSTTSTTTT TTTSSTTTTTNTTTTIESTTI ggTTSTNDgSATSTTTNETS
   245  256 A I  H  > S+     0   0   13   66   46  IIIIIIIIIILLII M IILILLLIII ILITMIMILIIIILI.IIVLC aaVCACVLaLTLILILVLIV
   246  257 A P  H  4 S+     0   0   72   67   74  PPPSPPASSQPEAL A ESEPEQDPPP PAPEEHEPKSKPPEPPAEEED AAVLEERFAQPSEEEDRTRE
   247  258 A D  H >> S+     0   0   70   66   51  DDDDDDDQDQKKKK E QDTEATDEEE EDESDQAEEMEEEGEGQEDGQ DDQQDQEEDK DEQQQEEEG
   248  259 A I  H >< S+     0   0    0   66   34  IIIIIIIIIIIIII I IIIIIVIIII IIIVVIIIIIIIIIIILIIIA IIAAAAAVVI AIVVSAAIV
   249  260 A K  T 3< S+     0   0   89   66   78  KKKKKKKKQTLLRQ L KRMKIMKKRK KEKLIKIKKEKKRIKKIEALL KKCLLLLAKM LSRRLLLRS
   250  261 A K  T <4 S+     0   0  145   66   69  KKKKKKKKKNNDDS D EKKKRQKQNK KNHKNTAQNENNNANTENSSQ NNQDTSDRNE LWQQEDNNR
   251  262 A D    4 S+     0   0    0   64    0  WWWWWWWWWWWWWW W WWWWWWWWWW W WWW WWWWWWWWWWWWWWW WWWWWWWWWW WWWWWWFWW
   254  265 A Y  T 34 S+     0   0   28   57   29  YYYYYYYYFF  CF F LFMFFLFFFY F FFF FFYFFFFFFYIILF  FF  LI LFI FLLLI IFL
   255  266 A N  T 3< S+     0   0   95   50   89  NNNTTTT SQ  KK K AVNL AQLLL L LTQ ALL QLLALTSK T  GG  NS SGI SA    VLA
   256  267 A K    <   -     0   0   72   42   43  KKKKKKR QK  KK K TK K PKKKK K KQ   KK KKK K SK    NN  N  ENK  N    KKN
   257  268 A P              0   0  124   31   82  PPPVPVP SK   S   DD N YDNNS N N    NN  NN N  S        S       T     NP
   258  269 A L              0   0   94   25    9  LLLLLLM  F       VL L LLMLL L L    LL  LL L                         L 
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1    7 A   0   0   0   0   0   0   0  23   0   0   4   0   0   2   0   0   4  43   8  17    53    0    0   1.517     50  0.53
    2    8 A   0   0   0   0   0   0   0  16   0   3   2   0   0   2  17  12   7   5   7  29    58    0    0   1.985     66  0.31
    3    9 A   0   0   0   0   8  23  69   0   0   0   0   0   0   0   0   0   0   0   0   0    62    0    0   0.793     26  0.90
    4   10 A   3   2   5   0   2   0   0   0   0   0   0   8   0   0   3   6   8  40   2  22    63    0    0   1.840     61  0.37
    5   11 A  13  52  13   6   8   0   0   0   5   3   0   0   0   0   0   0   0   0   0   0    63    0    0   1.493     49  0.61
    6   12 A  21  22  10   3   5   0   2  25   3   0   3   0   0   0   5   2   0   0   0   0    63    0    0   1.982     66  0.21
    7   13 A   0   2   0   0   3   0   0   0   0   0   5   0   0   2   8  36  34   6   3   2    64    0    0   1.662     55  0.36
    8   14 A   3   2   0   0   2   0   0   0   0   5   2  52   0   0   2   8   2  12   3   9    65    0    0   1.691     56  0.35
    9   15 A   0  75  24   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    67    0    0   0.623     20  0.82
   10   16 A   0   0   0   0   0   0   0  99   0   0   1   0   0   0   0   0   0   0   0   0    68    0    0   0.077      2  0.98
   11   17 A   1   0   0   0   0   0   0   0  10   0  18  10   0   3   6   7   6  37   0   1    68    0    0   1.895     63  0.29
   12   18 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    69    0    0   0.000      0  1.00
   13   19 A   0   0   0   0   0   0   0   3  29   0  13  12   1   1   0   3   0   4  32   0    68    0    0   1.714     57  0.33
   14   20 A   1   0   0   0  70   0  25   0   0   0   0   3   0   0   0   0   0   0   1   0    69    0    0   0.823     27  0.84
   15   21 A   0   0   0   0   0   0   0  66  11   0  21   0   1   0   0   0   0   0   0   0    70    0    0   0.915     30  0.67
   16   22 A  29   0   0   0   0   0   0   0   0   0   0   9   0   0   7  23   3  30   0   0    70    0    0   1.557     51  0.21
   17   23 A  80   0   0   0   0   0   0   0  18   0   0   1   0   0   0   0   0   0   0   0    71    0    0   0.547     18  0.71
   18   24 A   7   1   0   0   3   3   6   0   0   0   1   0   0   1  27  39  11   0   0   0    71    0    0   1.696     56  0.31
   19   25 A   0  72   3   7   3   0   1   0   0   0   1   0   0   0   7   1   1   3   0   0    71    0    0   1.153     38  0.61
   20   26 A  15  10   1   4   0   0   0  11  49   0   0   3   6   0   0   0   0   0   0   0    71    0    0   1.568     52  0.38
   21   27 A  21   3   4   1   3   4   1   0   1   0   0   8   0   1  28   8   1  13   0   0    71    0    0   2.133     71  0.12
   22   28 A   0   0   0   0   1   0   0   0   1   0   4   1   0  20   0   4   1   8  34  24    71    0    0   1.745     58  0.42
   23   29 A  10   3   1   1   0   0   0   0   6   3   1   1   0   0  31  34   3   6   0   0    71    0    0   1.824     60  0.31
   24   30 A   1   3   3   0   0   0   0   1   7   3   4   3   3   0  14  15  20  14   3   6    71    0    0   2.367     79  0.22
   25   31 A   0   0   0   0   0   1   1   7   0   0  10  63   0   4   0   1   0   1   3   7    71    0    0   1.366     45  0.47
   26   32 A   1   0   0   0   0   7   0  30   0   0   3   3   1   1   0  21   9  13  10   0    70    0    0   1.970     65  0.20
   27   33 A   3   0   0   4   1   0   3   0  10   0   0   3   1   6   6  17   6  41   0   0    71    0    0   1.936     64  0.24
   28   34 A   7  27   3   3   6   0   4   0  24   0   0   4   1   0   0   8   4   4   4   0    71    0    0   2.182     72  0.15
   29   35 A  68   3   1   1   8   1   1   0   1   0   1   0   3   0   1   8   0   0   0   0    71    0    0   1.304     43  0.48
