Complet list of 1y9m hssp fileClick here to see the 3D structure Complete list of 1y9m.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1Y9M
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-09-04
HEADER     Exo-inulinase, Aspergillus awamori, Gly 2004-12-28 1Y9M
COMPND     exo-inulinase; SUGAR (5-MER); SUGAR (2-MER)
SOURCE     Aspergillus awamori
AUTHOR     Nagem, R.A.P.; Rojas, A.L.; Golubev, A.M.; Korneeva, O.S.; Eneyskaya, 
SEQLENGTH   517
NCHAIN        1 chain(s) in 1Y9M data set
NALIGN       40
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : G7XL89_ASPKW        1.00  1.00    1  517   20  536  517    0    0  537  G7XL89     Exo-inulinase OS=Aspergillus kawachii (strain NBRC 4308) GN=AKAW_05812 PE=3 SV=1
    2 : Q96TU3_ASPAW1Y9G    1.00  1.00    1  517   20  536  517    0    0  537  Q96TU3     Exo-inulinase (Precursor) OS=Aspergillus awamori GN=inu1 PE=1 SV=1
    3 : A2R0E0_ASPNC        0.92  0.98    1  517   20  536  517    0    0  537  A2R0E0     Exo-inulinase inu1-Aspergillus niger (Precursor) OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=inu1 PE=3 SV=1
    4 : B6CAT0_ASPOZ        0.92  0.98    1  517   20  536  517    0    0  537  B6CAT0     Sucrose 1-fructosyl transferase OS=Aspergillus oryzae GN=1-SST PE=3 SV=1
    5 : E1ABX2_ASPFI        0.92  0.98    1  517   20  536  517    0    0  537  E1ABX2     Exo-inulinase OS=Aspergillus ficuum PE=3 SV=1
    6 : G3XWA9_ASPNA        0.92  0.98    1  517   20  536  517    0    0  537  G3XWA9     Inulinase OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) GN=inuE PE=3 SV=1
    7 : O42801_9EURO        0.92  0.98    1  517   20  536  517    0    0  537  O42801     Sucrose:Sucrose 1-Fructosyltransferase (Precursor) OS=Aspergillus foetidus PE=3 SV=1
    8 : Q0ZR33_ASPNG        0.92  0.98    1  517   20  536  517    0    0  537  Q0ZR33     Extracellular exo-inulinase OS=Aspergillus niger GN=InuE PE=3 SV=1
    9 : Q6S3E2_ASPNG        0.92  0.98    1  517   20  536  517    0    0  537  Q6S3E2     Exoinulinase OS=Aspergillus niger GN=inuF PE=3 SV=1
   10 : Q76HP6_ASPNG        0.92  0.98    1  517   20  536  517    0    0  537  Q76HP6     Exoinulinase OS=Aspergillus niger GN=inuE PE=3 SV=1
   11 : B6H982_PENCW        0.72  0.89    1  517   20  535  517    1    1  536  B6H982     Pc16g10410 protein OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=Pc16g10410 PE=3 SV=1
   12 : B6HIK8_PENCW        0.64  0.84    1  516   19  538  521    3    6  539  B6HIK8     Pc21g14720 protein (Precursor) OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=Pc21g14720 PE=3 SV=1
   13 : B8MHA6_TALSN        0.60  0.79    2  517   27  548  525    5   12  549  B8MHA6     Inulinase, putative OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_021420 PE=3 SV=1
   14 : N4U3J4_FUSOX        0.50  0.69    2  517   20  542  527    8   15  546  N4U3J4     Levanase OS=Fusarium oxysporum f. sp. cubense race 1 GN=FOC1_g10001260 PE=4 SV=1
   15 : N1RIZ1_FUSOX        0.48  0.69    2  517   20  542  527    8   15  546  N1RIZ1     Levanase OS=Fusarium oxysporum f. sp. cubense race 4 GN=FOC4_g10007767 PE=4 SV=1
   16 : B0Y174_ASPFC        0.46  0.61    2  517   27  702  679    6  166  703  B0Y174     Exoinulinase InuD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_048930 PE=3 SV=1
   17 : B8MJN8_TALSN        0.46  0.61    2  517   24  702  680    6  165  704  B8MJN8     Exoinulinase InuD OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_051740 PE=3 SV=1
   18 : G3GLJ6_PENJA        0.46  0.62    3  517   25  702  679    6  165  704  G3GLJ6     Exoinulinase OS=Penicillium janthinellum GN=inuA1 PE=2 SV=1
   19 : Q4WDS4_ASPFU        0.46  0.61    2  517   27  702  679    6  166  703  Q4WDS4     Exoinulinase InuD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_5G00480 PE=3 SV=1
   20 : A1D0V7_NEOFI        0.45  0.60    2  517   14  689  679    6  166  690  A1D0V7     Glycosyl hydrolase family protein OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_042050 PE=3 SV=1
   21 : Q8J0G1_9EURO        0.45  0.60    2  517   28  701  677    6  164  702  Q8J0G1     Exoinulinase (Precursor) OS=Penicillium sp. TN-88 GN=inuD PE=3 SV=1
   22 : K0E4E1_9EURO        0.43  0.58    2  517   27  702  676    5  160  703  K0E4E1     EcdE OS=Emericella rugulosa GN=ecdE PE=3 SV=1
   23 : F9F4X0_FUSOF        0.39  0.55    2  493   20  662  647    8  159  766  F9F4X0     Uncharacterized protein OS=Fusarium oxysporum (strain Fo5176) GN=FOXB_01445 PE=3 SV=1
   24 : J9N992_FUSO4        0.39  0.53    2  517   20  685  670    9  158  689  J9N992     Uncharacterized protein OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=FOXG_11757 PE=3 SV=1
   25 : A2TV74_9FLAO        0.38  0.60    3  517   33  513  517   11   38  514  A2TV74     Glycosyl hydrolase family 32 OS=Dokdonia donghaensis MED134 GN=MED134_10760 PE=3 SV=1
   26 : F4B1H9_KROS4        0.38  0.59    3  517   33  513  517   11   38  514  F4B1H9     Glycosyl hydrolase family 32 domain protein OS=Krokinobacter sp. (strain 4H-3-7-5) GN=Krodi_1434 PE=3 SV=1
   27 : K3VG00_FUSPC        0.38  0.54    2  517   20  685  670    9  158  689  K3VG00     Uncharacterized protein OS=Fusarium pseudograminearum (strain CS3096) GN=FPSE_08194 PE=3 SV=1
   28 : L5NCB4_9BACI        0.38  0.57    2  516   55  532  518   11   43  533  L5NCB4     Glycoside hydrolase OS=Halobacillus sp. BAB-2008 GN=D479_04248 PE=3 SV=1
   29 : C0BL85_9BACT        0.37  0.58    3  517   35  516  517    9   37  519  C0BL85     Levanase (Precursor) OS=Flavobacteria bacterium MS024-3C GN=Flav3CDRAFT_0996 PE=3 SV=1
   30 : I0BG73_9BACL        0.36  0.57    2  516    5  490  521   11   41  498  I0BG73     Protein SacC2 OS=Paenibacillus mucilaginosus K02 GN=B2K_11670 PE=3 SV=1
   31 : L8TXC1_9MICC        0.36  0.58    7  514   20  529  532   12   46  529  L8TXC1     Beta-fructosidase, levanase/invertase OS=Arthrobacter sp. SJCon GN=G205_01578 PE=3 SV=1
   32 : B2IK27_BEII9        0.35  0.53    2  517   26  702  683   11  173  705  B2IK27     Levanase (Precursor) OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_1319 PE=3 SV=1
   33 : E0RC65_PAEP6        0.35  0.55    3  517   23  522  532   15   49  527  E0RC65     Inulinase (2,1-beta-D-fructanfructanohydrolase) (Inulase) OS=Paenibacillus polymyxa (strain E681) GN=PPE_01473 PE=3 SV=1
   34 : F0M1F9_ARTPP        0.35  0.57    7  514   20  527  531   12   46  527  F0M1F9     Beta-fructosidase, levanase/invertase OS=Arthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) GN=Asphe3_30450 PE=3 SV=1
   35 : L8TTL6_9MICC        0.35  0.59    2  510   14  503  518   10   37  506  L8TTL6     Beta-fructosidase, levanase/invertase OS=Arthrobacter sp. SJCon GN=G205_00884 PE=3 SV=1
   36 : A1D0V0_NEOFI        0.34  0.47    2  516   23  874  854    7  341 1408  A1D0V0     Glycosyl hydrolase family protein OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_041980 PE=3 SV=1
   37 : Q45372_PAEPO        0.34  0.56    2  517    7  507  533   15   49  512  Q45372     Fructosyltransferase OS=Paenibacillus polymyxa GN=lelA PE=3 SV=1
   38 : B8MJN1_TALSN        0.33  0.46   59  517   35  540  587    8  209  573  B8MJN1     Putative uncharacterized protein OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_051670 PE=3 SV=1
   39 : B8HEB6_ARTCA        0.32  0.57    8  514   20  526  529   12   44  526  B8HEB6     Levanase OS=Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360) GN=Achl_2897 PE=3 SV=1
   40 : Q0UB15_PHANO        0.30  0.50    2  517   52  549  543   17   72  576  Q0UB15     Putative uncharacterized protein OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_11049 PE=3 SV=1
## ALIGNMENTS    1 -   40
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   20 A F              0   0  136   13    9  FFFFFFFFFFFL                            
     2   21 A N        +     0   0  107   32   68  NNNNNNNNNNNGSSSAS AASPSS  SE P T  STN  D
     3   22 A Y        +     0   0   19   37    6  YYYYYYYYYYYYYYYYYYYYYYYYFFYYYY YY LYY  Y
     4   23 A D        +     0   0  102   37   70  DDDDDDDDDDDTTTTTTTTTTTTTRRTDQL TR TNS  D
     5   24 A Q    >   -     0   0   30   37   32  QQQQQQQQQQQEEEEEEEEEEEEEEEEQEE EE DEE  G
     6   25 A P  T 3  S+     0   0  100   37   84  PPPPPPPPPPLPPDDPLLPLLVDDNNDSPK TT QLT  A
     7   26 A Y  T 3  S+     0   0   41   39   12  YYYYYYYYYYYYYYYYYYYYYYYYYYYFHYFFYFFYY  L
     8   27 A R    <   -     0   0    0   40    0  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
     9   28 A G        -     0   0    5   40   38  GGGGGGGGGGGPPPPPPPPPPPPPPPPPPSPPPPPPP PP
    10   29 A Q  S    S+     0   0   13   40   23  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAQQAARQ AQ
    11   30 A Y  S    S+     0   0    2   40   23  YYYYYYYYYYYYYYYFYYFYYYYYYYYFYFVFFIFYF LV
    12   31 A H  S    S-     0   0    3   40    0  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH
    13   32 A F        +     0   0    3   40    2  FFFFFFFFFFFFYFFFFFFFFFFFFFFYFFFYYFYFY YF
    14   33 A S        -     0   0    1   40   45  SSSSSSSSSSSSSTTSTTSSTSTTTTTTTTTTSTTTS TS
    15   34 A P        -     0   0    0   40   15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAPPAAPP AP
    16   35 A Q  S    S-     0   0   60   40   72  QQQQQQQQQQQKAAAESPEEAKAAPPAAKPRAEREAE RP
    17   36 A K  S    S+     0   0  113   40   56  KKKKKKKKKKDEKKKKIQKKQEKKTTKEEADKKDRKK DN
    18   37 A N  E    S-a  327   0A  19   40   36  NNNNNNNNNNNNNNNNNNNNNNNNMMNNKNTNNTNNN TG
    19   38 A W  E     -a  328   0A   0   40    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WF
    20   39 A M  E     +B   39   0B   0   40    3  MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMLMMLLMM LM
    21   40 A N  E     +     0   0B   6   40    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NN
    22   41 A D  E    S-     0   0B   6   40    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD
    23   42 A P  E     -B   37   0B   5   40    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP
    24   43 A N  E     +B   36   0B   1   40    7  NNNNNNNNNNSSNNNNNNNNNNNNNNNNNNNNNNNNN NN
    25   44 A G  E     -     0   0B   1   40    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
    26   45 A L  E     +     0   0B   3   40    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLMLMLLLLLLL LM
    27   46 A L  E     -Bc  34 300B   4   40   31  LLLLLLLLLLLLVIIVLLVVLVIILLIVVVVVVVVLV VF
    28   47 A Y  E     +B   33   0B  73   40    7  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFYYYYYY YV
    29   48 A H  E >   -B   32   0B  49   40   65  HHHHHHHHHHHHDHHdCHddAdHHHHHYYWHYYYLHF Yd
    30   49 A N  T 3  S-     0   0  122   40   56  NNNNNNNNNNNSNKKeKKeeDeKKNNKEKDDGEGNNE Gn
    31   50 A G  T 3  S+     0   0   25   40    7  GGGGGGGGGGEGCGGGGGGGGGGGGGGGGGGGGGGGG GG
    32   51 A T  E <   -B   29   0B  25   40   76  TTTTTTTTTTITTKKVIIVVTIKKTTKELELKELTVE QT
    33   52 A Y  E     -BD  28  56B  42   40    0  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY
    34   53 A H  E     -BD  27  55B   4   40    0  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH
    35   54 A L  E     + D   0  54B   0   40    6  LLLLLLLLLLLLLMMLLLLLMIMMLLMLLLLLLLLLL LL
    36   55 A F  E     -BD  24  53B   2   40    3  FFFFFFFFFFFFYYYYFYYYYYYYFFYFFFFFFFFYF FY
    37   56 A F  E     -BD  23  52B   0   40    3  FFFFFFFFFFFFYFFFYYFFYFFFYYFYYYFYYFYYY YY
    38   57 A Q  E     + D   0  51B   4   40    0  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ
    39   58 A Y  E     -BD  20  50B  12   40   36  YYYYYYYYYYYYYYYYYYYYYYYYHHYYYYNYHNHYH HY
    40   59 A N    >   -     0   0    9   40   32  NNNNNNNNNNNNNNNNNNNNNNNNYYNNYHNNTNNNT NN
    41   60 A P  T 3  S+     0   0   22   40    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPpPPPp PP
    42   61 A G  T 3  S+     0   0   50   40   70  GGGGGGGGGGSGGTTGGGGGGGTTEETEEGYNtYFGt FT
    43   62 A G    <   -     0   0   19   40   22  GGGGGGGGGGGGGGGGGGGGGGGGDDGGDGGGQGGGQ GA
    44   63 A I  S    S+     0   0   46   40   83  IIIIIIIIIIISDDDTTTTTNTDDIIDDITNMPSADP NN
    45   64 A E  S    S-     0   0   73   40   77  EEEEEEEEEEQATVVTTTTTTTVVVVVQVTVTDVDTD VI
    46   65 A W  S    S+     0   0  107   40   12  WWWWWWWWWWWWWWWWWWWWWWWWWWWFWWWWFWWWF WA
    47   66 A G        +     0   0   12   40    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
    48   67 A N  S    S-     0   0   48   40   53  NNNNNNNNNNNNANNAAAAAAANNPPNNPPNDRNNAN NN
    49   68 A I        +     0   0    0   40   37  IIIIIIIIIILMMIIMMMMMMMIIMMIMMMMMMMMMM MQ
    50   69 A S  E     -D   39   0B   0   40   42  SSSSSSSSSSSSSSSSSSSSSSSSHHSSHHSSHSSSH SH
    51   70 A W  E     -DE  38  69B   1   40    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WW
    52   71 A G  E     -D   37   0B   2   40    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
    53   72 A H  E     +DE  36  65B   4   40    0  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH
    54   73 A A  E     -DE  35  64B   0   40    0  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA
    55   74 A I  E     +DE  34  63B  34   40   40  IITTTTTTTTTTTVVTTTTTTTVVTTVTTVTVVTTTV TT
    56   75 A S  E     -D   33   0B   5   40    0  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SS
    57   76 A E  S    S+     0   0  148   40   70  EEEEEEEEEEKRSDDKRRKRERDNKKDKTTRTKRPNK RD
    58   77 A D  S    S-     0   0   48   40    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD
    59   78 A L  S    S+     0   0    2   41   14  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTLLLLLLLG
    60   79 A T  S    S+     0   0    0   41   67  TTTTTTTTTTTITMMMTTMMTMMMIIMVLTLVVLLTVTLY
    61   80 A H  S    S-     0   0   73   41   34  HHHHHHHHHHHHHRRHHHHHHHRRSSRHHHHHHHHHHHHT
    62   81 A W        -     0   0   20   41    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    63   82 A E  E     -E   55   0B 104   41   59  EEEEEEEEEEEDKKKTEETTKTKKEEKKEETTDTEKTKTT
    64   83 A E  E     -E   54   0B  42   41   26  EEEEEEEEEEEEEEEEHQEEEEEEHHEEHHEEEEEHEEEN
    65   84 A K  E     -E   53   0B  57   41   71  KKQQQQQQQQQRQLLHHQHHQHLLKKLEKLHMLHQQLQHQ
    66   85 A P  E    S-     0   0B  84   41    5  PPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPPPPPPPPPP
    67   86 A V  E     -     0   0B  52   41   22  VVVVVVVVVVVVVVVVIIVVVVVVIIVVIMVIPVVVPVVI
    68   87 A A  E    S+     0   0B  10   41    0  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
    69   88 A L  E    S-E   51   0B   6   41   18  LLLLLLLLLLLLLLLLLLLLLLLLLLLMLLILIIILIFII
    70   89 A L        -     0   0   84   41   92  LLLLLLLLLLLLLNNRELRRLRNNYYNTFKANPAPLPLAF
    71   90 A A    >   -     0   0    2   41   45  AAAAAAAAAAAAAAAAAAAAAAAAPPAPPPCVPCCAPACP
    72   91 A R  B 3  S+F   80   0C  78   41   86  RRRRRRRRRRRRRFFKRRKKRRFFDDFDDDDEGDDRGRDG
    73   92 A G  T >  S+     0   0   32   41   54  GGGGGGGGGGGGGNNGGGGGGGNNEEKEQREKEEEGEGEG
    74   93 A F  T <   +     0   0   76   41   88  FFYYYYYYYYHYFSSFFYFFYFSSLLSNHHTYDEQYDYEP
    75   94 A G  T 3  S+     0   0   76   41   56  GGGGGGGGGGSPPPPPPPPPPPPPGGPGGGEAGEEPGPET
    76   95 A S  S <  S-     0   0   90   41   79  SSSSSSSSSSGDDAADNNDDNDAALLAMYQDPADADANDE
    77   96 A D        -     0   0  143   41   79  DDDDDDDDDDNTDggNNNNNNNggIIgIIIIgIIININIG
    78   97 A V        +     0   0   22   29   37  VVVVVVVVVVVVIllIIIIIIIll..l....v...I.S..
    79   98 A T        +     0   0   44   29   39  TTTTTTTTTTTTTKNTTTTTTTNN..N....T...S.T..
    80   99 A E  B     -F   72   0C  10   29    5  EEEEEEEEEEEEEEEEEEEEEEEE..E....Q...E.E..
    81  100 A M  E     -G  112   0D  22   29    5  MMMMMMMMMMMMMLLMMMMMMMLL..L....M...M.M..
    82  101 A Y  E     -G  111   0D   7   30   12  YYYYYYYYYYYYFYYFFFFFFFYY..Y....F...F.F.I
    83  102 A F  E     -     0   0D  22   41    2  FFFFFFFFFFFFFYYFFFFFFFYYFFYFFFFWFFFFFFFF
    84  103 A S  E    S+     0   0D   5   41    7  SSSSSSSSSSTTSSSSSSSSSSSSSSSSSSSSSSSSSSSS
    85  104 A G  E     -G  109   0D  11   41    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    86  105 A S  E     -G  108   0D   4   41   21  SSSSSSSSSSSSSSSTSSTTSTSSSSSSSCSSSSSSSNSS
    87  106 A A  E     -G  107   0D   0   41   44  AAAAAAAAAAAAVAAVAVVVAVAAAATIAAVAAVAAAVVS
    88  107 A V  E     -G  106   0D   5   41    2  VVVVVVVVVVIVVVVVVVVVVVVVVVVIVVVVVVVVVVVV
    89  108 A A  E     -G  105   0D  21   41   69  AAAAAAAAAAVAISSIAAIIIVSSMMSAVVVVVVFAVIVV
    90  109 A D    >   +     0   0    1   40    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD
    91  110 A V  T 3  S+     0   0   83   41   90  VVVVVVVVVVMVEDDEVVEEEEDDIIDEFWHSKHEPKDHA
    92  111 A N  T 3  S-     0   0  123   41   66  NNNNNNNNNNNNRAARDDRRHSAAHHANEEGNNGHDNEGN
    93  112 A N    X   +     0   0   62   41   36  NNNNNNNNNNNNNLLNNNNNNNLLNNMNNDNNNNNNNHNN
    94  113 A T  T 3  S+     0   0   40   41   17  TTTTTTTTTTTTTTTTTTTTTTTTTTAKTSTTTTTTTNTT
    95  114 A S  T 3  S-     0   0    1   41    8  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSTSS
    96  115 A G  S <  S+     0   0   49   41    3  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG
    97  116 A F        +     0   0   24   41   16  FFFFFFFFFFFFFLLFFFFFFFLLLLLLLFFLFLLFFGFF
    98  117 A G        -     0   0   20   40   43  GGGGGGGGGGRGGGGGGGGGGGGGGGGFG.GGFGGGFFGF
    99  118 A K  B >   -K  102   0E 130   40   78  KKKKKKKKKKKVSDDRHHRRKRDDTTHPT.TTNTTTDGTP
   100  119 A D  T 3  S-     0   0  165   40   67  DDDDDDDDDDDDDGGNNSNNKKGGKKGDI.ATEPANEKAN
   101  120 A G  T 3  S+     0   0   83   40   58  GGGGGGGGGGRGGKKGGGGGGGKKDDKGE.DTEDAGEGEQ
   102  121 A K  B <   -K   99   0E  84   39   65  KKKKKKKKKKKKKRRKKKKKKKRRNNR.N.ANGANSGHST
   103  122 A T        -     0   0   51   39   66  TTTTTTTTTTTVIPPTTTTTAVPPPPP.P.PPSPPISAPN
   104  123 A P        -     0   0    0   39   29  PPPPPPPPPPPPPPPPPPPPPPPPPPP.A.APGAPPGPAG
   105  124 A L  E     -GH  89 137D   4   39   32  LLLLLLLLLLILWLLWLLWWWWLLMML.M.LMLLLFLWLV
   106  125 A V  E     -GH  88 136D   1   40    7  VVVVVVVVVVVVIVVVVVVVIVVVVVV.VFVVVVVVVVVV
   107  126 A A  E     -GH  87 135D   0   40    3  AAAAAAAAAAAASAAAAAAAAAAAAAA.AAAAAAAAAAAA
   108  127 A M  E     +GH  86 134D   2   39   43  MMMMMMMMMMMMMVVMMMMMMIVVI.V.IGIIIIIMIMIV
   109  128 A Y  E     -GH  85 133D   0   39    8  YYYYYYYYYYYYYYYYYYYYYYYYF.Y.FSYYYYYYYYYY
   110  129 A T  E     - H   0 132D   0   39    5  TTTTTTTTTTTTTTTTTTTTTTTTT.T.TPTTTTTTTTTT
   111  130 A S  E     -GH  82 131D   0   38   30  SSSSSSSSSSSSSSSSSSSSSSSSY.S.YGSSNSSSNSS.
   112  131 A Y  E     -GH  81 130D  39   38   76  YYYYYYYYYYFMSHHYYYYYYYHHH.H.HLAYEAAYEFA.
   113  132 A Y  E     - H   0 129D   1   39   41  YYYYYYYYYYIYYYYYYYYYYYYYLIY.LVYYGYYYGYF.
   114  133 A P  S    S+     0   0   33   38   70  PPPPPPPPPP.PPTTPPPPPPPTTMFT.MAKPNKSPNPK.
   115  134 A V  S    S-     0   0   69   39   88  VVVVVVVVVVLVVSSMIYMMTMSSDTS.EVAQRAHGKSA.
   116  135 A A        +     0   0   58   40   62  AAAAAAAAAAAAEDDEAAEEAEDDGYDEGFAAAAASSHG.
   117  136 A Q  E     -L  125   0F  43   37   61  QQQQQQQQQQQQQMMQQQQQQQMMKHMGET.LQ.SRQQ..
   118  137 A T  E     -L  124   0F  99   34   66  TTTTTTTTTTTDVTTVTTVVVVTTKLTGKH.T...N.V..
   119  138 A L    >   -     0   0   16   33   18  LLLLLLLLLLLLLLLLLLLLLLLLAMLL.A.L...L.L..
   120  139 A P  T 3  S+     0   0  106   33   35  PPPPPPPPPPPPPPPPPPPPPPPPGEPI.D.A...P.P..
   121  140 A S  T 3  S-     0   0   33   33   32  SSSSSSSSSSSSSSSSSSSSSSSSRGSA.Q.N...S.S..
   122  141 A G  S <  S+     0   0   51   32   51  GGGGGGGGGGGGGNNGGGGGGGNN.EKF.H.G...G.G..
   123  142 A Q        -     0   0   56   32   57  QQQQQQQQQQKKKKKKKKKKKKKK.KKY.P.T...K.K..
   124  143 A T  E     -L  118   0F 102   37   77  TTTTTTTTTTTHQSSRKTRRQRSS.ATTADSS.S.S.QSV
   125  144 A V  E     -L  117   0F   2   38   53  VVVVVVVVVVIVVVVVVVVVVVVV.GVSGTEV.EPV.VGN
   126  145 A Q    >   -     0   0  102   40   64  QQQQQQQQQQQRRRRKQQKKRRRR.RRAKDHQPHLNPRHR
   127  146 A E  T 3  S+     0   0  117   41   73  EEEEEEEEEEEAATTTKATTDKTTKKAGTRHAGNAGGDAP
   128  147 A D  T 3  S+     0   0   56   41   51  DDDDDDDDDDNENGGNDNNNNDGGDDGDDPGGKGGGKQGE
   129  148 A Q  E <   -H  113   0D   6   41   67  QQQQQQQQQQQQQQQQQQQQQQQQFFQVYRTTPTRQPQTD
   130  149 A Q  E     +H  112   0D  12   41   12  QQQQQQQQQQQQQEEQQQQQQQEEQQEQQQQQQQQQQQQQ
   131  150 A S  E     -H  111   0D   0   41   62  SSSSSSSSSSASGSSAAAAAAASSTTSDTRAAVAAAVAAT
   132  151 A Q  E     +HI 110 154D   0   41    0  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
   133  152 A S  E     -H  109   0D   0   41   22  SSSSSSSSSSSSSSSSSSSSSSSSGGSRGSSSSSSSSSSH
   134  153 A I  E     -H  108   0D   0   41   12  IIIIIIIIIIIIIIIIIIIIIIIIIIIIILLIILLIIILI
   135  154 A A  E     -HJ 107 146D   0   41    0  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   136  155 A Y  E     -HJ 106 145D  45   41    1  YYYYYYYYYYYYYFFYYYYYYYFFYYFYYYYYYYYYYYFY
   137  156 A S  E     -H  105   0D   2   41    0  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   138  157 A L  S    S+     0   0   56   40   55  LLLLLLLLLLLLLTTLLLLLLLTTLLTTLLTLRTLLKLT.
   139  158 A D  S >  S-     0   0   58   40    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
   140  159 A D  T 3  S-     0   0   46   40   62  DDDDDDDDDDDEQNNRDDRKHKDNEENKGKAQKGEEKHG.
   141  160 A G  T 3  S+     0   0    0   40    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG.
   142  161 A L  S <  S+     0   0   70   40   71  LLLLLLLLLLMEELLMMMMMTMLLEELRDRMTRMRIRAM.
   143  162 A T  S    S-     0   0   83   41   29  TTTTTTTTTTTTTSSTTTTTTTSSTTSTSTTTTTTTTTTH
   144  163 A W        -     0   0   29   40   11  WWWWWWWWWWXWWWWWWWWWWWWWWWWWWWWWWWWWWWWD
   145  164 A T  E     -J  136   0D  70   41   41  TTTTTTTTTTTTTTTTIVTTTTTTKKTTETHTTRTTTTSG
   146  165 A T  E     -J  135   0D  18   41   66  TTTTTTTTTTTTTEETTTTTTTEEKKEKMMKQKKKTKTKG
   147  166 A Y    >>  +     0   0   49   40    0  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY.YYYYY
   148  167 A D  T 34  +     0   0   62   33   48  DDDDDDDDDDDDDPPDDDDDDD..S....DR.ER.DEDAT
   149  168 A A  T 34 S+     0   0   76   37   65  AAAAAAAAAANAEDDAVSAAEAPPG.P..GNSGG.AGDGF
   150  169 A A  T <4 S+     0   0   32   37   59  AAAAAAAAAASEANNAAAAAAADDN.D..NNGNN.ANGNT
   151  170 A N     <  +     0   0    9   37   53  NNNNNNNNNNNNNPPNNNNNNNNNP.N..PPDPP.NPNPK
   152  171 A P        -     0   0    1   36   51  PPPPPPPPPPPPP.VPPPPPPPPPV.P..VVPVV.PVPVY
   153  172 A V  S    S+     0   0   21   37   30  VVVVVVVVVVVVIVIVVVVVVVVVI.V..LLILL.VLILE
   154  173 A I  B    S+I  132   0D  10   38   50  IIIIIIIIIIIIIILIIIIIIIIISSI..SAIFT.IFISA
   155  174 A P        +     0   0   33   41   88  PPPPPPPPPPHHLLEALSAALALLNGLEQHRQPRHLPLRN
   156  175 A N  S    S-     0   0   90   38   54  NNNNNNNNNNNNEEPEDDEDDEEEDNEGEENL..QN.DNP
   157  176 A P        -     0   0    5   36   35  PPPPPPPPPPPPPPPPPPPPPPPP.PPNN.SP..GP.PSV
   158  177 A P    >   -     0   0   12   36   34  PPPPPPPPPPPPPPSPPPPPPPPP.VPPP.AP..NP.PAI
   159  178 A S  T 3  S+     0   0   86   36   78  SSQQQQQQQQASASQTAATAAASS.ISVV.HS..PA.SHA
   160  179 A P  T 3  S+     0   0   91   35   66  PPPPPPPPPPPPQQ.PPTPPPPQQ.GQVI.FP..VP.PFP
   161  180 A Y    X   +     0   0   56   36   60  YYYYYYYYYYYYYYYYYYYYYYYY.NYPG.RY..LY.YRG
   162  181 A E  G >   +     0   0  101   36   61  EEQQQQQQQQQEQAAESSEQQHAA.EANN.DQ..DA.QDG
   163  182 A A  G 3  S+     0   0   78   39   65  AAAAAAAAAADDDDDDDDDDDDDDGGDPP.PDM.RDTDPT
   164  183 A E  G X   +     0   0   39   41   48  EEQQQQQQQQQEQEEQQQQQQQEENNQDGQKQENAQDQKN
   165  184 A Y  T <  S+     0   0   55   41   68  YYYYYYYYYYYFWYYYFFYYFHYYIIYIILVFTSSWTYVP
   166  185 A Q  T 3  S+     0   0   75   41   86  QQQQQQQQQQKIELLTLLTLLLLLKKLEKTFQLAARLLFT
   167  186 A N  S <  S+     0   0   34   41   46  NNNNNNNNNNENNNNEDNEEDENNDDNDDDRNDHDDDDRQ
   168  187 A F        +     0   0    0   41    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFYFFFFFFFYF
   169  188 A R  E     +M  187   0G  20   41   11  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRERRRRRRRER
   170  189 A D  E     -     0   0G   8   40    3  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDGD
   171  190 A P  E     -     0   0G   1   40    5  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP.PPPPPPPDP
   172  191 A F  E     -M  185   0G  18   40   93  FFFFFFFFFFFFNFFSNNSSNSFFKKFKKK.KKKKFKNNK
   173  192 A V  E     +M  184   0G   1   40    9  VVVVVVVVVVVVVVVVVIVVIVVVVVVVVV.VVVVVVIgV
   174  193 A F  E     -M  183   0G  13   40   16  FFFFFFFFFFFFFFFFFFFFFFFFFMFVFF.FFFFFIFyI
   175  194 A W  E     -M  182   0G  67   39    0  WWWWWWWWWWXWWWWWWWWWWWWWWWWWWW.WWRWWWWWW
   176  195 A H  E  >> -M  181   0G   6   40   50  HHHHHHHHHHHHHYYHHHHHHHYYDHYHNY.YHYYHHYVY
   177  196 A D  T  45S+     0   0  102   41   48  DDDDDDDDDDKDEGGDENDEQVGGDDGEEAGADDDEDEME
   178  197 A E  T  45S+     0   0  121   41   61  EEEEEEEEEEEDQPPEPPEEPEPPNDPEKPgPEggPEPAG