   30   36 A   1   1   6   0   0   0   0   0  92   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.363     12  0.84
   31   37 A  48  11  27  13   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   1.273     42  0.69
   32   38 A   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0  92   0   0   0   7    71    0    0   0.328     10  0.86
   33   39 A  11   4  34   3   6   0  17   0   0   0   6   3   4   0   1   8   0   3   0   0    71    0    0   2.075     69  0.23
   34   40 A  23  18  44   4   3   0   0   1   1   0   0   3   0   0   1   1   0   0   0   0    71    0    0   1.583     52  0.58
   35   41 A   0   1   0   0   1   0   0   0   0   7   4   0   0   4  13   8   6  20   4  31    71    0    0   2.024     67  0.32
   36   42 A   0  17   6  11   3   0   0   1   0   0   0   1   0   0  30  30   0   0   1   0    71    0    0   1.710     57  0.27
   37   43 A   1   1   1   1   1   0   0  23   6   0   6   4   0   0   7  27   6  10   1   4    71    0    0   2.218     74  0.21
   38          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
   39   50 A   4   0   0   3   0   0   0   6   3   0   3   0   0   3  14  37   6  17   6   0    71    0    0   1.966     65  0.31
   40   51 A   1   1   0   3   4   0   1   3   6   0  10   4   1   4   0  10  18   0  32   0    71    0    0   2.137     71  0.19
   41   52 A  34  14  39   6   0   0   0   0   1   0   1   3   0   0   0   0   0   1   0   0    71    0    0   1.452     48  0.62
   42   53 A   1   6   3   0   1   0   4   0   4   1   3   0   1   0  11  28  20   4   3   8    71    0    0   2.237     74  0.18
   43   54 A   0   0   0   1   0   0   0   1   1   0   0   0   0   4  61  25   0   0   6   0    71    0    0   1.127     37  0.60
   44   55 A   7   1   1   0   3   0   0   0   0   0   0   1   0   0   0   3   0  83   0   0    71    0    0   0.722     24  0.63
   45   56 A  20   7  62   3   1   0   0   0   4   0   0   0   1   1   0   0   0   0   0   0    71    0    0   1.218     40  0.68
   46   57 A   3   0  17   3   1   0   1   0  11   3  14   0  18   0   4   1   3  13   6   1    71    0    0   2.333     77  0.10
   47   58 A  15   0  52   0   0   0   0   0   1   0   0   6   0   4   1   0   0   0  20   0    71    0    0   1.365     45  0.37
   48   59 A   4  30   0  17   0   1   0   1   0   0   1   1   0  25   1   0   6   0  11   0    71    0    0   1.851     61  0.22
   49   60 A   0   3   0   1   0   0   0   6   0   0  10   3   0   0  38  34   4   1   0   0    71    0    0   1.580     52  0.39
   50   61 A   1   8   0  21   0   0   0   1   3   0  31   3   1   0   7   8   1   4   6   3    71    0    0   2.133     71  0.15
   51   62 A   1  77   8   3   3   0   0   0   0   0   3   0   1   3   0   0   0   0   0   0    71    0    0   0.929     31  0.72
   52   63 A   1   0   0   0   0   0   0   7   1   0  11   0   1   1  27  18  10   1  15   4    71    0    0   2.048     68  0.28
   53   64 A   0   0   0   0   0   0   0   0   0   0   0   0   0  94   0   0   1   0   0   4    71    0    0   0.248      8  0.93
   54   65 A   1   1   0   0   0   0   0   0   1  62   1   1   0   0   3   6   4  15   1   1    71    0    0   1.402     46  0.45
   55   66 A   0   0   0   0   4   0   1   1   0   0   1   0   0   7   0   0   0   0  85   0    71    0    0   0.643     21  0.73
   56   67 A  23   4  72   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.767     25  0.85
   57   68 A  46   6  44   1   0   0   0   0   0   0   0   1   1   0   0   0   0   0   0   0    71    0    0   1.060     35  0.77
   58   69 A   0   0   0   0   0   0   0   1   4   0   1   0   0   1  48  23  10   4   4   3    71    0    0   1.599     53  0.44
   59   70 A   3  41   3   4  46   0   1   0   0   0   0   1   0   0   0   0   0   0   0   0    71    0    0   1.177     39  0.77
   60   71 A   0   8   3   0  10   0  37   0   0   0   0   0   0   7   6  23   1   6   0   0    71    0    0   1.812     60  0.15
   61   72 A   0   0   0   0   0   0   0  30   1   0   1   0   0   1   0   0   4  46   0  15    71    0    0   1.319     44  0.57
   62   73 A  45   4   6   4  11   1   0   0   3   0   0   1   0  17   1   3   1   1   0   0    71    0    0   1.836     61  0.26
   63   74 A   6  18  13   4  11   0   6   1   0   0   6   1   8   0  23   1   1   0   0   0    71    0    0   2.223     74  0.12
   64   75 A   6  11   1   1   1   0   0   1   6   0   4   3   1   4  14   3   7  30   0   6    71    0    0   2.324     77  0.15
   65   76 A   1   0   3   0   0   0   0   0   0   0  20  35   1   0   0   1   3  17   7  11    71    0    0   1.802     60  0.31
   66   77 A   1   0   0   1   0   0   0  23   3  24  10   8   0   0   6   6   1   7   4   6    71    0    0   2.203     73  0.26
   67   78 A   0   0   0   0   0   1   0   3   1   0  14  28   0   6   7   4   1   6  20   8    71    0    0   2.087     69  0.26
   68   79 A   3   1  14   0   1   1   6   4   1   0   0   7   3  32   4   6   1   1   7   6    71    0    0   2.330     77  0.11
   69   80 A   7  27  25   6   0   1  10   0   0   1   1   1   1   1   0   0  13   4   0   0    71    0    0   2.034     67  0.25
   70   81 A   1   1   0   0   8   1  54   6  21   0   0   0   3   1   1   0   1   0   0   0    71    0    0   1.495     49  0.33