   179  198 A S  T  45S-     0   0   45   37   59  SSSSSSSSSSSTTSSTTTTTITSSTTSST.gE.geT.I.T
   180  199 A Q  T  <5 +     0   0  111   37   69  QQQQHQQQQHEQQKKHKKHRRSKKEQKEN.TK.VSQ.E.E
   181  200 A K  E    > - N   0 193G   0   40   62  IIIIIIIIIILVLLLLLLLLLLLLALLA.IELLEELLSEY
   189  208 A A  G > 5S+     0   0    0   40   35  AAAAAAAAAAAAAPPAAAAAAAPPGVP.VAAAAAAAAQAP
   190  209 A E  G 3 5S+     0   0   90   40   77  EEEEEEEEEEVANKKKKEKKKKKKDAQ.AAQAVQVQVNQI
   191  210 A L  G < 5S-     0   0   53   41   77  LLLLLLLLLLIIILLLVLLLLLLLHGLGGGHLRHQLRFQD
   192  211 A H  T < 5 +     0   0   37   41   51  HHHHHHHHHHHHHHHHHHHHHHHHADHKDDQHEQRHDIQF
   193  212 A K  E   < -N  188   0G  32   41   26  KKKKKKKKKKKKKKKKKKKKKKKKKHKKHRKKRKQKRSKK
   194  213 A L  E     -NO 187 211G   0   41   39  LLLLLLLLLLFILLLILLIILILLFALVLVVVVVVLVSVI
   195  214 A A  E     -NO 186 210G   0   40   74  AAAAAAAAAAVLLLLLLLLLLLLL.KLMQLVVEVVLESVG
   196  215 A I  E     -NO 185 209G   0   40   26  IIIIIIIIIIIIIIIIIIIIIIII.FIFIFFLFILIFYLI
   197  216 A Y  E     -NO 184 207G  13   41    7  YYYYYYYYYYYFYYYYYYYYYYYYYYYYWYYYYYYYYIYF
   198  217 A T  E     +NO 183 206G   5   41   54  TTTTTTTTTTTSTTTTATTTTTTTSSTGGTRSTRRTTHRS
   199  218 A S  E     -N  182   0G   4   41    3  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSS
   200  219 A D  S    S+     0   0   98   41   69  DDDDDDDDDDDDPKKRKKRRTQKKPPKKEPDKPDAPPQEP
   201  220 A N  S    S-     0   0   33   41   26  NNNNNNNNNNNNNNNDDDDDNDNNNNNNNDDDNDDNNSNN
   202  221 A L  S    S+     0   0    1   41    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   203  222 A K  S    S+     0   0   55   41   40  KKKKKKKKKKKKKTTKKKKKKKTTKKTVIKKKRKKKKKKI
   204  223 A D  S    S-     0   0  116   41   61  DDDDDDDDDDDEEAAHNSHHQQAANDADDATQESSEEQAD
   205  224 A W        -     0   0   39   40    0  WWWWWWWWWWXWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   206  225 A K  E     -O  198   0G 124   41   69  KKKKKKKKKKKSTEEDTTDDDDEETTEENADTSEETSNDK
   207  226 A L  E     +O  197   0G  73   41   59  LLLLLLLLLLLFLHHLLPLLLWHHLLHYKYFFFFYYFLFP
   208  227 A V  E     -     0   0G  38   41   67  VVVVVVVVVVAIVVVAAAAAEVVVMMVLQALMALLTAELE
   209  228 A S  E     -O  196   0G  17   41    0  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   210  229 A E  E     -O  195   0G  70   41   18  EEEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEKETEEEEN
   211  230 A F  E     -O  194   0G   7   41    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   212  231 A G        -     0   0   15   41    3  GGGGGGGGGGGGGGGGGGGGGGGGggGGggGGgGGGgGGS
   213  232 A P        +     0   0   49   41   40  PPPPPPPPPPPPPPPPPPPPPPPPnnPNnePPdPPPdPPH
   214  233 A Y        -     0   0   94   41   82  YYYYYYYYYYYYLVVAVVAAFAVVIIVVQEVAIAAMIFAY
   215  234 A N  S    S+     0   0    1   41   32  NNNNNNNNNNNNNNNNNNNNNNNNGGNGGGNNqNNNpNNG
   216  235 A A        +     0   0    3   41   25  AAAAAAAAAAAAAAAAAAAAAAAAAAAAASAEiAAAiAAV
   217  236 A Q        +     0   0   46   41   78  QQQQQQQQQQQVVVVVVVVVVVVVHHVQHHDSHDTVHVDV
   218  237 A G  S    S+     0   0   50   41   35  GGGGGGGGGGGGGGGGGGGGGGGGGGGDGDQIRAGGRGAG
   219  238 A G  S    S-     0   0    8   41    8  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGL
   220  239 A V  E     -P  246   0H  24   41   62  VVVVVVVVVVVVQQQVVVVVNVQQVVQVVVEAIEVVINEQ
   221  240 A W  E     +P  245   0H   0   41    3  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWFWWWFWWY
   222  241 A E  E     +P  244   0H  22   41    0  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
   223  242 A C  E     -     0   0H  12   41    5  CCCCCCCCCCCCCCCCCCCCCCCCCCCTCCCCCCCCCCCC
   224  243 A P  E     +     0   0H   7   41    3  PPPPPPPPPPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   225  244 A G  E     -P  242   0H   2   41   56  GGGGGGGGGGGNSSSSNNSSNSSSDDSEDDDDDDDSDNDN
   226  245 A L  E     +P  241   0H   5   41   17  LLLLLLLLLLLLLLLILIIIIILLLLLLLLLLILLIILLL
   227  246 A V  E     -P  240   0H  21   41   17  VVFFFFFFFFFFFFFFFFFFFFFFFFFFFIFFFFFFFFFV
   228  247 A K  E     -P  239   0H  60   41   68  KKKKKKKKKKQQPQQPPPPPPPQQPPQESEPPQPEPRTPE
   229  248 A L  E     -P  238   0H   0   41    8  LLLLLLLLLLLMLLLLLMLLLLLLLLLLFLLLILLLILLM
   230  249 A P  E     -P  237   0H  14   41   51  PPPPPPPPPPPPPPPSPSSAPTPPKEPPTPAPQAPAQHAP
   231  250 A L  B >   -t  339   0I  22   41   31  LLLLLLLLLLLVVVVLVVLLVLVVVVVVDVVVVVVLVVVV
   232  251 A D  T 3  S-     0   0   61   41   13  DDDDDDDDDDDENDDDDDDDDDDDEEDDEDDDDDDDDDDH
   233  252 A S  T 3  S+     0   0  127   41   28  SSGGGGGGGGRgnggGgdGGgGggGGggTGggegGgeggG
   234  253 A G  S <  S-     0   0   53   39   77  GGGGGGGGGGGpekkSkdSSkSkkSSkeSQptpq.eldp.
   235  254 A N  S    S+     0   0  169   40   63  NNSSSSSSSSKSSSSKNNKKSQSSDDSEGADSNENANSD.
   236  255 A S        -     0   0   69   40   78  SSSSSSSSSSSTNRRKNNKKKQRREERDADNNTDPETKN.
   237  256 A T  E     -P  230   0H  42   40   55  TTTTTTTTTTTKITTTVVTTVDTTTTTTERVITIRTTVI.
   238  257 A K  E     -P  229   0H  34   41   20  KKKKKKKKKKKKKKKKKKKKKKKKKKKRKTKKKKDKKEKN
   239  258 A W  E     -PQ 228 263H  23   40   16  WWWWWWWWWWXWWWWFWWFFWWWWWWWWWRWWWWTWWWWS
   240  259 A V  E     -PQ 227 262H   0   41   25  VVVVVVVVVVIVVVVVVVVVVVVVVVVVVWVVIVRVIVVT
   241  260 A I  E     -PQ 226 261H   1   41   46  IIIIIIIIIILLLMMLAALLALMMLLMLLVLLLLWVLALV
   242  261 A T  E     +PQ 225 260H   0   41   70  TTTTTTTTTTTVVVVMLMMMIMVVIIVQFLIVMIVQMIID
   243  262 A S  E     - Q   0 259H   1   41   68  SSSSSSSSSSALVIILLILLVLIIIIIVIIVVLVLILVVE
   244  263 A G  E     -PQ 222 258H   1   41   46  GGGGGGGGGGGGGGGGGGGGGGGGSSGDSVNNSNVGSGNP
   245  264 A L  E     -PQ 221 257H   0   41   31  LLLLLLLLLLLLLLLLLLLLILLLIILMISVIVVVLVVVL
   246  265 A N  E    S+P  220   0H  39   41   22  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNINNgNNNgNNy
   247  266 A P  S    S+     0   0   69   36   26  PPPPPPPPPPPPPPPPPPPPPPPPP.PPPG..d.IPdP.p
   248  267 A G        +     0   0   29   36   19  GGGGGGGGGGSGGGGGGGGGGGGGG.GGGD..D.NGDG.G
   249  268 A G        -     0   0   11   40   45  GGGGGGGGGGGGGGGGGGGGGGGGAPGSARP.PPPGPGPA
   250  269 A P  S >  S-     0   0    0   40   38  PPPPPPPPPPPPPPPPPPPPPPPPPGPIPPG.EGGPEPGP
   251  270 A P  T 3  S+     0   0   78   40   48  PPPPPPPPPPPPPAAPPPPPPPAANAAA.EAPPAGPPPAL
   252  271 A G  T 3  S+     0   0   57   40   61  GGGGGGGGGGGGGHHGGGGGGGHHGPHG.CVGPVIGPGVG
   253  272 A T    <   -     0   0   18   41   57  TTTTTTTTTTTTTAATTTTTTTAAGNAGNPASAAAVATAG
   254  273 A V        +     0   0   74   40   67  VVVVVVVVVVVVVGGVITVVVIGGSGG.GEGIGGGVGYGS
   255  274 A G  S    S+     0   0    2   40   13  GGGGGGGGGGGGGGGGGGGGGGGGGGG.GGGtGGGGGsGV
   256  275 A S        +     0   0    0   39    0  SSSSSSSSSSSSSSSSSSSSSSSS.SSSSSSsSSSSSsS.
   257  276 A G  E     -Q  245   0H   1   39   19  GGGGGGGGGGRGGGGGGGGGGGGG.GGGGRGGGGAGGDG.
   258  277 A T  E     -Q  244   0H   1   41   42  TTTTTTTTTTTTTTTTSTTTVTTTTTTGTTGAMGGTMGGT
   259  278 A Q  E     -QR 243 286H   0   41   20  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQMQQQMSQE
   260  279 A Y  E     -QR 242 285H  18   41    5  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYIYY
   261  280 A F  E     -Q  241   0H   0   41   34  FFFFFFFFFFFFFVVIIIIIFIVVFFVFFFFFFFFIFVFF
   262  281 A V  E     +Q  240   0H   4   41   16  VVVVVVVVVVVILVVVVVVVLVVVVIVLVVVLIVVVVFVV
   263  282 A G  E     -QS 239 272H   0   41    3  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGEGG
   264  283 A E  E     - S   0 271H  84   41   58  EEEEEEEEEEDDDTTDNNDDDDTTDDTDDSQQNNESSDHT
   265  284 A F  E     - S   0 270H  15   41    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   266  285 A D        -     0   0  106   41   21  DDDDDDDDDDDDNDDNDDNNNNDDDDDNDDDDDDDNDEDN
   267  286 A G  S    S+     0   0    1   41    2  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGG
   268  287 A T  S    S+     0   0   58   41   44  TTTTTTTTTTTTTTTTTTTTTTTTTTTKKSATKVVTKNVT
   269  288 A T        -     0   0   57   41   54  TTTTTTTTTTTTTTTTTTTTTTTTTTTETRRQARAASRSH
   270  289 A F  E     -S  265   0H   8   41    6  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFF
   271  290 A T  E     -S  264   0H  81   41   47  TTTTTTTTTTSKTTTTTTTTTTTTTTTITTVVTVRVTFVD
   272  291 A P  E     -S  263   0H  22   41   55  PPPPPPPPPPPAAAAPAAPPAAAATTARSSPALPSAPAAP
   273  292 A D    >>  -     0   0   31   41   20  DDDDDDDDDDDDDDDDDDDDDDDDNNDQDDDDDDGDDDDL
   274  293 A A  G >4 S+     0   0   95   41   55  AAAAAAAAAAASVAAASTAASAAAQQAEQAAAEGSSERAD
   275  294 A D  G 34 S+     0   0   82   41   65  DDDDDDDDDDDDGNNNDDNNNDNNKKNKEQSNTCTnAGSP
   276  295 A T  G <4 S+     0   0    4   41   78  TTTTTTTTTTSNSNNSSSSSSSNNEESTEPSNLSVtLWSQ
   277  296 A V    <<  -     0   0   35   41   56  VVVVVVVVVVVVIVIIIIIIIIVVIILYDEVVGLTSEVLT
   278  297 A Y        -     0   0   57   41   87  YYYYYYYYYYYYsyyyyfyyhyyyKKhdQaaySpetSaaR
   279  298 A P  S    S+     0   0  132   30   59  PPPPPPPPPPHPpttggggggg.t..a...ps.p.s..p.
   280  299 A G  S    S-     0   0   62   33   78  GGGGGGGGGGGDSSSiiiiiiiii..i...dd.ddi.td.
   281  300 A N  S    S+     0   0  102   33   75  NNNNNNNNNNDNNAASSSSSSCVV..V...PD.SGS.NA.
   282  301 A S  S    S+     0   0   89   33   92  SSSSSSSSSSAKDPPFFFFFFFFF..F...VI.ASF.DA.
   283  302 A T        +     0   0   86   33   67  TTTTTTTTTTTSTEESSSSSASTT..T...AV.ARS.NG.
   284  303 A A        -     0   0   11   35   73  AAAAAAAAAATAADDNDDNNNNDD..D...AFYAMDIAA.
   285  304 A N  E     -R  260   0H  17   35   69  NNNNNNNNNNNNNnnqtsqkttkk..k...asdarvdNt.
   286  305 A W  E     -R  259   0H  18   40    0  WWWWWWWWWWXWWwwwwwwwwwwwWWwwWwwwwwwwwWwF
   287  306 A M  S    S+     0   0    3   41   36  MMMMMMMMMMMMFVVMVVMLLLVVLLVVVLLIVLLMVLLT
   288  307 A D        -     0   0    2   41    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   289  308 A W  S    S+     0   0   54   40   20  WWWWWWWWWWXFRYYWWWWWWWYYYYYFWHWYYWWWYWWF
   290  309 A G  S    S-     0   0    1   41    3  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGA
   291  310 A P  S    S+     0   0    0   41   49  PPPPPPPPPPPPPPPPPPPPPPPPTTPKTRRPSRRPSPRK
   292  311 A D  S    S+     0   0    0   41    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   293  312 A F        +     0   0    2   41   50  FFFFFFFFFFFFFYYFFFFFFFYYNNYFNNCFFCYYFFCN
   294  313 A Y  E     +U  312   0I   0   41    0  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   295  314 A A  E    S-     0   0I   0   41    3  AAAAAAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   296  315 A A  E     -     0   0I   2   41   30  AAAAAAAAAAAAAAAAAAAATAAAGGAAGGSVASAAAASA
   297  316 A A  E     -U  310   0I  20   41   71  AAAAAAAAAAAAIAALQQLLQLAAVVAQVVVNVVVAVQVQ
   298  317 A G  E     -U  309   0I   7   41   61  GGGGGGGGGGGSGTTGVGGGGSTTTTTATTSSTSSPSSSF
   299  318 A Y        -     0   0    8   41    7  YYYYYYYYYYYYYYYFYYFFYFYYFFYFYWFWWFFFWYFY
   300  319 A N  B    S+c   27   0B  21   41   28  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNSSNNSSNNNSY
   301  320 A G  S    S+     0   0   53   41   27  GGGGGGGGGGSGGGGGGGGGGGGGGGGGHDNGGNNGGGNG
   302  321 A L        -     0   0   26   41   37  LLLLLLLLLLVLLLLLLLLLLLLLLLLMTAVLIVMLIIAT
   303  322 A S    >   -     0   0   68   41   50  SSSSSSSSSSPPPSSPPSPPPDSSPPSDPnPSpPPPsPPa
   304  323 A L  G >  S+     0   0   65   40   81  LLIIIIIIIIIDENNQISQQQRNNDDD.DdGGdDDSdQDd
   305  324 A N  G 3  S+     0   0  101   41   88  NNKKKKKKKKDGYYYDGDDDYDYYTTYDGGGGGGGAGYGA
   306  325 A D  G <   +     0   0   84   41   63  DDDDDDDDDDAEEEEKEEKQQQEEEDERAGRRRRRDRQRD
   307  326 A H    <   -     0   0   25   41   54  HHHHHHHHHHLVRRRRRRRRRRRRRRRTRRRRKCRRKRRP
   308  327 A V  E     - V   0 336I   3   41   47  VVVVVVVVVVVITVVTVITTTTVVTTVVLLILIIITITIV
   309  328 A H  E     -UV 298 335I   5   41   95  HHHHHHHHHHQQLAAIAAIIIIAAFFAWFFISWIMNWIIS
   310  329 A I  E     -U  297   0I   2   41   18  IIIIIIIIIIIIIVVIIIIIILVVIIVMIIIIVMIILIIV
   311  330 A G  E     -     0   0I   0   41   28  GGGGGGGGGGGAGAAAGGAASAAAGGAAGGGGGGGAGSGG
   312  331 A W  E     -UW 294 331I   0   40    0  WWWWWWWWWWXWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   313  332 A M  S    S+     0   0    3   41    9  MMMMMMMMMMIMMMMMMMMMMMMMMMMMMMMMMMMMMMMA
   314  333 A N        -     0   0    0   41   25  NNNNNNNNNNNNNNNNNNNNNNNNSSNSSSNNNNNNNNNS
   315  334 A N    >>  -     0   0    0   41   12  NNNNNNNNNNNNNDDNNNNNNNDDNNDNNNNNNNNNNNNN
   316  335 A W  T 34 S+     0   0   70   40    0  WWWWWWWWWWXWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   317  336 A Q  T 34 S-     0   0   83   41   57  QQQQQQQQQQQQQAAQQQQQQQAANNAELKDNRDDQRQDQ
   318  337 A Y  T X4 S+     0   0    2   41    0  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   319  338 A G  G >< S+     0   0    0   41   35  GGGGGGGGGGSGGAAGGGGGGGAAAAAAAAAAGAAAAGAT
   320  339 A A  G 3  S+     0   0   34   41   74  AAAAAAAAAAAAQVVGGGGGGAVVRRVAQNNNTNGSTANN
   321  340 A N  G <   +     0   0   88   41   80  NNNNNNNNNNNLSDDVLLVVVADDDDDDNLQTTQSNTAQV
   322  341 A I  S <  S-     0   0    1   41   37  IIIIIIIIIIIIIIIIIIIIIIIITTIITTLILLTILILL
   323  342 A P        +     0   0   43   41    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   324  343 A T        -     0   0    3   41    9  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSTTTSTTT
   325  344 A Y  S    S-     0   0  182   41   89  YYYYYYYYYYGSSSSDSSDDSDSSEESDEDATEAGSKSAA
   326  345 A P  S    S+     0   0   29   41   37  PPPPPPPPPPSPPPPPPPPPPPPPAAPPRSPPEPEPEPPg
   327  346 A W  E     -a   18   0A   5   41    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWf
   328  347 A R  E     +a   19   0A  28   41    0  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   329  348 A S        -     0   0    1   41   12  SSSSSSSSSSGSSSSSSSSSSSSSSSSGSSSSGSSSGSSS
   330  349 A A        -     0   0    9   41   33  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAASAKSAMKASV
   331  350 A M  B     -W  312   0I   3   41   10  MMMMMMMMMMTMMMMMMMMMMMMMMMMMMMMMMMMLTMMM
   332  351 A A        -     0   0    2   41   54  AAAAAAAAAAASSSSSSSSSSTSSTTSSTTTSSTSSSATT
   333  352 A I        -     0   0    0   41   23  IIIIIIIIIIIVIIIVIIVVIVIILLIILLLVILLIIILI
   334  353 A P        -     0   0    4   41   21  PPPPPPPPPPPPPPPPPPPPPPPPSSPPPPAPPAPAPPAP
   335  354 A R  E     -VX 309 352I   0   41    4  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRPRR
   336  355 A H  E     -VX 308 351I  38   41   82  HHHHHHHHHHHHYVVQDEQHQRVVKKVETVEEEEEKESEG
   337  356 A M  E     + X   0 350I   0   40   21  MMLLLLLLLLLLLLLLLFLLLLLLLLFVLMVFLLVLL.LH
   338  357 A A  E     - X   0 349I   5   40   73  AAAAAAAAAAASSTTASSAASATTTTTTSSRAQRTSQ.RY
   339  358 A L  E     -tX 231 348I   0   40    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL.LL
   340  359 A K  E     - X   0 347I  62   40   56  KKKKKKKKKKRKREEKKKKKKKEEHHETKKTKRTTKR.TK
   341  360 A T  E     + X   0 346I  66   40   38  TTTTTTTTTTTTTTTTTTTTTTTTKKTKDTATTTRTT.AD
   342  361 A I  E >   - X   0 345I  34   40   58  IIIIIIIIIIIVIVVIVIIIIIVVNNVDIGAIYVLIY.HL
   343  362 A G  T 3  S-     0   0   75   39   58  GGNNNNNNNNGNGDDNGDNNDDND.SDKEPNNPNDNP.EP
   344  363 A S  T 3  S+     0   0  117   39   56  SSNNNNNNNNDEQGGGGGGGEGGG.SGNGSGSEGGGE.GR
   345  364 A K  E <  S-X  342   0I  57   39   72  KKKKKKKKKKKKKRRKKKKKSKRR.NRDVGSQGSRWG.SY
   346  365 A A  E     -X  341   0I  19   40   71  AATTTTTTTTVVTAAAVAAAIPAAKGAEPVAVLSVPL.Ag
   347  366 A T  E     -X  340   0I  20   40   73  TTTTTTTTTTTTARRTTTTTASRRTFRVTRRRHRVTR.Rt
   348  367 A L  E     -X  339   0I   2   40   28  LLLLLLLLLLLLLLLILLIVVLLLNYLQLLLLLLLVL.LL
   349  368 A V  E     -X  338   0I   7   39   32  VVVVVVVVVVVLVIIVVVVVVVIIG.ILFVVVIVRII.VI
   350  369 A Q  E     -X  337   0I   2   39   29  QQQQQQQQQQQQQQQQQQQQQQQQF.QVSQQQQQQQQ.QS
   351  370 A Q  E     -X  336   0I  96   39   71  QQQQQQQQQQQQTKKESAEEEQKKY.KQTEQRAQEQT.EY
   352  371 A P  E     -X  335   0I  19   39   16  PPPPPPPPPPPPPPPPPPPPPPPPL.PQPPPPPPAPP.PP
   353  372 A Q        +     0   0   70   39   88  QQQQQQQQQQQQQHHARTAAEAHHK.HPAVVVIVIAI.VW
   354  373 A E  S    S-     0   0   11   39   78  EEEEEEEEEEEQELPGEEGGEGPPN.PAPSLASLGAN.LN
   355  374 A A    >   +     0   0   31   39   88  AAAAAAAAAAASNNNK.KKKCRNNYLNPVGPDEPYNE.GI
   356  375 A W  G >>  +     0   0   51   40   79  WWWWWWWWWWWWWLLWNWWWWWLLPKLEWLGLLPSWL.GM
   357  376 A S  G 34 S+     0   0  116   40   80  SSSSSSSSSSSRAQQSWSSKKRQQVNQLDQHLSVGAS.GS
   358  377 A S  G <4 S+     0   0   63   40   78  SSSSSSSSSSSTSTTAGSAPATTTTYTENKPGQRETQ.SI
   359  378 A I  T <4 S+     0   0   11   40   66  IIIIIIIIIIIVILLLSVLLISLLSPLQILSLLAPLL.SV
   360  379 A S     <  -     0   0   21   40   86  SSSSSSSSSSVAAEETIVTTTGEELVELGRGRREDQR.GE
   361  380 A N        -     0   0  114   39   78  NNSSSSSSSSND.GGHVSHHQNDGDASRKRQGKEATK.TS
   362  381 A K  S    S+     0   0  195   39   79  KKKKKKKKKKKH.RRGSHGGTHRRKSRGDGESPAQGP.SE
   363  382 A R  S    S-     0   0  202   40   92  RRHHHHHHHHRKERRGRKGGQGRRYIRDQEPSIVGTI.LL
   364  383 A P        -     0   0   41   40   90  PPPPPPPPPPAAEMMQKGQQIRMMADMLKRPILPFYL.SA
   365  384 A I  S    S+     0   0   76   39   90  IILLLLLLLLAAALLTC.TTAELLYELLGQAYSARSS.GS
   366  385 A Y  E    S+Y  510   0J  21   39   66  YYYYYYYYYYY.IYYFFLFFSFYYAYYYKWLTLVLNL.TN
   367  386 A S  E     +Y  509   0J  55   40   73  SSSSSSSSSSSKVKKSDDSSTSKKTSKEDEAQQNGAQ.GD
   368  387 A R  E     -Y  508   0J 120   39   97  RRRRRRRRRRHHSNN.QQFFFFNNVYNTVNPTDGPLD.ES
   369  388 A T  E     -Y  507   0J  99   39   87  TTTTTTTTTTKSAQQ.SSPPPRQQVDETSVVTLHRNL.SL
   370  389 A F  E     -Y  506   0J  49   39   94  FFYYYYYYYYYWFWW.WWRRSAWWHTWDVPENTMATT.LG
   371  390 A K  E    S+     0   0J 150   39   91  KKSSSSSSSSNKPHHFSS.VIVHHDVREPVQTIHVVI.RN
   372  391 A T  E    S-Y  504   0J  76   39   69  TTTTTTTTTTSSSSSPFS.ETDSSTESTATISKSPAK.SG
   373  392 A L  E     -Y  503   0J   7   39   91  LLFFFFFFFFMVVTTRVV.GGGITMHTLGPILSGPEP.GT
   374  393 A S        -     0   0   86   39   86  SSSSSSSSSSLS.RRVKDVVTVRRKDRGQGTFGAGGG.PV
   375  394 A E  S    S+     0   0  126   40   86  EEEEEEEEEEEEATTEEQERHRTTNTTGSIESMFVNM.FM
   376  395 A G  E    S-D  498   0K  33   40   58  GGGGGGGGGGGGDGGGGGGGSPGGGMGAINPSNDVQN.DV
   377  396 A S  E     -D  497   0K  64   40   88  SSSSSSSSSSSTVNNVTTVLLLNNMKNKVISNVLEPV.LD
   378  397 A T        -     0   0   25   40   91  TTTTTTTTTTVTHLLRQKRGGGLLSNLPTLDMLRLIL.EY
   379  398 A N        -     0   0  138   39   87  NNNNNNNNNNHSETTGSSGR.RTTLGTLYSLVSDPPS.DS
   380  399 A T        -     0   0   59   39   83  TTAAAAAAAALLLLLLLLLI.LLLSMLSSSQVDSALD.AK
   381  400 A T  E     -E  494   0K  31   39   73  TTSSSSSSSSGDGPPGGGGG.GPPSSPDEEDPIVSSI.AV
   382  401 A T  E     +E  493   0K  85   39   88  TTTTTTTTTTTSDVVRSSR.DKVVKLVIDKSVSFAGS.FK
   383  402 A T        -     0   0    2   39   83  TTTTTTTTTTTPISSIVVI.IASSNSSELSVDARAKA.RS
   384  403 A G        -     0   0   19   39   60  GGGGGGGGGGSGGGGGGGG.GLGGYSGSNglNAlASA.lG
   385  404 A E  S    S+     0   0   54   35   72  EEEEEEEEEEEKKKKKMKKKNDKKNKKQQfl..dA...d.
   386  405 A T  S    S+     0   0   21   38   66  TTTTTTTTTTTAAAATAATTAIAAENATSEPTKAR.K.A.
   387  406 A F  E     -ZA 465 512J   0   39   70  FFFFFFFFFFIFLLLLLLLLAELLQYLYKIAKAVILA.V.
   388  407 A K  E     -ZA 464 511J  51   39   76  KKRRRRRRRRKKEDDEKQEEELDDRNDEIEAGEPDDE.P.
   389  408 A V  E     -ZA 463 510J   0   39   62  VVVVVVVVVVIIIIILIILLITIILEIIDCAEIGAII.G.
   390  409 A D  E     -ZA 462 509J  49   40   77  DDDDDDDDDDDDQTTEDEEEEFTTDQTVFEPAISETI.TA
   391  410 A L  E     +ZA 461 508J   5   40   53  LLLLLLLLLLLLLLLLLLLLLSLLFRLAVLGLAAFVA.AL
   392  411 A S  E     +ZA 460 507J  29   40   80  SSSSSSSSSSSSTTTTSSTTTSTTKLTEWESDEQHAE.QY
   393  412 A F  E     -Z  459   0J   1   40   46  FFFFFFFFFFFFFFFFFFFFFNFFIYFFDLAIFVPFF.VF
   394  413 A S  E >   -Z  458   0J  13   40   69  SSSSSSSSSSSASAASSSSSSMAAPFAEGGQSEIGSE.IE
   395  414 A A  T 3  S+     0   0   24   40   68  AAAAAAAAAAADSAASDDSSSSAAGKAVSSVTIESDI.DA
   396  415 A K  T 3  S+     0   0  177   40   84  KKTTTTTTTTAHRGGRLRRRGPGGKISGAAIKSAARG.AN
   397  416 A S    <   -     0   0   13   40   82  SSSSSSSSSSSDEAAQEEQQDSAALPKSMTEFTETNT.EV
   398  417 A K  S    S+     0   0  168   41   79  KKKKKKKKKKTstEEsppssgnEEDGEASEakAiAsAEit
   399  418 A A  S    S-     0   0    6   30   57  AAAAAAAAAAAas.SksakkslS...S...ag.a.s..ag
   400  419 A S  S    S+     0   0   72   34   57  SSSSSSSSSSSSSSKASSAASGKS.NKG..ET.E.S..GG
   401  420 A T  E     -FG 421 499K  28   34   81  TTTTTTTTTTKTEKMEQQEEEEMK.LME..HA.S.Q..QT
   402  421 A F  E     +FG 420 498K   0   36   55  FFFFFFFFFFFFSMLFFFFFFFLM.DLF..VSVV.FV.VL
   403  422 A A  E     -FG 419 497K   4   37   64  AAAAAAAAAAAAGLGGGGGGGGGLDDGG..AQES.GE.YN
   404  423 A I  E     -FG 418 496K   3   39   46  IIIIIIIIIIIIIGLVIIVVIVLGFFLF.VFFFFVIF.FF
   405  424 A A  E     -FG 417 495K   0   39   80  AAAAAAAAAAAASLNAAIAAISNLKENR.GHGGHGLG.HT
   406  425 A L  E     +F  416   0K   0   40   41  LLLLLLLLLLVVINVVVVVVVIVNLLVVFLLMFLLLF.LF
   407  426 A R  E    S+     0   0K   1   39   79  RRRRRRRRRRRRRV.ARRAARARVNNRRSKFKKFVRK.LT
   408  427 A A  E     - G   0 493K   0   40   78  AAAAAAAAAAGAARRAAAAAAATRFFTNFLAVVGLAV.ES
   409  428 A S    >   -     0   0    8   40   68  SSSSSSSSSSSSSTTTTTTTSTDTTSNSVRSRRNHTR.GS
   410  429 A A  T 3  S+     0   0   70   40   73  AAAAAAAAAAASEDDKPAKKKKGDNNGDNQEVKDASK.EK
   411  430 A N  T 3  S-     0   0  111   40   63  NNNNNNNNNNDDDGGDDDDDDGRGVVGDQSDgSDGDS.DT
   412  431 A F  S <  S+     0   0   14   38   98  FFFFFFFFFFFFFRRYSLYYFY.RNNKLKEGnSGDLA.G.
   413  432 A T  S    S+     0   0   98   39   73  TTTTTTTTTTTKSTTSKKSSSQTTKKYKQSSGNSAAN.N.