   71   82 A   0  54  38   4   3   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0    71    0    0   0.997     33  0.72
   72   83 A  59   0  14   0  23   0   1   0   3   0   0   0   0   0   0   0   0   0   0   0    71    0    0   1.083     36  0.58
   73   84 A   1  54   0  44   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0    71    0    0   0.816     27  0.88
   74   85 A   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   3  96   0   0    71    0    0   0.202      6  0.94
   75   86 A   0  18   0   1  11   0  68   0   0   0   0   0   0   1   0   0   0   0   0   0    71    0    0   0.942     31  0.71
   76   87 A  28   1   1   0   0   0   0   1  51   0   0   0  17   0   0   0   0   0   0   0    71    0    0   1.182     39  0.44
   77   88 A   0   0   0   0   0   0   3   3  18   4  44  14   1   0   1   1   0   6   1   3    71    0    0   1.786     59  0.36
   78   89 A   0   0   0   0   0   0   0  89   0   0   0   0   1   0   1   1   0   1   4   1    71    0    0   0.540     18  0.81
   79   90 A   0   3   0   0   0   0   0  97   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.128      4  0.92
   80   91 A   0   0   0   0   0   0   0   0   0   0   1   1   0   0   0   0   3  85   1   8    71    0    0   0.632     21  0.84
   81   92 A   3  90   1   1   1   0   0   0   0   0   0   0   0   0   3   0   0   0   0   0    70    0    0   0.480     16  0.87
   82   93 A   0   3   0   0  89   0   3   1   0   0   0   0   0   1   1   0   1   0   0   0    71    0    0   0.547     18  0.82
   83   94 A   0   0   3   0   0   0   0   4   1   0   3   4   0   0   1   3   1  17   1  61    71    0    0   1.413     47  0.59
   84   95 A   0   1   1   0   1   0  14   0   0   0   0   1   3   1  52  23   0   1   0   0    71    0    0   1.412     47  0.33
   85   96 A   3   8  85   0   3   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0    71    0    0   0.612     20  0.84
   86   97 A  27   7   3   1   0   0   0   0   4   0   3   1  20   0   7   0   1  23   1   0    70    0    0   1.971     65  0.09
   87   98 A   0   0   0   0   0   0   1   0   8  23  17   6   0   1   1  13   6  11   8   4    71    0    0   2.200     73  0.23
   88   99 A   0   1   6   0   0   0   0   4  27   0   0   6   0  11   7  11   0   3   0  24    71    0    0   1.992     66  0.20
   89  100 A  11   1   8   0   0   0   1  54   0   0   1   0   0   1   4   8   4   0   3   1    71    0    0   1.666     55  0.28
   90  101 A   0   0   1   0   3   0  10  29   0   4   6   0   0   0  37   9   0   0   0   1    70    0    0   1.688     56  0.11
   91  102 A   1  28   1  27  30   0  10   0   0   0   1   0   0   0   0   0   0   0   0   1    71    0    0   1.539     51  0.60
   92  103 A   1   0   0   0   0   0   0   7   0  23  30   8   1   0   1   7   1   4   1  14    71    0    0   1.989     66  0.29
   93  104 A   3   3   1   0   0   0   0   0   0   1   1   4   0   0   0   1   4  75   0   6    71    0    0   1.089     36  0.63
   94  105 A   1   3   1   1   0   0   0   1   1  14   8   3   1   6   6   8  13   6   1  24    71    0    0   2.405     80  0.22
   95  106 A   1   3   0   0   0   0   1   0   1   0   0   7   0   4   7   3   6  44   0  23    71    0    0   1.748     58  0.41
   96  107 A   1   0   1   0   0   0   0   0  89   0   4   1   3   0   0   0   0   0   0   0    71    0    0   0.520     17  0.82
   97  108 A   0   0   0   0   0   0   0   1  10   0   6   0   1   6  49   6  21   0   0   0    71    0    0   1.512     50  0.37
   98  109 A   1   4   0   0  17   0  11   0   4   0   0   1   1   6  30  18   3   1   1   0    71    0    0   2.048     68  0.11
   99  110 A   4  15   7   1  39   1  30   0   0   0   0   0   0   0   0   1   0   0   0   0    71    0    0   1.517     50  0.65
  100  111 A   0   0  11   1  82   0   0   0   4   0   1   0   0   0   0   0   0   0   0   0    71    0    0   0.665     22  0.72
  101  112 A   1   1   0   0   0   0   0   1   7   0   6   3   1  17  20  11  31   0   0   0    71    0    0   1.919     64  0.28
  102  113 A   0   0   0   0   0   0   0   0   0   0   1   0   0   0   1   1  92   4   0   0    71    0    0   0.395     13  0.88
  103  114 A  10  73  14   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.833     27  0.80
  104  115 A  15  24  41  13   0   0   0   0   4   0   0   3   0   0   0   0   0   0   0   0    71    0    0   1.493     49  0.60
  105  116 A   0   1   0   0   0   0   0   1  28   0  38   0   3   1   0   0   4  11   4   7    71    0    0   1.705     56  0.35
  106  117 A   1   0   4   0   0   0   0  65  30   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.835     27  0.66
  107  118 A  75  11   8   1   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.867     28  0.79
  108  119 A  10   0   1   0   0   1   3   4   7   0  20   1   0  10   8   1  10  13   3   7    71    0    0   2.425     80  0.14
  109  120 A   0   0   0   0   4   1  90   0   0   0   0   0   0   3   0   1   0   0   0   0    71    0    0   0.448     14  0.90
  110  121 A   1  38   6   6   0   0   0   0   0   0   0   0  49   0   0   0   0   0   0   0    71    0    0   1.100     36  0.19
  111  122 A   0   0   0   0   0   0   0   0   0   0   0   0   0  99   0   1   0   0   0   0    71    0    0   0.074      2  0.97
  112  123 A   0   0   0   0   1   0   0  15   3   0  39   3   0   0   4   4   8  14   3   4    71    0    0   1.904     63  0.34
  113  124 A   1   8  11  15   0   0   1   0   3   0   6   0   4   3  10  25   1   3   7   0    71    0    0   2.284     76  0.14
  114  125 A   0   0   0   3   0   0   0  61   0   0   0   0   0   4   1   1   8  10  10   1    71    0    0   1.384     46  0.48
  115  126 A  35   0  55   0   8   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.965     32  0.76
  116  127 A  28   0  10   0   0   0   3   0  23   0   1  15  20   0   0   0   0   0   0   0    71    0    0   1.691     56  0.31
  117  128 A   0   0   0   0   0   0   4   0   0   0   0   0   0  96   0   0   0   0   0   0    71    0    0   0.175      5  0.93
  118  129 A   0   1   0   0   0   0   0   3   0   0   0   0   0   1  94   0   0   0   0   0    71    0    0   0.275      9  0.87
  119  130 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    71    0    0   0.000      0  1.00
  120  131 A   0  69  31   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.619     20  0.78
  121  132 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0    71    0    0   0.000      0  1.00
  122  133 A   0  27   0   0   0   0   0   0   3  66   0   0   4   0   0   0   0   0   0   0    71    0    0   0.860     28  0.41
  123  134 A   0   1   0   0   0   0   0   0   3   0   1   0   0   0   1   0   3  90   0   0    71    0    0   0.475     15  0.83
  124  135 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0    71    0    0   0.000      0  1.00
  125  136 A   1  63  13   0   0   0   0   0   3   0   0  20   0   0   0   0   0   0   0   0    71    0    0   1.032     34  0.52
  126  137 A   1  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    70    0    0   0.075      2  0.99
  127  138 A   0  77  10   4   1   0   7   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.807     26  0.78
  128  139 A   0   1   0   1   1   0   1   1   7   0   1   4   1   0   0   3   1   1   3  70    71    0    0   1.309     43  0.52
  129  140 A   1   0   0   0   0   0   0  24  11   0  10   4   0   3   8   4   1  17   3  13    71    0    0   2.176     72  0.28
  130  141 A   0   4   0   0   0   0   4   1   1   6  20   3   0   6  13   6   0   9  14  13    70    0    0   2.322     77  0.17
  131  142 A   0   4   0   1   3   0   1  28   1  11   4   7   0   1   1   3   0   3   3  27    71    0    0   2.112     70  0.25
  132  143 A   8   3   1   1   1   0   4   0   8   1   4  10   0   6   1   0   4   4  35   6    71    0    0   2.273     75  0.19
  133  144 A  16  63  17   0   0   0   0   0   0   3   1   0   0   0   0   0   0   0   0   0    70    0    0   1.047     34  0.68
  134  145 A   0   1   4   4   0   0   0   0   1   1   0   0   0   0   0  87   0   0   0   0    71    0    0   0.566     18  0.75
  135  146 A   4  23  72   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0    71    0    0   0.767     25  0.78
  136  147 A   0   1   3   0   0   0   0   1  17   0  40  19  19   0   0   0   0   0   0   0    70    0    0   1.517     50  0.40
  137  148 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0  99    70    0    0   0.075      2  0.98
  138  149 A   0   0   1   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    70    0    0   0.075      2  0.99
  139  150 A   0   0   0   0   0   0   0  99   0   0   0   0   1   0   0   0   0   0   0   0    70    0    0   0.075      2  0.98
  140  151 A   0  49   0   4  18   3  18   0   0   0   1   1   1   0   0   0   1   0   0   1    71    0    0   1.505     50  0.56
  141  152 A   0   0   0   0   1   0   0   1  44   0  49   1   1   0   0   0   0   0   0   1    71    0    0   1.011     33  0.55
  142  153 A   4   0   1   0   4   0   0   1   6   0   4  26   0   0   4  36   0   0  12   0    69    0    0   1.801     60  0.24
  143  154 A  25   7   6  12   1   0   3   3   0   0  19   6   1   0   7   4   1   3   0   1    69    0    0   2.310     77  0.15
  144  155 A   6   6   7   3  36   0   4   3   9   1  12   0   3   3   0   1   1   3   1   0    69    0    0   2.245     74  0.17
  145  156 A  10  13   3   3   1   0   1   4   1   3   1   3   0   1  25   6   6   9   1   7    69    0    0   2.491     83  0.09
  146  157 A   0   0   0   0   2   0   5   5   0   0   2   3   0  33   3   8  13   2  10  16    63    0    0   2.052     68  0.30
  147  158 A  11   7   4   0   0   0   0   7   0   0   4   0   0   7   7   4   4   4  36   7    28    0    0   2.145     71  0.15
  148  159 A   0   5   0   0   0   0   0  38   3   0   3   0   0   0  11   5   8   5  19   3    37    0    0   1.893     63  0.25
  149  160 A   0   5   0   0   0   0   0   3   5   8   8   0   0   0  41  10  10   8   0   3    39    0    0   1.917     63  0.24
  150  161 A   0   2   0   0   0   0   0  17   2   2   4   2   0   2   4   4   9  38   0  13    47    0    0   1.954     65  0.37
  151  162 A   9   0   0   0   2   0   0   9   3   3  20   3   0   2  27   8   3   5   0   6    64    0    0   2.199     73  0.15
  152  163 A   4  41   3   7   3   0   0   1   0   0   0   3   1   1   7  16  10   0   0   0    68    0    0   1.913     63  0.25
  153  164 A   0  49   1  13   1   1   0   0   0  17   4   4   1   0   3   0   0   3   0   0    69    0    0   1.642     54  0.31