   414  433 A E  S    S+     0   0   27   40   74  EEEEEEEEEEKQQYYHQQHYQYYYEEGEEETEQAGQQ.AG
   415  434 A Q        -     0   0   41   39   63  QQQQQQQQQQQEQGGEQQEEQGGGSS.GLEGEEGRQE.GE
   416  435 A T  E     -F  406   0K   0   41   26  TTTTTTTTTTTTTTTTTTTTTTTTVLTTLTTTTTTTTDTS
   417  436 A L  E     -FH 405 430K  32   41   84  LLLLLLLLLLLLRAARRRRRRRAAKKAISVVVILVRIFVV
   418  437 A V  E     +FH 404 429K   0   41   57  VVAAAAAAAAVMVIIVVVVVIVIIFLIVVVLVILLIISLS
   419  438 A G  E     -FH 403 428K   0   41   25  GGGGGGGGGGGGGGGGGGGGGGGGGSGGHGGGGTTGGQSG
   420  439 A Y  E     -FH 402 427K   0   41   18  YYYYYYYYYYYYYYYYYYYYYYYYYYYYLYYYYYYYYHYG
   421  440 A D  E  >> -FH 401 426K  31   41   29  DDDDDDDDDDDNDDDNDDNNDDDDDDDDDNNDNNDDNDHT
   422  441 A F  T  45S+     0   0   18   41   73  FFFFFFFFFFFFFFFFFFFFFFFFSSFAPAAVSATFISPW
   423  442 A A  T  45S+     0   0   96   41   69  AAAAAAAAAAVTADDAAAAATADDSSDKESAKSARGSTGL
   424  443 A K  T  45S-     0   0  142   41   67  KKKKKKKKKKNSTTTTTTTTTTTTTKANNATTNAQTNTRS
   425  444 A Q  T  <5 +     0   0   76   41   63  QQQQQQQQQQKKKNNQKKQQQQNNKSNDQQGHGNGKEQAG
   426  445 A Q  E   < -HI 421 450K  59   41   54  QQQQQQQQQQQEQEEQEEQQQQEENQELQTRTEQVREQED
   427  446 A I  E     -HI 420 449K   0   41   43  IIIIIIIIIIVMAMMVLIVVVVMMYFMVMLLVLLLMLVLL
   428  447 A F  E     -HI 419 448K  22   41   31  FFFFFFFFFFFFFFFFFFFFFFFFYIFFSFVFFVRFFFIW
   429  448 A L  E     -HI 418 447K   0   41   32  LLLLLLLLLLIVVVVVIVVVVVVVLLVTIILVVLLVVILL
   430  449 A D  E     +HI 417 446K  34   41   10  DDDDDDDDDDDDDNNDDDDDDDNNDDDDDDDDDDDDDDDD
   431  450 A R    >   +     0   0    0   41    0  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   432  451 A T  T 3  S+     0   0   37   41   62  TTTTTTTTTTTQTEETTSTTTSEEKTEASTSSTRRTTTRG
   433  452 A H  T 3  S+     0   0  122   41   69  HHKKKKKKKKKHQSSRQQRRKRSSKDSDARRKKLEKKKQE
   434  453 A S  S <  S-     0   0    0   41    5  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSST
   435  454 A G  S    S+     0   0   27   41   10  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGSGGD
   436  455 A D        +     0   0   47   41   55  DDDDDDDDDDDDNDDDDNDDDDDDIIDKLEDQANMNADNg
   437  456 A V    >   +     0   0   39   41   63  VVVVVVVVVVVVVSSTIVTTVVSFITSTVTTIITTVTVTp
   438  457 A S  T 3   +     0   0  105   41   47  SSSSSSSSSSSSSSSSSSSSSSSSSDSDDGGNDGGGDSGF
   439  458 A F  T 3  S+     0   0   37   41    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   440  459 A D    X>  -     0   0   24   41   56  DDDDDDDDDDDDDSSDDDDDDDSSEESHQHHDHHHDHDHT
   441  460 A E  T 34 S+     0   0  202   41   71  EENNNNNNNNNKSAAGGRGGSAAAPTAEEAEPSEEGSSPD
   442  461 A T  T 34 S+     0   0   35   41   61  TTTTTTTTTTTTTSSTTTTTTTSSSSSNDAKTDKATDTKK
   443  462 A F  T <4 S+     0   0    0   41    1  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFF
   444  463 A A  S  < S+     0   0   41   41   56  AAAAAAAAAAAAAPPAPPAAAPPPggPPKGSTTPPSTAPS
   445  464 A S        -     0   0   31   29   52  SSSSSSSSSSSSSGGSDASSSG..kk..N..G...N.S..
   446  465 A V  E     -I  430   0K  49   40   67  VVVVVVVVVVVLVVVVITVVVVGGVPGGICSRASSTAVS.
   447  466 A Y  E     -I  429   0K   4   40   72  YYYYYYYYYYYYYYYYYYYYYYVVHHVVQRAYIAVYIYA.
   448  467 A H  E     +I  428   0K  67   41   76  HHHHHHHHHHRHFYYHYYHYYHYYTIYYIHESHEEYHYEA
   449  468 A G  E     -I  427   0K   1   41   63  GGGGGGGGGGGAAAAAAAAAAAYYAAYRGESAKAAAKAAT
   450  469 A P  E     +I  426   0K  59   41   37  PPPPPPPPPPPPPPPPPPPPPPAAPPAAPAAPAAVPAPAG
   451  470 A L        -     0   0    3   41   66  LLLLLLLLLLLLLLLLLLLLLLPPAAPPIPPLPPALTLPL
   452  471 A T        -     0   0   76   40   77  TTVVVVVVVVASS.PAAAAASSLLIILSGLLLMLVAMSLF
   453  472 A P        -     0   0   25   41   68  PPPPPPPPPPAAPPIPAAPPPNPPLIPSDEVPKVPPKPIN
   454  473 A D    >   -     0   0   67   41   87  DDDDDDDDDDDSAIRSDNSSASIIDDVALALSPLLGPALP
   455  474 A S  T 3  S+     0   0  131   41   82  SSSSSSSSSSVAPRDADAAASARRSNREPREVEEQIELAA
   456  475 A T  T 3  S-     0   0  108   41   64  TTTTTTTTTTNDDDGDKKDDDNDDPKDDNEDDHDDDHNSE
   457  476 A G  S <  S+     0   0   16   41   42  GGSSGSSSGGGKNGKGGGGGKGGGTEGGTGGGGGGGENGG
   458  477 A V  E     -Z  394   0J  42   41   85  VVMMMMMMMMKRTKVTQQTTTTKKDDKTERVSRARKRTVS
   459  478 A V  E     -Z  393   0J   1   41   32  VVVVVVVVVVVIVVKVIIVVVIVVVVVVILLIVLLVIVLW
   460  479 A K  E     +Z  392   0J 109   40   70  KKRRRRRRRRNNSK.SNDSSTSEKADKKSKKAQKRTQTKK
   461  480 A L  E     -ZB 391 474J   4   41    8  LLLLLLLLLLLLLLLLLLLLLLLLYFLLVLLLLLLLLLLL
   462  481 A S  E     -ZB 390 473J  24   41   65  SSSSSSSSSSSQRRRRERRRRRRRSTRHSRQRSQRRSHRS
   463  482 A I  E     -ZB 389 472J   0   41   19  IIIIIIIIIIIVIIIVIVVVIIIIIIILILIVIIVIIIIG
   464  483 A F  E     -ZB 388 471J   3   41   35  FFFFFFFFFFFFFLLLYYLLFLLLVILFFFVLYVYLYFVV
   465  484 A V  E     +ZB 387 470J   0   41   24  VVVVVVVVVVVVVLLVVVVVVLLLMMLVLVVVVVLLLVVI
   466  485 A D  E >   - B   0 469J   0   41    0  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   467  486 A R  T 3  S+     0   0   33   41   45  RRRRRRRRRRRWWWWWWWWWWWWWAAWRQHHWWHRSWWHR
   468  487 A S  T 3  S+     0   0    9   41   16  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSACSSCCSSSCS
   469  488 A S  E <   -BC 466 484J   1   41    7  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSI
   470  489 A V  E     -BC 465 483J   0   41    6  VVVVVVVVVVVVVVVVVVVVVVVVIIVVIVVVVVVVVVVI
   471  490 A E  E     -BC 464 482J   0   41    0  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
   472  491 A V  E     -BC 463 481J   0   41    7  VVVVVVVVVVVVVVVVVVVVVVVVIIVLVVVVVVVVVVVI
   473  492 A F  E     -BC 462 480J   6   41    0  FFFFFFFFFFFLFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   474  493 A G  E >>> -BC 461 479J   0   41   43  GGGGGGGGGGGGGGGGGGGGGGGGIIGALAAGGAAGGGAL
   475  494 A G  T 345S-     0   0   32   41   45  GGGGGGGGGGGGGGGGGGGGGAGGDDGNNNQGNQQGNGQN
   476  495 A Q  T 345S-     0   0  102   41   65  QQQQQQQQQQQQQHHNQQNNQHHHGGRGGDGSHGDLHQDG
   477  496 A G  T <45S+     0   0    1   41    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   478  497 A E  T  <5S+     0   0   31   41   43  EEEEEEEEEEEEEEEEEEEEQEEESSERQEAEEKLEKQQE
   479  498 A T  E   < +C  474   0J   8   41   75  TTTTTTTTTTTVSEEATSAATAEETTEQKLVAIVAVATVL
   480  499 A T  E     -C  473   0J   1   41   58  TTSSTSSSTTTSTTTTTTTTTTTTVVTVVVVVIVTTITVS
   481  500 A L  E     -C  472   0J   0   41   34  LLLLLLLLLLLLIIIIIIIIMIIIFFIMMMLLILILIILA
   482  501 A T  E     +C  471   0J   0   41   12  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSTTSSTTT
   483  502 A A  E     -C  470   0J   0   41   63  AAAAAAAAAAAAASSSTTSSTSSSDDANADDSDDDADTDS
   484  503 A Q  E     -C  469   0J   4   41   43  QQQQQQQQQQQQQQQQQQQQQQQQQQQRQQLQMLLQMQLV
   485  504 A I        -     0   0    0   41   12  IIIIIIIIIIIIIIIIIIIIIIIIIIIIFIVIIVVIIIVF
   486  505 A F        +     0   0    0   41    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   487  506 A P        -     0   0    6   41    6  PPPPPPPPPPPPPPPPPPPPPPPPPPPPNPPPPPPPPPPP
   488  507 A S    >   -     0   0   44   40   74  SSSSSSSSSSSEPSSANSAADGSS.TLFTDGADDTQDPLS
   489  508 A S  T 3  S+     0   0  113   40   81  SSNNNNNNNNREDDDSDDSSEPDD.TDMNPAPLREDFKAA
   490  509 A D  T 3  S+     0   0   77   41   69  DDDDDDDDDDDSNSSDISDDNDSSTPSEPGETEGATEMGP
   491  510 A A    <   +     0   0    0   41   66  AAAAAAAAAAAAASSAAAAAAASSTFSSYSSSSQSGSPQL
   492  511 A V        +     0   0   29   41   76  VVVVVVVVVVITTTTVSTVVTVTTPTTNNTQDRTTVKRTD
   493  512 A H  E     -EG 382 408K  35   41   90  HHHHHHHHHHNEYGGYYYYYNYDGFAGGQGAGGEGDGMAT
   494  513 A A  E     +E  381   0K   1   39   80  AAAAAAAAAATAAV.GAAGGAG VTLVLLLNVLNMILRNM
   495  514 A R  E     - G   0 405K  76   40   75  RRRRRRRRRRQQRSVRQQRRQQ SATSEKEWAERARESRE
   496  515 A L  E     - G   0 404K   2   40   23  LLLLLLLLLLLLLLSLIVLLLL LLFLMILLVLLILLFLV
   497  516 A A  E     -DG 377 403K  14   40   79  AAVVVVVVVVVVFFLFFFFFFF FTTFYEYAFYTFFYSTA
   498  517 A S  E     -DG 376 402K   0   40   53  SSSSSSSSSSSSSSFSSSSSSS SFSSSNAAAAVASATAT
   499  518 A T  E     + G   0 401K  78   40   63  TTTTTTTTTTTTTVSTTTTTTS VTEVKKLANITETIGST
   500  519 A G  S    S-     0   0   45   39   23  GGGGGGGGGGGDG.VDGGDGGG GSDGDGGGGGGGGGEGG
   501  520 A G  S    S-     0   0   11   40   34  GGGGGGGGGGGGGGGGGGGGGG VEAVGTGGGGGEGGTGL
   502  521 A T        -     0   0   31   40   79  TTAAAAAAAATASVVESNEESQ VNTVEEEPTEQGSETRH
   503  522 A T  E     -Y  373   0J   0   40   66  TTTTTTTTTTTTTVLTTTTTTT KTIKVKAAALAATLDAP
   504  523 A E  E     +Y  372   0J  30   40   78  EEEEEEEEEEKHDKKRQRRRKR DTADTARTVRTQSRNTD
   505  524 A D  E    S-     0   0J  54   40   80  DDDDDDDDDDSDNDDNNNDDND VINVIVLILAVLGVVVA
   506  525 A V  E     -Y  370   0J   0   40   62  VVVVVVVVVVVVVVVVVVVVVV KALKKFIQQVRVVVQRK
   507  526 A R  E     +YA 369 392J 100   40   78  RRRRRRRRRRKRQKKKRRKKQS INKISKSKSSTATSLAV
   508  527 A A  E     +YA 368 391J   1   39   60  AAVVVVVVVVILVIILVVLLLL EL.EMgLLILLLILRLs
   509  528 A D  E     -YA 367 390J  34   36   68  DDDDDDDDDDDQREERSERRRQ .K..QkRTNQTDDQ.Tg
   510  529 A I  E     -YA 366 389J   3   40   24  IIVVVVVVVVIIIVVVIIVVIV VVVVIILVIIVVAIKVV
   511  530 A Y  E     - A   0 388J  36   39   86  YYHHHHHHHHFTSHHKNNKKSR HSSHYTYSSNT KNSTW
   512  531 A K  E     - A   0 387J 110   39   74  KKNNNNNNNNNGKSSENQEEKE SKKSEPETSDA IDKAA
   513  532 A I        -     0   0    2   39   31  IIIIIIIIIIVMVVVVIIVVVI VIIVMILLMLL LLVLL
   514  533 A A        -     0   0   52   39   83  AATTTTTTTTASRSSRSSRRRQ SKKSNHNTNVN GVRSQ
   515  534 A S        -     0   0   55   36   27  SSSSSSSSSSSSSSSSSSSSSS SRRSTSS SS  SSP A
   516  535 A T              0   0    8   36   59  TTTTTTTTTTTSTAATATTTTT AIIATIV SI  AIT A
   517  536 A W              0   0   75   32    0  WWWWWWWWWWW WWWWWWWWWW WWWW W  WW   WW W
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1   20 A   0   8   0   0  92   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   0.271      9  0.91
    2   21 A   0   0   0   0   0   0   0   3   9   6  28   6   0   0   0   0   0   3  41   3    32    0    0   1.616     53  0.31
    3   22 A   0   3   0   0   5   0  92   0   0   0   0   0   0   0   0   0   0   0   0   0    37    0    0   0.333     11  0.94
    4   23 A   0   3   0   0   0   0   0   0   0   0   3  43   0   0   8   0   3   0   3  38    37    0    0   1.324     44  0.30
    5   24 A   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0   0  35  59   0   3    37    0    0   0.872     29  0.68
    6   25 A   3  16   0   0   0   0   0   0   3  43   3   8   0   0   0   3   3   0   5  14    37    0    0   1.777     59  0.15
    7   26 A   0   3   0   0  13   0  82   0   0   0   0   0   0   3   0   0   0   0   0   0    39    0    0   0.614     20  0.88
    8   27 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0    40    0    0   0.000      0  1.00
    9   28 A   0   0   0   0   0   0   0  30   0  68   3   0   0   0   0   0   0   0   0   0    40    0    0   0.719     23  0.61
   10   29 A   0   0   0   0   0   0   0   0  10   0   0   0   0   0   3   0  88   0   0   0    40    0    0   0.439     14  0.76
   11   30 A   5   3   3   0  20   0  70   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.906     30  0.77
   12   31 A   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   13   32 A   0   0   0   0  82   0  17   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.464     15  0.98
   14   33 A   0   0   0   0   0   0   0   0   0   0  52  47   0   0   0   0   0   0   0   0    40    0    0   0.692     23  0.55
   15   34 A   0   0   0   0   0   0   0   0  10  90   0   0   0   0   0   0   0   0   0   0    40    0    0   0.325     10  0.85
   16   35 A   0   0   0   0   0   0   0   0  25  13   3   0   0   0   8   8  30  15   0   0    40    0    0   1.733     57  0.27
   17   36 A   0   0   3   0   0   0   0   0   3   0   0   5   0   0   3  60   5  10   3  10    40    0    0   1.435     47  0.44
   18   37 A   0   0   0   5   0   0   0   3   0   0   0   8   0   0   0   3   0   0  82   0    40    0    0   0.687     22  0.63
   19   38 A   0   0   0   0   3  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.117      3  0.99
   20   39 A   0  10   0  90   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.325     10  0.97
   21   40 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0    40    0    0   0.000      0  1.00
   22   41 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    40    0    0   0.000      0  1.00
   23   42 A   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   24   43 A   0   0   0   0   0   0   0   0   0   0   5   0   0   0   0   0   0   0  95   0    40    0    0   0.199      6  0.93
   25   44 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   26   45 A   0  93   0   8   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.266      8  0.98
   27   46 A  38  47  13   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   1.074     35  0.69
   28   47 A   3   0   0   0   3   0  95   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.233      7  0.92
   29   48 A   0   3   0   0   3   3  15   0   3   0   0   0   3  57   0   0   0   0   0  15    40    0    5   1.348     45  0.35
   30   49 A   0   0   0   0   0   0   0   8   0   0   3   0   0   0   0  20   0  17  45   8    40    0    0   1.467     48  0.43
   31   50 A   0   0   0   0   0   0   0  95   0   0   0   0   3   0   0   0   0   3   0   0    40    0    0   0.233      7  0.93
   32   51 A  10   8  10   0   0   0   0   0   0   0   0  45   0   0   0  15   3  10   0   0    40    0    0   1.621     54  0.24
   33   52 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   34   53 A   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   35   54 A   0  82   3  15   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.535     17  0.94
   36   55 A   0   0   0   0  65   0  35   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.647     21  0.97
   37   56 A   0   0   0   0  60   0  40   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.673     22  0.96
   38   57 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0    40    0    0   0.000      0  1.00
   39   58 A   0   0   0   0   0   0  80   0   0   0   0   0   0  15   0   0   0   0   5   0    40    0    0   0.613     20  0.63
   40   59 A   0   0   0   0   0   0   8   0   0   0   0   5   0   3   0   0   0   0  85   0    40    0    0   0.574     19  0.68
   41   60 A   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    40    0    2   0.000      0  1.00
   42   61 A   0   0   0   0   5   0   5  55   0   0   3  20   0   0   0   0   0  10   3   0    40    0    0   1.365     45  0.29
   43   62 A   0   0   0   0   0   0   0  85   3   0   0   0   0   0   0   0   5   0   0   8    40    0    0   0.574     19  0.78
   44   63 A   0   0  38   3   0   0   0   0   3   5   5  17   0   0   0   0   0   0  10  20    40    0    0   1.709     57  0.17
   45   64 A  28   0   3   0   0   0   0   0   3   0   0  28   0   0   0   0   5  28   0   8    40    0    0   1.594     53  0.23
   46   65 A   0   0   0   0   8  90   0   0   3   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.381     12  0.87