  154  165 A   6   0   0   3   0   0   4   1   6   0   3   6   0   6   6  23   9   3  13  12    69    0    0   2.398     80  0.17
  155  166 A   0   0   0   0   0   0   0   4   1   0  17  48   0   0   6  22   1   0   0   0    69    0    0   1.413     47  0.37
  156  167 A   9   6   0  13  13   0   3   0  14   1   7  20   3   1   4   1   0   1   1   0    69    0    0   2.351     78  0.11
  157  168 A  19   0   0   1   0   1   1   0   1   0   0   0  76   0   0   0   0   0   0   0    70    0    0   0.766     25  0.61
  158  169 A   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   1    70    0    0   0.075      2  0.99
  159  170 A   0   0   0   0   1   0   0   0   0   0  20  77   0   0   0   1   0   0   0   0    71    0    0   0.638     21  0.68
  160  171 A   1  24   1   3   0   0   1   0   0  59   1   3   0   0   3   0   1   0   0   1    71    0    0   1.315     43  0.33
  161  172 A   0   1   0   0   0   0   0   7  24  31   3   0   4   0   0   1   4   6  14   4    71    0    0   1.952     65  0.29
  162  173 A   0   0   0   0   3   0  94   0   1   0   0   0   0   0   0   0   1   0   0   0    71    0    0   0.275      9  0.92
  163  174 A  32  10  24   0   1   3   0   1  18   1   1   1   4   0   0   0   0   0   1   0    71    0    0   1.841     61  0.34
  164  175 A   0   0   0   0   0   0   0   0  90   1   4   0   1   0   0   1   0   0   1   0    71    0    0   0.467     15  0.84
  165  176 A   0   0   0   0   0   0   0   0   0  99   1   0   0   0   0   0   0   0   0   0    71    0    0   0.074      2  0.98
  166  177 A   0   1   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0  97   0   0    71    0    0   0.148      4  0.94
  167  178 A  51  25  13   4   1   0   0   1   0   0   0   1   1   0   0   0   0   1   0   0    71    0    0   1.388     46  0.62
  168  179 A  11  70   6   1   8   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   1.044     34  0.78
  169  180 A   6  13   1   6   0   0   0   1   3   0  25   3   1   1   3  17   7   1   8   3    71    0    0   2.332     77  0.13
  170  181 A   0   0   0   1   0   0   0  18   3   0   6   1   1   1  34   7   8   8   8   1    71    0    0   2.054     68  0.23
  171  182 A   2   4   5   0   0   0   2   7   2   0   0   2   0   2  20  48   0   5   2   0    56    0    0   1.724     57  0.32
  172  183 A   0   6   0   0   0   0   3  12   4  12   1   1   0   0   0  16   4  35   3   3    69    0    0   2.028     67  0.24
  173  184 A   0   0   3   0  11   0  66   7   4   4   0   0   0   3   1   0   0   0   0   0    70    0    0   1.246     41  0.45
  174  185 A   1   1   0   0   1   0  13   0   4   0   0   3   0  24   4   1   6   1   6  33    70    0    0   1.975     65  0.24
  175  186 A   1   0   0   1   0   0   0  62  23   4   4   0   0   0   0   0   0   0   0   4    71    0    0   1.153     38  0.62
  176  187 A   0   7   0   0   1   0   1   0   3  17   3   1   1   0   3  34   7  21   0   0    71    0    0   1.911     63  0.21
  177  188 A   6   0  11   1   1   0   0   1  14  30   7   1   0   1   0  10   0  15   0   0    71    0    0   2.049     68  0.19
  178  189 A  44   3   1   0   0   0   0   3  42   0   7   0   0   0   0   0   0   0   0   0    71    0    0   1.174     39  0.44
  179  190 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    71    0    0   0.000      0  1.00
  180  191 A  51   7  27   4   0   4   0   0   0   0   0   0   4   0   0   0   0   0   3   0    71    0    0   1.386     46  0.56
  181  192 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.000      0  1.00
  182  193 A   0   0   0   0   0   0   0   0   4   0  89   6   1   0   0   0   0   0   0   0    71    0    0   0.462     15  0.83
  183  194 A   3  18   7   3   0   0   0   0   7   0   0   0  62   0   0   0   0   0   0   0    71    0    0   1.182     39  0.30
  184  195 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.000      0  1.00
  185  196 A  69   0  30   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.676     22  0.86
  186  197 A  30  10  39   0   0   0   0   0   0   0   0  20   1   0   0   0   0   0   0   0    71    0    0   1.336     44  0.54
  187  198 A   0  86   4   0   0   0   0   0   4   0   1   3   1   0   0   0   0   0   0   0    71    0    0   0.618     20  0.73
  188  199 A  10   0   3   0  11   0  63   0   0   0   0  13   0   0   0   0   0   0   0   0    71    0    0   1.126     37  0.51
  189  200 A  34   1  11   0   1   0   3   0  31   0   1   6   0   0   0   0   0  11   0   0    71    0    0   1.664     55  0.29
  190  201 A   0  24   1  70   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.783     26  0.89
  191  202 A  13  79   1   1   0   0   0   0   0   0   0   1   0   0   0   0   0   0   4   0    71    0    0   0.763     25  0.74
  192  203 A  18   0   3   1   0   0   4   0  44   0  10   3  17   0   0   0   0   0   0   0    71    0    0   1.596     53  0.33
  193  204 A   0   0   0   0   0   0   0  94   3   0   0   0   0   0   1   1   0   0   0   0    71    0    0   0.275      9  0.90
  194  205 A   4   0   4   0   1   0  15   0  17   0  10   3   0   1   6  10   1  24   1   1    71    0    0   2.219     74  0.08
  195  206 A   4  51   1   1   1   0  20   0   0  13   0   1   0   0   3   0   0   0   0   4    71    0    0   1.534     51  0.27
  196  207 A   0   1   0   0   3   0   0   0   1  94   0   0   0   0   0   0   0   0   0   0    71    0    0   0.275      9  0.86
  197  208 A   0   0   0   0  70  30   0   0   0   0   0   0   0   0   0   0   0   0   0   0    71    0    0   0.607     20  0.94
  198  209 A   0   0   0   0   0   0   7   0   0   0   8   0   0   0   3   1   0  37   1  42    71    0    0   1.348     45  0.48
  199  210 A   3   0   1   3   0   0   0  10   6   3   4   0   0   0   0   0  17   7   0  46    70    0    0   1.743     58  0.42
  200  211 A   1   0   0   0   0   0   0   0   7  46   1   9   0   0   9   3   1  13   1   9    70    0    0   1.786     59  0.32
  201  212 A   1   0   0   0   0   0   0   3   1   4  27  10   0   3   0   3   1  10  23  13    70    0    0   2.037     68  0.31
  202  213 A   4   3   7   4   1   0   6   1   6   6   1   3   0   1   1   0   3  11   1  39    70    0    0   2.233     74  0.20
  203  214 A   1   1   0   6   1   0   0   1   3  27  23   0   0   0   4   6   4   6  13   3    70    0    0   2.162     72  0.20
  204  215 A   3   3   4   1   0   0   3   0   6   3   4   3  22   0   6  17   3   9   3  10    69    0    0   2.463     82  0.05
  205  216 A   3  21  10  10   0   0   1   0   1   3   0   3   0   0   1   1  13   4  22   3    67    0    0   2.213     73  0.14
  206  217 A   0   7   7   0   2   0   0   0   5   0   0  33   0   2   5   2   2  30   2   2    43    0    0   1.909     63  0.14
  207  218 A   2   0  26   0  15   0  44   2   0   0   0   0   0   2   0   2   0   4   4   0    54    0    0   1.533     51  0.36
  208  219 A   2   8   3   0   2   0   3  10   3   0  17   3  10   0   5  10  15   7   2   0    60    0    0   2.470     82  0.07
  209  220 A   2  13   3   3   2   0   0   0   0   0   3   2   0   2  28  13   6   5   5  16    64    0    0   2.212     73  0.15
  210  221 A   0   3  39   0   1  28   6   0   3   0   1   0   1   0   4   6   1   4   0   0    67    0    0   1.800     60  0.13
  211  222 A   4  25   4  12   0   1   0   0   0   0   0   1   1   0   4  37   4   0   4   0    68    0    0   1.841     61  0.25
  212  223 A   1   4   9   1   0   0   3   7   6   0  17   6   0   0   1  14   4  17   3   4    69    0    0   2.419     80  0.14
  213  224 A  13   4  10   0   0   0   0   7   9   0   0   3   6   1   1  20   7   6  10   1    69    0    0   2.400     80  0.11
  214  225 A   3   0   1   0   1   0   3   7   1   0   7   1   0   1   6  29  20   4   3  10    69    0    0   2.211     73  0.23
  215  226 A   9   3   3   1   1   0  29  13   3   1   4  14   1   4   4   1   0   4   0   1    69    0    0   2.338     78  0.06
  216  227 A   2   2   0   2  12   0  24   3   2   2  21   6   0   2   2   6   5   5   3   5    66    0    0   2.346     78  0.06
  217  228 A   7  21  22   0  15   0   4   0   1   3   0   6   0   3   6   1   3   1   1   3    67    0    0   2.286     76  0.21
  218  229 A   1   1   6   0   4   0   1   0   1  43  10   9   0   1   0   1   7   3   7   0    67    0    0   1.991     66  0.22
  219  230 A   1   0   0   7   4   0   1   1   1  40   3   4   1   0   1   7   3   4   0  18    68    0    0   2.049     68  0.18
  220  231 A   2   2   2   0   2  46  23   0   2   7   0   2   2   4   0   0   0   2   4   2    56    0    0   1.769     59  0.27
  221  232 A  20   6   2   0   2   3   0   2   0   8   8   3   0   0   8  16   3   3   3  14    64    0    0   2.397     80  0.08
  222  233 A   0   0   0   0   1   1   7   4   0   0   4   3   0  22  14  29   3   4   1   4    69    0    0   2.095     69  0.21
  223  234 A  26  12  46   4   9   0   1   0   0   0   0   0   0   0   0   0   0   0   1   0    69    0    0   1.428     47  0.65
  224  235 A   0   0   0   0   0   0   0   0   0   3  62   4   0   1   0   0   1   0   3  25    68    0    0   1.113     37  0.50
  225  236 A   0   4   3   1   1   0   0   1   4   7  26   7   0   0   3  12   6   7   4  10    68    0    0   2.387     79  0.19
  226  237 A   0   6   0   3   0   0   0   3  16   3  10   3   0   1   0   0   3  25   9  18    68    0    0   2.143     71  0.28
  227  238 A   9   1   3   0   0   0   0   0  38  18   1   3  26   0   0   0   0   0   0   0    68    0    0   1.571     52  0.34
  228  239 A   1  21   6   0   3   0   0   0   0   0   1   0   3   0  18  35   9   3   0   0    68    0    0   1.815     60  0.18
  229  240 A   1   0   0   0   0   0   0   0  16   0  18   0   0   6   4   3   3   0  13  35    68    0    0   1.810     60  0.33
  230  241 A   1  85   1   0  10   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0    68    0    0   0.556     18  0.89
  231  242 A  12  53  35   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    68    0    0   0.956     31  0.73
  232  243 A   1   0   0   0   0   0   1   3   9   0  29   3   1  13  13  18   1   3   3   0    68    0    0   2.079     69  0.21
  233  244 A   0   0   1   0   0   1   0   3   0   0   1   0   1   9  35  40   6   1   0   0    68    0    0   1.529     51  0.47
  234  245 A   6  28  49  13   3   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0    68    0    0   1.307     43  0.66
  235  246 A   0  69   4   4  22   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    68    0    0   0.864     28  0.87