   47   66 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   48   67 A   0   0   0   0   0   0   0   0  22  10   0   0   0   0   3   0   0   0  63   3    40    0    0   1.044     34  0.46
   49   68 A   0   3  40  55   0   0   0   0   0   0   0   0   0   0   0   0   3   0   0   0    40    0    0   0.880     29  0.63
   50   69 A   0   0   0   0   0   0   0   0   0   0  82   0   0  17   0   0   0   0   0   0    40    0    0   0.464     15  0.58
   51   70 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   52   71 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   53   72 A   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   54   73 A   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   55   74 A  22   0   8   0   0   0   0   0   0   0   0  70   0   0   0   0   0   0   0   0    40    0    0   0.780     26  0.60
   56   75 A   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
   57   76 A   0   0   0   0   0   0   0   0   0   3   3   8   0   0  20  20   0  30   5  13    40    0    0   1.793     59  0.30
   58   77 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    40    0    0   0.000      0  1.00
   59   78 A   0  95   0   0   0   0   0   2   0   0   0   2   0   0   0   0   0   0   0   0    41    0    0   0.229      7  0.86
   60   79 A  10  12   7  22   0   0   2   0   0   0   0  46   0   0   0   0   0   0   0   0    41    0    0   1.455     48  0.33
   61   80 A   0   0   0   0   0   0   0   0   0   0   5   2   0  80  12   0   0   0   0   0    41    0    0   0.669     22  0.66
   62   81 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
   63   82 A   0   0   0   0   0   0   0   0   0   0   0  24   0   0   0  24   0  46   0   5    41    0    0   1.192     39  0.40
   64   83 A   0   0   0   0   0   0   0   0   0   0   0   0   0  15   0   0   2  80   2   0    41    0    0   0.637     21  0.73
   65   84 A   0  20   0   2   0   0   0   0   0   0   0   0   0  20   2  15  39   2   0   0    41    0    0   1.558     52  0.28
   66   85 A   0   0   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   2   0   0    41    0    0   0.115      3  0.94
   67   86 A  76   0  17   2   0   0   0   0   0   5   0   0   0   0   0   0   0   0   0   0    41    0    0   0.751     25  0.77
   68   87 A   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
   69   88 A   0  78  17   2   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.676     22  0.81
   70   89 A   0  44   0   0   5   0   5   0   7   7   0   2   0   0  10   2   0   2  15   0    41    0    0   1.819     60  0.08
   71   90 A   2   0   0   0   0   0   0   0  68  20   0   0  10   0   0   0   0   0   0   0    41    0    0   0.897     29  0.54
   72   91 A   0   0   0   0  12   0   0   7   0   0   0   0   0   0  49   7   0   2   0  22    41    0    0   1.413     47  0.13
   73   92 A   0   0   0   0   0   0   0  59   0   0   0   0   0   0   2   5   2  22  10   0    41    0    0   1.202     40  0.45
   74   93 A   0   5   0   0  22   0  34   0   0   2  12   2   0   7   0   0   2   5   2   5    41    0    0   1.952     65  0.12
   75   94 A   0   0   0   0   0   0   0  44   2  39   2   2   0   0   0   0   0  10   0   0    41    0    0   1.227     40  0.44
   76   95 A   0   5   0   2   0   0   2   2  20   2  27   0   0   0   0   0   2   2  10  24    41    0    0   1.934     64  0.20
   77   96 A   0   0  27   0   0   0   0  17   0   0   0   2   0   0   0   0   0   0  24  29    41   12    6   1.449     48  0.20
   78   97 A  48  17  31   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0   0   0    29    0    0   1.134     37  0.63
   79   98 A   0   0   0   0   0   0   0   0   0   0   3  79   0   0   0   3   0   0  14   0    29    0    0   0.689     23  0.60
   80   99 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   3  97   0   0    29    0    0   0.150      5  0.95
   81  100 A   0  17   0  83   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    29    0    0   0.460     15  0.95
   82  101 A   0   0   3   0  37   0  60   0   0   0   0   0   0   0   0   0   0   0   0   0    30    0    0   0.788     26  0.88
   83  102 A   0   0   0   0  85   2  12   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.482     16  0.98
   84  103 A   0   0   0   0   0   0   0   0   0   0  95   5   0   0   0   0   0   0   0   0    41    0    0   0.195      6  0.93
   85  104 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
   86  105 A   0   0   0   0   0   0   0   0   0   0  85  10   2   0   0   0   0   0   2   0    41    0    0   0.543     18  0.79
   87  106 A  24   0   2   0   0   0   0   0  68   0   2   2   0   0   0   0   0   0   0   0    41    0    0   0.876     29  0.55
   88  107 A  95   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.195      6  0.97
   89  108 A  27   0  15   5   2   0   0   0  39   0  12   0   0   0   0   0   0   0   0   0    41    1    0   1.496     49  0.30
   90  109 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    40    0    0   0.000      0  1.00
   91  110 A  34   0   5   2   2   2   0   0   2   2   2   0   0   7   0   5   0  20   0  15    41    0    0   1.996     66  0.09
   92  111 A   0   0   0   0   0   0   0   7  12   0   2   0   0  10  10   0   0   7  44   7    41    0    0   1.737     57  0.34
   93  112 A   0  10   0   2   0   0   0   0   0   0   0   0   0   2   0   0   0   0  83   2    41    0    0   0.654     21  0.64
   94  113 A   0   0   0   0   0   0   0   0   2   0   2  90   0   0   0   2   0   0   2   0    41    0    0   0.455     15  0.82
   95  114 A   0   0   0   0   0   0   0   0   0   0  95   5   0   0   0   0   0   0   0   0    41    0    0   0.195      6  0.91
   96  115 A   0   0   0   0   0   0   0  98   0   0   2   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.97
   97  116 A   0  29   0   0  68   0   0   2   0   0   0   0   0   0   0   0   0   0   0   0    41    1    0   0.711     23  0.83
   98  117 A   0   0   0   0  13   0   0  85   0   0   0   0   0   0   3   0   0   0   0   0    40    0    0   0.490     16  0.56
   99  118 A   3   0   0   0   0   0   0   3   0   5   3  22   0   8  10  32   0   0   3  13    40    0    0   1.904     63  0.22
  100  119 A   0   0   3   0   0   0   0  13   8   3   3   3   0   0   0  13   0   5  15  38    40    0    0   1.885     62  0.32
  101  120 A   0   0   0   0   0   0   0  57   3   0   0   3   0   0   3  13   3  10   0  10    40    1    0   1.408     46  0.42
  102  121 A   0   0   0   0   0   0   0   5   5   0   5   3   0   3  13  54   0   0  13   0    39    0    0   1.505     50  0.34
  103  122 A   5   0   5   0   0   0   0   0   5  33   5  44   0   0   0   0   0   0   3   0    39    0    0   1.431     47  0.34
  104  123 A   0   0   0   0   0   0   0   8  10  82   0   0   0   0   0   0   0   0   0   0    39    0    0   0.593     19  0.71
  105  124 A   3  64   3  10   3  18   0   0   0   0   0   0   0   0   0   0   0   0   0   0    39    0    0   1.109     37  0.67
  106  125 A  93   0   5   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.314     10  0.92
  107  126 A   0   0   0   0   0   0   0   0  98   0   3   0   0   0   0   0   0   0   0   0    40    1    0   0.117      3  0.97
  108  127 A  15   0  26  56   0   0   0   3   0   0   0   0   0   0   0   0   0   0   0   0    39    0    0   1.054     35  0.57
  109  128 A   0   0   0   0   5   0  92   0   0   0   3   0   0   0   0   0   0   0   0   0    39    0    0   0.320     10  0.91
  110  129 A   0   0   0   0   0   0   0   0   0   3   0  97   0   0   0   0   0   0   0   0    39    1    0   0.119      3  0.95
  111  130 A   0   0   0   0   0   0   5   3   0   0  87   0   0   0   0   0   0   0   5   0    38    0    0   0.528     17  0.70
  112  131 A   0   3   0   3   5   0  53   0  11   0   3   0   0  18   0   0   0   5   0   0    38    0    0   1.484     49  0.23
  113  132 A   3   5   5   0   3   0  79   5   0   0   0   0   0   0   0   0   0   0   0   0    39    1    0   0.827     27  0.58
  114  133 A   0   0   0   5   3   0   0   0   3  61   3  13   0   0   0   8   0   0   5   0    38    0    0   1.368     45  0.30
  115  134 A  36   3   3  10   0   0   3   3   8   0  15   5   0   3   3   3   3   3   0   3    39    0    0   2.178     72  0.12
  116  135 A   0   0   0   0   3   0   3   8  52   0   5   0   0   3   0   0   0  15   0  13    40    3    0   1.504     50  0.37
  117  136 A   0   3   0  14   0   0   0   3   0   0   3   3   0   3   3   3  65   3   0   0    37    3    0   1.332     44  0.38
  118  137 A  21   3   0   0   0   0   0   3   0   0   0  59   0   3   0   6   0   0   3   3    34    1    0   1.323     44  0.34
  119  138 A   0  91   0   3   0   0   0   0   6   0   0   0   0   0   0   0   0   0   0   0    33    0    0   0.363     12  0.81
  120  139 A   0   0   3   0   0   0   0   3   3  85   0   0   0   0   0   0   0   3   0   3    33    0    0   0.669     22  0.65
  121  140 A   0   0   0   0   0   0   0   3   3   0  85   0   0   0   3   0   3   0   3   0    33    1    0   0.669     22  0.68
  122  141 A   0   0   0   0   3   0   0  75   0   0   0   0   0   3   0   3   0   3  13   0    32    0    0   0.909     30  0.49
  123  142 A   0   0   0   0   0   0   3   0   0   3   0   3   0   0   0  56  34   0   0   0    32    0    0   1.016     33  0.42
  124  143 A   3   0   0   0   0   0   0   0   5   0  24  41   0   3  11   3   8   0   0   3    37    0    0   1.702     56  0.22
  125  144 A  74   0   3   0   0   0   0   8   0   3   3   3   0   0   0   0   0   5   3   0    38    0    0   1.059     35  0.47
  126  145 A   0   3   0   0   0   0   0   0   3   5   0   0   0   8  30  10  38   0   3   3    40    0    0   1.672     55  0.35
  127  146 A   0   0   0   0   0   0   0  10  17   2   0  20   0   2   2  10   0  29   2   5    41    0    0   1.944     64  0.27
  128  147 A   0   0   0   0   0   0   0  27   0   2   0   0   0   0   0   5   2   5  17  41    41    0    0   1.496     49  0.48
  129  148 A   2   0   0   0   5   0   2   0   0   5   0  10   0   0   5   0  68   0   0   2    41    0    0   1.201     40  0.32
  130  149 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  88  12   0   0    41    0    0   0.371     12  0.87
  131  150 A   5   0   0   0   0   0   0   2  37   0  41  10   0   0   2   0   0   0   0   2    41    0    0   1.379     46  0.38
  132  151 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0    41    0    0   0.000      0  1.00
  133  152 A   0   0   0   0   0   0   0   7   0   0  88   0   0   2   2   0   0   0   0   0    41    0    0   0.487     16  0.77
  134  153 A   0  12  88   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.371     12  0.87
  135  154 A   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  136  155 A   0   0   0   0  15   0  85   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.416     13  0.98
  137  156 A   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0    41    1    0   0.000      0  1.00
  138  157 A   0  73   0   0   0   0   0   0   0   0   0  22   0   0   3   3   0   0   0   0    40    0    0   0.753     25  0.44
  139  158 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    40    0    0   0.000      0  1.00
  140  159 A   0   0   0   0   0   0   0   8   3   0   0   0   0   5   5  15   5  13  10  38    40    0    0   1.878     62  0.37
  141  160 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
  142  161 A   0  40   3  25   0   0   0   0   3   0   0   5   0   0  13   0   0  10   0   3    40    0    0   1.630     54  0.29
  143  162 A   0   0   0   0   0   0   0   0   0   0  15  83   0   2   0   0   0   0   0   0    41    0    0   0.527     17  0.71
  144  163 A   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   3    40    0    0   0.117      3  0.88
  145  164 A   2   0   2   0   0   0   0   2   0   0   2  78   0   2   2   5   0   2   0   0    41    0    0   0.975     32  0.59
  146  165 A   0   0   0   5   0   0   0   2   0   0   0  56   0   0   0  22   2  12   0   0    41    1    0   1.242     41  0.34
  147  166 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0    40    7    0   0.000      0  1.00
  148  167 A   0   0   0   0   0   0   0   0   3   6   3   3   0   0   6   0   0   6   0  73    33    0    0   1.059     35  0.51
  149  168 A   3   0   0   0   3   0   0  16  46   8   5   0   0   0   0   0   0   5   5   8    37    0    0   1.728     57  0.35
  150  169 A   0   0   0   0   0   0   0   5  54   0   3   3   0   0   0   0   0   3  24   8    37    0    0   1.331     44  0.41
  151  170 A   0   0   0   0   0   0   0   0   0  24   0   0   0   0   0   3   0   0  70   3    37    1    0   0.787     26  0.47
  152  171 A  22   0   0   0   0   0   3   0   0  75   0   0   0   0   0   0   0   0   0   0    36    0    0   0.650     21  0.48
  153  172 A  68  16  14   0   0   0   0   0   0   0   0   0   0   0   0   0   0   3   0   0    37    0    0   0.928     30  0.69
  154  173 A   0   3  74   0   5   0   0   0   5   0  11   3   0   0   0   0   0   0   0   0    38    0    0   0.963     32  0.49
  155  174 A   0  22   0   0   0   0   0   2  10  32   2   0   0  10   7   0   5   5   5   0    41    3    0   1.966     65  0.11
  156  175 A   0   3   0   0   0   0   0   3   0   5   0   0   0   0   0   0   3  26  45  16    38    2    0   1.445     48  0.45
  157  176 A   3   0   0   0   0   0   0   3   0  83   6   0   0   0   0   0   0   0   6   0    36    0    0   0.672     22  0.64
  158  177 A   3   0   3   0   0   0   0   0   6  83   3   0   0   0   0   0   0   0   3   0    36    0    0   0.711     23  0.65
  159  178 A   6   0   3   0   0   0   0   0  25   3  28   6   0   6   0   0  25   0   0   0    36    1    0   1.730     57  0.22
  160  179 A   6   0   3   0   6   0   0   3   0  66   0   3   0   0   0   0  14   0   0   0    35    0    0   1.186     39  0.33
  161  180 A   0   3   0   0   0   0  81   6   0   3   0   0   0   0   6   0   0   0   3   0    36    0    0   0.794     26  0.39
  162  181 A   0   0   0   0   0   0   0   3  17   0   6   0   0   3   0   0  39  19   6   8    36    0    0   1.712     57  0.38
  163  182 A   0   0   0   3   0   0   0   5  28  10   0   5   0   0   3   0   0   0   0  46    39    0    0   1.440     48  0.34
  164  183 A   0   0   0   0   0   0   0   2   2   0   0   0   0   0   0   5  54  22  10   5    41    0    0   1.370     45  0.52
  165  184 A   5   2  10   0  12   5  51   0   0   2   5   5   0   2   0   0   0   0   0   0    41    0    0   1.687     56  0.32
  166  185 A   0  32   2   0   5   0   0   0   5   0   0  10   0   0   2  10  29   5   0   0    41    0    0   1.801     60  0.13
  167  186 A   0   0   0   0   0   0   0   0   0   0   0   0   0   2   5   0   2  12  49  29    41    0    0   1.295     43  0.54
  168  187 A   0   0   0   0  95   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.195      6  0.99
  169  188 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  95   0   0   5   0   0    41    1    0   0.195      6  0.88
  170  189 A   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0   0   0   0   0  98    40    0    0   0.117      3  0.97
  171  190 A   0   0   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   3    40    0    0   0.117      3  0.94