  236  247 A  49   3   4   3   0   0   0   0   4   0   0  13   0   0   1   1   1  10   4   4    68    0    0   1.797     59  0.31
  237  248 A  18   6   3   0   0   0   0   4  21  21   3   4   0   0   0   6   0  13   0   0    67    0    0   2.056     68  0.21
  238  249 A   0   3   0   0   0   0   0   3   0   0  12   4   1   0   0   1   1   1  28  44    68    0    0   1.562     52  0.45
  239  250 A   4   4   1   3   0   0   0   0   1  81   1   1   0   0   0   1   0   0   0   0    68    0    0   0.861     28  0.64
  240  251 A   4   1   1   3   1   0   0   9  13   1  29   4   1   0   6   6   0  15   0   3    68    0    0   2.250     75  0.23
  241  252 A   1   3   0   7   1   0   1   0  12   0   3   6   0   0   6  41   7   3   3   4    68    0    0   2.073     69  0.26
  242  253 A   0   0   1   0   0   0   0   0   0   0   0   0   0   0  97   1   0   0   0   0    67    0    0   0.155      5  0.95
  243  254 A   0  10  43   1   4   1   9   0  16  10   0   0   0   0   1   0   0   1   0   0    67    0    0   1.737     57  0.25
  244  255 A   0   0   3   0   0   0   0   4   1   0  13  67   0   0   0   0   0   3   4   3    67    0    0   1.192     39  0.54
  245  256 A   8  24  50   5   0   0   0   0   6   0   0   3   5   0   0   0   0   0   0   0    66    0    0   1.442     48  0.54
  246  257 A   1   3   0   0   1   0   0   0  12  28   9   1   0   1   4   3   4  25   0   4    67    0    0   2.053     68  0.25
  247  258 A   0   0   0   2   0   0   0   6   3   0   2   3   0   0   0   8  18  30   0  29    66    0    0   1.734     57  0.48
  248  259 A  12   2  71   0   0   0   0   0  14   0   2   0   0   0   0   0   0   0   0   0    66    0    0   0.896     29  0.66
  249  260 A   0  21   8   5   0   0   0   0   3   0   3   2   2   0  11  39   3   5   0   0    66    0    0   1.855     61  0.21
  250  261 A   0   2   0   0   0   2   0   0   3   0   6   5   0   2   5  26  11   8  24   9    66    0    0   2.092     69  0.31
  251  262 A   0   2   0   0   0   0   2   0   0   0   0   0   0  69   2   0   0   0   0  26    65    0    0   0.798     26  0.63
  252  263 A   2   0   0   0   0   2   0   0   2  58   2   0   0   3  20   5   2   5   0   2    65    0    0   1.412     47  0.44
  253  264 A   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0    64    0    0   0.080      2  1.00
  254  265 A   0  16  11   2  49   0  21   0   0   0   0   0   2   0   0   0   0   0   0   0    57    0    0   1.348     44  0.71
  255  266 A   4  24   2   0   0   0   0   6  12   0  10  14   0   0   0   8   8   0  12   0    50    0    0   2.137     71  0.10
  256  267 A   0   0   0   0   0   0   0   0   0   2   2   2   0   0   2  69   5   2  14   0    42    0    0   1.124     37  0.57
  257  268 A   6   0   0   0   0   0   3   0   0  23  16   3   0   0   0   3   0   0  35  10    31    0    0   1.733     57  0.18
  258  269 A   4  84   0   8   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    25    0    0   0.606     20  0.91
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     1    39    45     6 rAIDCPEn
     2    39    45     6 rAIDCPEn
     3    39    45     6 rAIDCPEn
     4    39    45     6 rAIDCPEn
     5    39    45     6 rAADCPEn
     6    39    45     6 rAIDCPEn
     7    23    23     6 rAVDCPEn
     8    39    45     6 kQQGAADs
     9    39    45     6 qAKECAEn
    10    39    57     6 kHANAAEt
    10   145   169     1 rFq
    11    39    68     6 kHPDAVNs
    11   145   180     1 rCk
    11   213   249     1 hWq
    11   217   254     1 tPw
    12    39    54     6 kHPDAVIs
    12   145   166     1 rCk
    12   213   235     1 rWq
    12   217   240     1 tPw
    13    39    58     7 gDNALTLDc
    13    46    72     5 rGVNICi
    13   193   224    13 gELIAITKQEKTSTk
    14    39    45     6 nYSDALVt
    14   145   157     1 lCg
    14   214   227     1 yAn
    15    37    54     8 kVLKHKMIGq
    16    37    49     8 kVLKHKMAEq
    16   209   229     1 sAd
    17    20    40     2 nGVs
    17    33    55     9 mARQQNVTTDm
    17   140   171     1 kKn
    17   198   230     2 tDFr
    18    18    29     1 dPs
    18    31    43     8 eEGVKELIEs
    18   137   157     1 nEd
    19    39    45     8 kIQSSKMDKk
    20    39    89     7 qLNPSSLQk
    21    39    41     4 kKIDEn
    21   132   138     2 sPRl
    21   145   153     1 lLh
    21   201   210     3 nFRKt
    22    23    33     2 gRKw
    22    36    48     5 kENMEDq
    23    39    72     8 nVDNQVRLSk
    23   169   210     1 sEg
    23   204   246     3 dGDNi
    23   214   259     1 sTt
    24    39    50     8 kIKNLDVVGk
    24   209   228     1 gVf
    25    39    41     4 kKIDEn
    25   132   138     2 sPRl
    25   145   153     1 lLh
    25   201   210     3 nFRKt
    26    32    32     4 eKIDEn
    26   125   129     2 aPRl
    26   138   144     1 vLh
    26   194   201     3 nFRKt
    27    39    41     4 nKIDEn
    27   132   138     2 tPRv
    27   145   153     1 lLh
    27   201   210     3 nFRKt
    28    39    66     9 aLSGNATRLPk
    28   145   181    29 nPQDELGEEIERNIHDKNFVKQKGLDAVGAd
    28   146   211     1 dNh
    28   170   236     1 sDg
    29    39    41     4 kKIDEn
    29   132   138     2 sPRv
    29   145   153     1 lLh
    29   201   210     3 nFRKt
    30    26    54     1 sLn
    30    39    68     4 rVEQVh
    30    46    79     1 sIh
    30   144   178     1 rVy
    30   213   248     1 tFn
    30   217   253     1 vLc
    31    39    41     4 kKIDEn
    31   132   138     2 tPRv
    31   145   153     5 fQSALLh
    31   201   214     3 nFRKt
    32    39    40     8 mIQQENLESq
    32   146   155     1 gAg
    33    26    33     2 gRTw
    33    39    48     5 kENMEDq
    34    38    56     3 kYTSv
    34   144   165     2 vPGq
    34   206   229     1 aNf
    35    26    32     2 gRKw
    35    39    47     5 kANMEEq
    36    39    41     4 kKIDEn
    36   132   138     2 tPRv
    36   145   153     1 lLh
    36   201   210     3 nFRKt
    37    39    40     4 rKIDEn
    37    67    72     6 wVILTPTh
    37   132   143     2 aPLl
    37   145   158     1 iLh
    37   201   215     3 nFRKt
    38    26    41     1 tPn
    38    39    55     7 gKDECFMEs
    38    46    69     3 sIQKr
    38   145   171     1 rFn
    38   204   231     3 iFQSr
    38   216   246     1 gAw
    39    38    47     2 kAYm
    39    45    56     4 eIHSLv
    40    39    40     4 hKIDEn
    40    67    72    13 sWLKLHPQVVLTPTh
    40   132   150     2 aPRl
    40   145   165     1 vLh
    40   201   222     3 nFRKt
    41    39    59     4 eKIDEn
    41   132   156     2 aPRl
    41   145   171    13 vLHSQPKSTVGTPAy
    41   158   197     1 dGk
    41   201   241     3 nFRKt
    42    26    33     2 gRKw
    42    39    48     5 qENMEDq
    43    39    40     4 eKIDEh
    43   112   117     4 sMIFMl
    43   113   122     1 lQq
    43   132   142     2 vPRv
    43   145   157     1 vLh
    43   201   214     3 nFRKt
    44    39    73     8 sAPADYLKKf
    44   145   187     2 mKIk
    45    15    31     1 dGv
    45    28    45     9 kKRKEETEKEy
    45    35    61     3 sEFCi
    45    57    86     1 nRw
    45   121   151     1 qTl
    45   134   165     1 rTq
    45   135   167     1 qWe
    45   159   192     1 tQh
    45   204   238     1 eTg
    46    39    50     1 kDt
    46    46    58     3 sEMTt
    47    37    70     8 rLRNDLDRAh
    47   205   246     1 rHg
    48    26    33     2 gRRw
    48    39    48     5 kENMEDq
    49    25    47     6 aLKGKETs
    49   118   146     3 dESKi
    49   197   228     1 eFd
    50    39    41     4 kKIDEn
    50   204   210     3 nFRKt
    51    38    52     5 eIIRLKq
    51    45    64     3 nENTi
    51   234   256     5 gNLKNGa
    52    38    52     5 eIIRLKq
    52    45    64     3 nENTi
    52   234   256     5 gNLKNGa
    53    39    41     9 sNYTTASEPAa
    53    46    57     4 qAEAAi
    53   113   128     1 sCn
    53   132   148     3 nDVHi
    53   166   185     6 rQHTVAGr
    54    39    61     6 vLRGKSDl
    54   132   160     3 dDARi
    54   145   176     1 ySd
    54   210   242     1 yEf
    54   214   247     1 pYw
    55    37    38     7 eLGSDYEKn
    55   130   138     3 nDLEv
    55   208   219     1 fDy
    55   212   224     1 eYw
    56    25    47     1 eCg
    56    38    61     6 gLSGKEDs
    56   131   160     3 vDSKi
    56   208   240     1 yEf
    56   212   245     1 pYw
    57    31    51     2 vRDg
    57    38    60     5 vRTEIGv
    57   124   151     3 lDAPl
    57   181   211     1 gFe
    57   202   233     1 yEf
    57   206   238     1 pWw
    58    37   256     4 kESLAg
    58    39   262     5 nNTRLPk
    58   145   373    36 dPADELSEDAEGRISDKDYIKRHGFDKVIPWQDGREGg
    58   170   434     1 sDg
    58   205   470     3 eGDNi
    58   215   483     1 sTp
    59    38    52     5 eIIRLKq
    59    45    64     3 nENTi
    59   234   256     5 gNLKNGa
    60    39    54     8 qIEKYRLHHq
    61    39    42     4 eKIDKn
    61    46    53     1 iNh
    61   132   140     2 aPRl
    61   192   202     3 nFRKt
    62    39    40     2 hAPa
    62    89    92     2 gRLd
    62   145   150     2 eGSt
    62   179   186     2 gICv
    62   207   216     1 lDy
    63    38    45     4 gGPEEf
    63    45    56     4 pRELQi
    63    67    82     1 gKi
    63   209   225     1 gVs
    64    39    50     4 kLRPTa
    64    78    93     2 gKDl
    64   145   162     2 lPGq
    64   152   171     1 gCt
    64   205   225     1 gRy
    65    39    50     4 kLRPTa
    65    78    93     2 gKDl
    65   145   162     2 lPGq
    65   152   171     1 gCt
    65   205   225     1 gQy
    66    37    59     5 rAKPTYq
    66    39    66     8 kYSPKEVEKk
    66    46    81     4 yREAAi
    66   132   171     3 dDSKl
    66   165   207     3 sKLTk
    66   200   245     1 nEi
    66   210   256     1 yHf
    66   214   261     1 pHw
    67    30    56     2 vRDg
    67    37    65     5 vRTEIGv
    67   123   156     3 lDAPl
    67   180   216     1 gFe
    67   201   238     1 yEf
    67   205   243     1 pWw
    68    39    46     8 eIQTVETARq
    68    90   105     1 gKf
    68   200   216     1 rEa
    69    37    38     1 rGl
    69    39    41     3 kIDEn
    69    66    71    33 gGEFPGVQPPAALGGGEFLFVFFFSSCWVIIHLGg
    69    67   105    13 gVFFFSPQVVLTPTh
    69   132   183     2 aPRl
    69   145   198     1 lLh
    69   201   255     3 nFRKt
    70    39    48     4 eGPEEf
    70    46    59     4 pRELQi
    70    68    85     1 gKi
    70   210   228     1 gVs
//