  172  191 A   0   0   0   0  47   0   0   0   0   0  10   0   0   0   0  28   0   0  15   0    40    0    0   1.223     40  0.06
  173  192 A  90   0   8   0   0   0   0   3   0   0   0   0   0   0   0   0   0   0   0   0    40    0    1   0.381     12  0.91
  174  193 A   3   0   5   3  88   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.543     18  0.84
  175  194 A   0   0   0   0   0  97   0   0   0   0   0   0   0   0   3   0   0   0   0   0    39    0    0   0.119      3  1.00
  176  195 A   3   0   0   0   0   0  28   0   0   0   0   0   0  65   0   0   0   0   3   3    40    0    0   0.912     30  0.49
  177  196 A   2   0   0   2   0   0   0  15   5   0   0   0   0   0   0   2   2  20   2  49    41    0    0   1.550     51  0.52
  178  197 A   0   0   0   0   0   0   0  10   2  29   0   0   0   0   0   2   2  46   2   5    41    4    3   1.453     48  0.38
  179  198 A   0   0   5   0   0   0   0   5   0   0  49  35   0   0   0   0   0   5   0   0    37    0    0   1.191     39  0.40
  180  199 A   3   0   0   0   0   0   0   0   0   0   5   3   0  11   5  22  35  14   3   0    37    0    0   1.818     60  0.31
  181  200 A   0   0   0   0   0   0   3   0   3   0   5   0   5  15   5  45  15   0   5   0    40    0    0   1.712     57  0.25
  182  201 A   0   0   0   0   0  90   3   0   3   0   3   0   0   0   3   0   0   0   0   0    40    1    0   0.464     15  0.84
  183  202 A  77   0  13   5   0   0   0   0   0   0   0   5   0   0   0   0   0   0   0   0    39    0    0   0.770     25  0.76
  184  203 A  31   0   3  33   0   8   0   0  18   0   8   0   0   0   0   0   0   0   0   0    39    0    0   1.526     50  0.21
  185  204 A  68   5  13   0   0   0   0   0   0   0   0  15   0   0   0   0   0   0   0   0    40    0    0   0.960     32  0.64
  186  205 A  20  12  10  12   0   0   0   0  15   0   2  29   0   0   0   0   0   0   0   0    41    1    0   1.791     59  0.28
  187  206 A  25   0   0   0   0   0   0   0  10   0  65   0   0   0   0   0   0   0   0   0    40    0    0   0.857     28  0.41
  188  207 A   3  47  30   0   0   0   3   0   5   0   3   0   0   0   0   0   0  10   0   0    40    1    0   1.372     45  0.37
  189  208 A   5   0   0   0   0   0   0   3  75  15   0   0   0   0   0   0   3   0   0   0    40    0    0   0.835     27  0.64
  190  209 A  10   0   3   0   0   0   0   0  13   0   0   0   0   0   0  25  13  30   5   3    40    0    0   1.792     59  0.23
  191  210 A   2  59   7   0   2   0   0  10   0   0   0   0   0   7   5   0   5   0   0   2    41    0    0   1.490     49  0.23
  192  211 A   0   0   2   0   2   0   0   0   2   0   0   0   0  68   2   2   7   2   0  10    41    0    0   1.222     40  0.48
  193  212 A   0   0   0   0   0   0   0   0   0   0   2   0   0   5   7  83   2   0   0   0    41    0    0   0.675     22  0.74
  194  213 A  22  54  15   0   5   0   0   0   2   0   2   0   0   0   0   0   0   0   0   0    41    1    0   1.277     42  0.60
  195  214 A  15  40   0   3   0   0   0   3  28   0   3   0   0   0   0   3   3   5   0   0    40    0    0   1.617     53  0.25
  196  215 A   0   8  75   0  15   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.787     26  0.73
  197  216 A   0   0   2   0   5   2  90   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.421     14  0.93
  198  217 A   0   0   0   0   0   0   0   5   2   0  12  68   0   2  10   0   0   0   0   0    41    0    0   1.073     35  0.46
  199  218 A   0   0   0   0   0   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.96
  200  219 A   0   0   0   0   0   0   0   0   2  20   0   2   0   0   7  22   5   5   0  37    41    0    0   1.687     56  0.30
  201  220 A   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0  71  27    41    0    0   0.688     22  0.73
  202  221 A   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  203  222 A   2   0   5   0   0   0   0   0   0   0   0  12   0   0   2  78   0   0   0   0    41    0    0   0.779     25  0.59
  204  223 A   0   0   0   0   0   0   0   0  17   0   7   2   0   7   0   0  10  12   5  39    41    0    0   1.773     59  0.38
  205  224 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
  206  225 A   0   0   0   0   0   0   0   0   2   0   7  17   0   0   0  32   0  20   5  17    41    0    0   1.716     57  0.31
  207  226 A   0  51   0   0  17   2  10   0   0   5   0   0   0  12   0   2   0   0   0   0    41    0    0   1.457     48  0.40
  208  227 A  44  12   2   7   0   0   0   0  22   0   0   2   0   0   0   0   2   7   0   0    41    0    0   1.605     53  0.33
  209  228 A   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  210  229 A   2   0   0   0   0   0   0   0   0   0   0   2   0   0   0   2   0  90   2   0    41    0    0   0.455     15  0.81
  211  230 A   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  212  231 A   0   0   0   0   0   0   0  98   0   0   2   0   0   0   0   0   0   0   0   0    41    0    6   0.115      3  0.96
  213  232 A   0   0   0   0   0   0   0   0   0  80   0   0   0   2   0   0   0   2  10   5    41    0    0   0.730     24  0.60
  214  233 A  22   2  10   2   5   0  34   0  20   0   0   0   0   0   0   0   2   2   0   0    41    0    0   1.755     58  0.17
  215  234 A   0   0   0   0   0   0   0  15   0   2   0   0   0   0   0   0   2   0  80   0    41    0    2   0.637     21  0.68
  216  235 A   2   0   5   0   0   0   0   0  88   0   2   0   0   0   0   0   0   2   0   0    41    0    0   0.533     17  0.75
  217  236 A  41   0   0   0   0   0   0   0   0   0   2   2   0  15   0   0  32   0   0   7    41    0    0   1.383     46  0.21
  218  237 A   0   0   2   0   0   0   0  80   5   0   0   0   0   0   5   0   2   0   0   5    41    0    0   0.798     26  0.64
  219  238 A   0   2   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.91
  220  239 A  63   0   5   0   0   0   0   0   2   0   0   0   0   0   0   0  17   7   5   0    41    0    0   1.167     38  0.37
  221  240 A   0   0   0   0   5  93   2   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.308     10  0.97
  222  241 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0    41    0    0   0.000      0  1.00
  223  242 A   0   0   0   0   0   0   0   0   0   0   0   2  98   0   0   0   0   0   0   0    41    0    0   0.115      3  0.95
  224  243 A   0   0   0   0   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.97
  225  244 A   0   0   0   0   0   0   0  29   0   0  27   0   0   0   0   0   0   2  15  27    41    0    0   1.437     47  0.44
  226  245 A   0  78  22   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.526     17  0.83
  227  246 A  10   0   2   0  88   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.432     14  0.83
  228  247 A   0   0   0   0   0   0   0   0   0  37   2   2   0   0   2  27  20  10   0   0    41    0    0   1.538     51  0.31
  229  248 A   0  85   5   7   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.564     18  0.91
  230  249 A   0   0   0   0   0   0   0   0  12  63   7   5   0   2   0   2   5   2   0   0    41    0    0   1.303     43  0.49
  231  250 A  56  41   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2    41    0    0   0.780     26  0.69
  232  251 A   0   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0  10   2  85    41    0    0   0.543     18  0.86
  233  252 A   0   0   0   0   0   0   0  78   0   0   7   2   0   0   2   0   0   5   2   2    41    2   19   0.894     29  0.72
  234  253 A   0   3   0   0   0   0   0  31   0  10  18   3   0   0   0  18   5   8   0   5    39    0    0   1.903     63  0.22
  235  254 A   0   0   0   0   0   0   0   3   5   0  45   0   0   0   0  10   3   5  20  10    40    0    0   1.626     54  0.37
  236  255 A   0   0   0   0   0   0   0   0   3   3  30   8   0   0  13  13   3   8  15   8    40    0    0   2.025     67  0.22
  237  256 A  13   0  10   0   0   0   0   0   0   0   0  65   0   0   5   3   0   3   0   3    40    0    0   1.197     39  0.45
  238  257 A   0   0   0   0   0   0   0   0   0   0   0   2   0   0   2  88   0   2   2   2    41    0    0   0.567     18  0.79
  239  258 A   0   0   0   0   8  85   0   0   0   0   3   3   0   0   3   0   0   0   0   0    40    0    0   0.609     20  0.84
  240  259 A  85   0   7   0   0   2   0   0   0   0   0   2   0   0   2   0   0   0   0   0    41    0    0   0.598     19  0.75
  241  260 A   7  41  27  12   0   2   0   0  10   0   0   0   0   0   0   0   0   0   0   0    41    0    0   1.484     49  0.53
  242  261 A  22   5  17  17   2   0   0   0   0   0   0  29   0   0   0   0   5   0   0   2    41    0    0   1.772     59  0.29
  243  262 A  20  22  27   0   0   0   0   0   2   0  27   0   0   0   0   0   0   2   0   0    41    0    0   1.539     51  0.32
  244  263 A   5   0   0   0   0   0   0  68   0   2  12   0   0   0   0   0   0   0  10   2    41    0    0   1.073     35  0.54
  245  264 A  17  66  12   2   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0    41    0    0   1.015     33  0.68
  246  265 A   0   0   2   0   0   0   2   5   0   0   0   0   0   0   0   0   0   0  90   0    41    5    3   0.421     14  0.78
  247  266 A   0   0   3   0   0   0   0   3   0  89   0   0   0   0   0   0   0   0   0   6    36    0    0   0.464     15  0.73
  248  267 A   0   0   0   0   0   0   0  86   0   0   3   0   0   0   0   0   0   0   3   8    36    0    0   0.535     17  0.81
  249  268 A   0   0   0   0   0   0   0  70   8  17   3   0   0   0   3   0   0   0   0   0    40    0    0   0.933     31  0.54
  250  269 A   0   0   3   0   0   0   0  13   0  80   0   0   0   0   0   0   0   5   0   0    40    1    0   0.680     22  0.62
  251  270 A   0   3   0   0   0   0   0   3  25  65   0   0   0   0   0   0   0   3   3   0    40    0    0   0.995     33  0.51
  252  271 A   8   0   3   0   0   0   0  68   0   8   0   0   3  13   0   0   0   0   0   0    40    0    0   1.098     36  0.38
  253  272 A   2   0   0   0   0   0   0   7  27   2   2  54   0   0   0   0   0   0   5   0    41    1    0   1.297     43  0.43
  254  273 A  47   0   8   0   0   0   3  32   0   0   5   3   0   0   0   0   0   3   0   0    40    0    0   1.340     44  0.33
  255  274 A   3   0   0   0   0   0   0  93   0   0   3   3   0   0   0   0   0   0   0   0    40    2    2   0.349     11  0.87
  256  275 A   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0    39    0    0   0.000      0  1.00
  257  276 A   0   0   0   0   0   0   0  90   3   0   0   0   0   0   5   0   0   0   0   3    39    0    0   0.437     14  0.81
  258  277 A   2   0   0   5   0   0   0  15   2   0   2  73   0   0   0   0   0   0   0   0    41    0    0   0.929     31  0.58
  259  278 A   0   0   0   5   0   0   0   0   0   0   2   0   0   0   0   0  90   2   0   0    41    0    0   0.421     14  0.79
  260  279 A   0   0   2   0   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.95
  261  280 A  15   0  17   0  68   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.843     28  0.66
  262  281 A  80  10   7   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.684     22  0.84
  263  282 A   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   2   0   0    41    0    0   0.115      3  0.96
  264  283 A   0   0   0   0   0   0   0   0   0   0   7  15   0   2   0   0   5  29  10  32    41    0    0   1.661     55  0.41
  265  284 A   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  266  285 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2  22  76    41    0    0   0.635     21  0.79
  267  286 A   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   0   2    41    0    0   0.115      3  0.97
  268  287 A   7   0   0   0   0   0   0   0   2   0   2  76   0   0   0  10   0   0   2   0    41    0    0   0.902     30  0.56
  269  288 A   0   0   0   0   0   0   0   0   7   0   5  71   0   2  10   0   2   2   0   0    41    0    0   1.082     36  0.46
  270  289 A   0   0   0   0  98   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.93
  271  290 A  12   0   2   0   2   0   0   0   0   0   2  73   0   0   2   2   0   0   0   2    41    0    0   1.029     34  0.52
  272  291 A   0   2   0   0   0   0   0   0  37  46   7   5   0   0   2   0   0   0   0   0    41    0    0   1.244     41  0.45
  273  292 A   0   2   0   0   0   0   0   2   0   0   0   0   0   0   0   0   2   0   5  88    41    0    0   0.533     17  0.79
  274  293 A   2   0   0   0   0   0   0   2  61   0  12   2   0   0   2   0   7   7   0   2    41    0    0   1.394     46  0.44
  275  294 A   0   0   0   0   0   0   0   5   2   2   5   5   2   0   0   7   2   2  27  39    41    0    1   1.806     60  0.34
  276  295 A   2   5   0   0   0   2   0   0   0   2  32  32   0   0   0   0   2   7  15   0    41    0    0   1.711     57  0.22
  277  296 A  46   7  27   0   0   0   2   2   0   0   2   5   0   0   0   0   0   5   0   2    41    0    0   1.558     51  0.44
  278  297 A   0   0   0   0   2   0  56   0  10   2   7   2   0   5   2   5   2   2   0   2    41   11   17   1.671     55  0.12
  279  298 A   0   0   0   0   0   0   0  23   3  53   7  10   0   3   0   0   0   0   0   0    30    0   14   1.312     43  0.41
  280  299 A   0   0  33   0   0   0   0  36   0   0   9   3   0   0   0   0   0   0   0  18    33    0    0   1.368     45  0.21
  281  300 A   9   0   0   0   0   0   0   3   9   3  24   0   3   0   0   0   0   0  42   6    33    0    0   1.631     54  0.25
  282  301 A   3   0   3   0  33   0   0   0   9   6  36   0   0   0   0   3   0   0   0   6    33    0    0   1.610     53  0.08
  283  302 A   3   0   0   0   0   0   0   3   9   0  24  48   0   0   3   0   0   6   3   0    33    0    0   1.506     50  0.32
  284  303 A   0   0   3   3   3   0   3   0  49   0   0   3   0   0   0   0   0   0  14  23    35    0    0   1.474     49  0.27
  285  304 A   3   0   0   0   0   0   0   0   6   0   6  11   0   0   3  11   6   0  49   6    35    0   20   1.704     56  0.31
  286  305 A   0   0   0   0   3  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.117      3  0.99
  287  306 A  27  27   2  39   2   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    41    0    0   1.345     44  0.64
  288  307 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    41    0    0   0.000      0  1.00
  289  308 A   0   0   0   0   8  63  25   0   0   0   0   0   0   3   3   0   0   0   0   0    40    0    0   1.019     34  0.80
  290  309 A   0   0   0   0   0   0   0  98   2   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.96
  291  310 A   0   0   0   0   0   0   0   0   0  71   5   7   0   0  12   5   0   0   0   0    41    0    0   0.988     32  0.50
  292  311 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    41    0    0   0.000      0  1.00
  293  312 A   0   0   0   0  63   0  17   0   0   0   0   0   7   0   0   0   0   0  12   0    41    0    0   1.039     34  0.50
  294  313 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  295  314 A   0   0   0   0   0   0   0   0  98   0   0   2   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.97
  296  315 A   2   0   0   0   0   0   0  10  78   0   7   2   0   0   0   0   0   0   0   0    41    0    0   0.793     26  0.70
  297  316 A  24  10   2   0   0   0   0   0  46   0   0   0   0   0   0   0  15   0   2   0    41    0    0   1.390     46  0.29
  298  317 A   2   0   0   0   2   0   0  44   2   2  22  24   0   0   0   0   0   0   0   0    41    0    0   1.401     46  0.39
  299  318 A   0   0   0   0  29  10  61   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.888     29  0.92
  300  319 A   0   0   0   0   0   0   2   0   0   0  12   0   0   0   0   0   0   0  85   0    41    0    0   0.482     16  0.71
  301  320 A   0   0   0   0   0   0   0  83   0   0   2   0   0   2   0   0   0   0  10   2    41    0    0   0.654     21  0.72
  302  321 A   7  71   7   5   0   0   0   0   5   0   0   5   0   0   0   0   0   0   0   0    41    0    0   1.070     35  0.62
  303  322 A   0   0   0   0   0   0   0   0   2  44  46   0   0   0   0   0   0   0   2   5    41    1    4   1.046     34  0.49
  304  323 A   0   8  25   0   0   0   0   5   0   0   5   0   0   0   3   0  13   3  10  30    40    0    0   1.876     62  0.18
  305  324 A   0   0   0   0   0   0  20  27   5   0   0   5   0   0   0  20   0   0   7  17    41    0    0   1.779     59  0.11
  306  325 A   0   0   0   0   0   0   0   2   5   0   0   0   0   0  20   5  10  24   0  34    41    0    0   1.642     54  0.37
  307  326 A   2   2   0   0   0   0   0   0   0   2   0   2   2  27  56   5   0   0   0   0    41    0    0   1.277     42  0.45
  308  327 A  49   7  20   0   0   0   0   0   0   0   0  24   0   0   0   0   0   0   0   0    41    0    0   1.205     40  0.53
  309  328 A   0   2  22   2  10   7   0   0  17   0   5   0   0  27   0   0   5   0   2   0    41    0    0   1.972     65  0.04
  310  329 A  17   5  73   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.825     27  0.81
  311  330 A   0   0   0   0   0   0   0  66  29   0   5   0   0   0   0   0   0   0   0   0    41    0    0   0.782     26  0.71
  312  331 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
  313  332 A   0   0   2  95   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.229      7  0.91
  314  333 A   0   0   0   0   0   0   0   0   0   0  15   0   0   0   0   0   0   0  85   0    41    0    0   0.416     13  0.74
  315  334 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  88  12    41    0    0   0.371     12  0.87
  316  335 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
  317  336 A   0   2   0   0   0   0   0   0  12   0   0   0   0   0   5   2  59   2   7  10    41    0    0   1.408     46  0.42
  318  337 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  319  338 A   0   0   0   0   0   0   0  54  41   0   2   2   0   0   0   0   0   0   0   0    41    0    0   0.880     29  0.64
  320  339 A  12   0   0   0   0   0   0  17  39   0   2   5   0   0   5   0   5   0  15   0    41    0    0   1.739     58  0.25
  321  340 A  12  10   0   0   0   0   0   0   5   0   5   7   0   0   0   0   7   0  34  20    41    0    0   1.847     61  0.19
  322  341 A   0  15  73   0   0   0   0   0   0   0   0  12   0   0   0   0   0   0   0   0    41    0    0   0.766     25  0.63
  323  342 A   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  324  343 A   0   0   0   0   0   0   0   0   0   0   5  95   0   0   0   0   0   0   0   0    41    0    0   0.195      6  0.91
  325  344 A   0   0   0   0   0   0  27   5  10   0  29   2   0   0   0   2   0  10   0  15    41    0    0   1.776     59  0.10
  326  345 A   0   0   0   0   0   0   0   2   5  78   5   0   0   0   2   0   0   7   0   0    41    0    1   0.861     28  0.62
  327  346 A   0   0   0   0   2  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.99
  328  347 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0    41    0    0   0.000      0  1.00
  329  348 A   0   0   0   0   0   0   0  10   0   0  90   0   0   0   0   0   0   0   0   0    41    0    0   0.320     10  0.87
  330  349 A   2   0   0   2   0   0   0   0  83   0   7   0   0   0   0   5   0   0   0   0    41    0    0   0.675     22  0.67
  331  350 A   0   2   0  93   0   0   0   0   0   0   0   5   0   0   0   0   0   0   0   0    41    0    0   0.308     10  0.89
  332  351 A   0   0   0   0   0   0   0   0  32   0  46  22   0   0   0   0   0   0   0   0    41    0    0   1.053     35  0.46
  333  352 A  15  20  66   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.875     29  0.76
  334  353 A   0   0   0   0   0   0   0   0  10  85   5   0   0   0   0   0   0   0   0   0    41    0    0   0.509     17  0.78
  335  354 A   0   0   0   0   0   0   0   0   0   2   0   0   0   0  98   0   0   0   0   0    41    0    0   0.115      3  0.96
  336  355 A  15   0   0   0   0   0   2   2   0   0   2   2   0  34   2   7   7  22   0   2    41    1    0   1.907     63  0.18
  337  356 A   8  73   0  10   8   0   0   0   0   0   0   0   0   3   0   0   0   0   0   0    40    0    0   0.944     31  0.78
  338  357 A   0   0   0   0   0   0   3   0  43   0  20  22   0   0   8   0   5   0   0   0    40    0    0   1.457     48  0.26
  339  358 A   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    40    0    0   0.000      0  1.00
  340  359 A   0   0   0   0   0   0   0   0   0   0   0  13   0   5  10  60   0  13   0   0    40    0    0   1.206     40  0.44
  341  360 A   0   0   0   0   0   0   0   0   5   0   0  80   0   0   3   8   0   0   0   5    40    0    0   0.765     25  0.62
  342  361 A  20   5  55   0   0   0   5   3   3   0   0   0   0   3   0   0   0   0   5   3    40    1    0   1.469     49  0.41
  343  362 A   0   0   0   0   0   0   0  15   0  10   3   0   0   0   0   3   0   5  44  21    39    0    0   1.549     51  0.42
  344  363 A   0   0   0   0   0   0   0  44   0   0  15   0   0   0   3   0   3  10  23   3    39    0    0   1.504     50  0.44
  345  364 A   3   0   0   0   0   3   3   8   0   0  10   0   0   0  15  51   3   0   3   3    39    0    0   1.625     54  0.28
  346  365 A  15   5   3   0   0   0   0   5  35   8   3  22   0   0   0   3   0   3   0   0    40    0    1   1.850     61  0.28
  347  366 A   5   0   0   0   3   0   0   0   5   0   3  55   0   3  28   0   0   0   0   0    40    0    0   1.260     42  0.27
  348  367 A   8  80   5   0   0   0   3   0   0   0   0   0   0   0   0   0   3   0   3   0    40    1    0   0.799     26  0.72
  349  368 A  64   5  23   0   3   0   0   3   0   0   0   0   0   0   3   0   0   0   0   0    39    0    0   1.058     35  0.68
  350  369 A   3   0   0   0   3   0   0   0   0   0   5   0   0   0   0   0  90   0   0   0    39    0    0   0.437     14  0.70
  351  370 A   0   0   0   0   0   0   5   0   5   0   3   8   0   0   3  13  46  18   0   0    39    0    0   1.618     54  0.29
  352  371 A   0   3   0   0   0   0   0   0   3  92   0   0   0   0   0   0   3   0   0   0    39    0    0   0.356     11  0.84
  353  372 A  13   0   8   0   0   3   0   0  15   3   0   3   0  13   3   3  36   3   0   0    39    0    0   1.943     64  0.12
  354  373 A   0  10   0   0   0   0   0  13   8  13   5   0   0   0   0   0   3  41   8   0    39    1    0   1.767     58  0.21
  355  374 A   3   3   3   0   0   0   5   5  31   8   3   0   3   0   3  10   0   5  18   3    39    0    0   2.216     73  0.12
  356  375 A   0  22   0   3   0  55   0   5   0   5   3   0   0   0   0   3   0   3   3   0    40    0    0   1.425     47  0.21
  357  376 A   5   5   0   0   0   3   0   5   5   0  45   0   0   3   5   5  15   0   3   3    40    0    0   1.912     63  0.19
  358  377 A   0   0   3   0   0   0   3   5   8   5  38  22   0   0   3   3   5   5   3   0    40    0    0   1.958     65  0.22
  359  378 A   8  32  38   0   0   0   0   0   3   5  13   0   0   0   0   0   3   0   0   0    40    0    0   1.522     50  0.34
  360  379 A   8   5   3   0   0   0   0  10   5   0  28  10   0   0  10   0   3  17   0   3    40    1    0   2.121     70  0.14
  361  380 A   3   0   0   0   0   0   0  10   5   0  28   5   0   8   5   8   5   3  13   8    39    0    0   2.243     74  0.22
  362  381 A   0   0   0   0   0   0   0  15   3   5  10   3   0   8  13  33   3   5   0   3    39    0    0   2.029     67  0.21
  363  382 A   3   5   8   0   0   0   3  13   0   3   3   3   0  20  25   5   5   5   0   3    40    0    0   2.275     75  0.07
  364  383 A   0   8   5  13   3   0   3   3  10  32   3   0   0   0   5   5   8   3   0   3    40    1    0   2.247     74  0.09
  365  384 A   0  36   8   0   0   0   5   5  15   0  10   8   3   0   3   0   3   5   0   0    39    1    0   2.023     67  0.09
  366  385 A   3  13   3   0  13   3  49   0   3   0   3   5   0   0   0   3   0   0   5   0    39    0    0   1.745     58  0.33
  367  386 A   3   0   0   0   0   0   0   5   5   0  43   5   0   0   0  15   8   5   3  10    40    1    0   1.856     61  0.27
  368  387 A   5   3   0   0  10   0   3   3   0   5   5   5   0   5  28   0   5   3  15   5    39    0    0   2.321     77  0.02
  369  388 A   8   8   0   0   0   0   0   0   3   8  13  33   0   3   5   3  10   3   3   3    39    0    0   2.171     72  0.12
  370  389 A   3   3   0   3  10  21  23   3   5   3   3  10   0   3   5   0   0   3   3   3    39    1    0   2.374     79  0.05
  371  390 A  15   0   8   0   3   0   0   0   0   5  26   3   0  13   5  10   3   3   5   3    39    0    0   2.258     75  0.09
  372  391 A   0   0   3   0   3   0   0   3   5   5  31  38   0   0   0   5   0   5   0   3    39    0    0   1.715     57  0.30
  373  392 A  10  13   5   5  21   0   0  15   0   8   3  13   0   3   3   0   0   3   0   0    39    1    0   2.251     75  0.08
  374  393 A  13   3   0   0   3   0   0  15   3   3  31   5   0   0  13   5   3   0   0   5    39    0    0   2.104     70  0.13
  375  394 A   3   0   3   8   5   0   0   3   3   0   5  15   0   3   5   0   3  43   5   0    40    0    0   1.995     66  0.14
  376  395 A   5   0   3   3   0   0   0  60   3   5   5   0   0   0   0   0   3   0   8   8    40    0    0   1.513     50  0.41
  377  396 A  15  13   3   3   0   0   0   0   0   3  32   8   0   0   0   5   0   3  15   3    40    0    0   2.000     66  0.11
  378  397 A   3  22   3   3   0   0   3   8   0   3   3  32   0   3   8   3   3   3   3   3    40    1    0   2.196     73  0.08
  379  398 A   3   8   0   0   0   0   3   8   0   5  18  13   0   3   5   0   0   3  28   5    39    0    0   2.156     71  0.12
  380  399 A   3  36   3   3   0   0   0   0  26   0  13   8   0   0   0   3   3   0   0   5    39    0    0   1.799     60  0.17
  381  400 A   5   0   5   0   0   0   0  21   3  15  31   8   0   0   0   0   0   5   0   8    39    1    0   1.921     64  0.27
  382  401 A  15   3   3   0   5   0   0   3   3   0  15  31   0   0   5  10   0   0   0   8    39    0    0   2.050     68  0.11
  383  402 A   8   3  10   0   0   0   0   0  10   3  21  31   0   0   5   3   0   3   3   3    39    0    0   2.068     69  0.17
  384  403 A   0  10   0   0   0   0   3  64   8   0  10   0   0   0   0   0   0   0   5   0    39    5    4   1.196     39  0.39
  385  404 A   0   3   0   3   3   0   0   0   3   0   0   0   0   0   0  34   6  34   6   9    35    0    0   1.678     56  0.28
  386  405 A   0   0   3   0   0   0   0   0  32   3   3  45   0   0   3   5   0   5   3   0    38    0    0   1.512     50  0.33
  387  406 A   5  31   8   0  31   0   5   0  10   0   0   0   0   0   0   5   3   3   0   0    39    0    0   1.801     60  0.30
  388  407 A   0   3   3   0   0   0   0   3   3   5   0   0   0   0  23  15   3  23   3  18    39    0    0   1.989     66  0.24
  389  408 A  28  10  38   0   0   0   0   5   5   0   0   3   3   0   0   0   0   5   0   3    39    0    0   1.697     56  0.37
  390  409 A   3   0   5   0   5   0   0   0   5   3   3  17   0   0   0   0   5  17   0  38    40    0    0   1.854     61  0.23
  391  410 A   5  70   0   0   5   0   0   3  13   0   3   0   0   0   3   0   0   0   0   0    40    0    0   1.086     36  0.47
  392  411 A   0   3   0   0   0   3   3   0   3   0  43  25   0   3   0   3   5  10   0   3    40    0    0   1.736     57  0.20
  393  412 A   5   3   5   0  75   0   3   0   3   3   0   0   0   0   0   0   0   0   3   3    40    0    0   1.069     35  0.53
  394  413 A   0   0   5   3   3   0   0   8  15   3  52   0   0   0   0   0   3  10   0   0    40    0    0   1.566     52  0.30
  395  414 A   5   0   5   0   0   0   0   3  45   0  22   3   0   0   0   3   0   3   0  13    40    0    0   1.623     54  0.32
  396  415 A   0   3   5   0   0   0   0  17  15   3   5  20   0   3  15  13   0   0   3   0    40    0    0   2.124     70  0.16
  397  416 A   3   3   0   3   3   0   0   0  10   3  35  10   0   0   0   3   8  15   3   5    40    0    0   2.102     70  0.17
  398  417 A   0   0   5   0   0   0   0   5  12   5  15   7   0   0   0  29   0  17   2   2    41   11   15   2.014     67  0.20
  399  418 A   0   3   0   0   0   0   0   7  57   0  23   0   0   0   0  10   0   0   0   0    30    0    0   1.186     39  0.42
  400  419 A   0   0   0   0   0   0   0  12   9   0  59   3   0   0   0   9   0   6   3   0    34    0    0   1.366     45  0.42
  401  420 A   0   3   0   9   0   0   0   0   3   0   3  38   0   3   0   9  12  21   0   0    34    0    0   1.788     59  0.18
  402  421 A  14  11   0   6  61   0   0   0   0   0   6   0   0   0   0   0   0   0   0   3    36    0    0   1.240     41  0.44
  403  422 A   0   5   0   0   0   0   3  35  38   0   3   0   0   0   0   0   3   5   3   5    37    0    0   1.599     53  0.35
  404  423 A  15   8  46   0  26   0   0   5   0   0   0   0   0   0   0   0   0   0   0   0    39    0    0   1.343     44  0.53
  405  424 A   0   8   5   0   0   0   0  13  44   0   5   3   0   8   3   3   0   3   8   0    39    0    0   1.898     63  0.20
  406  425 A  30  47   5   3  10   0   0   0   0   0   0   0   0   0   0   0   0   0   5   0    40    1    0   1.337     44  0.59
  407  426 A   8   3   0   0   5   0   0   0  10   0   3   3   0   0  54  10   0   0   5   0    39    0    0   1.584     52  0.21
  408  427 A   8   5   0   0   8   0   0   5  55   0   3   5   0   0   8   0   0   3   3   0    40    0    0   1.638     54  0.22
  409  428 A   3   0   0   0   0   0   0   3   0   0  47  28   0   3  10   0   0   0   5   3    40    0    0   1.458     48  0.32
  410  429 A   3   0   0   0   0   0   0   5  35   3   5   0   0   0   0  20   3   8   8  13    40    0    0   1.914     63  0.26
  411  430 A   5   0   0   0   0   0   0  17   0   0   8   3   0   0   3   0   3   0  28  35    40    2    1   1.648     55  0.37
  412  431 A   0   8   0   0  39   0  11   8   3   0   5   0   0   0   8   5   0   3   8   3    38    0    0   2.003     66  0.02
  413  432 A   0   0   0   0   0   0   3   3   5   0  21  41   0   0   0  15   5   0   8   0    39    0    0   1.668     55  0.26
  414  433 A   0   0   0   0   0   0  15   8   5   0   0   3   0   5   0   3  20  43   0   0    40    1    0   1.648     55  0.25
  415  434 A   0   3   0   0   0   0   0  23   0   0   5   0   0   0   3   0  44  23   0   0    39    0    0   1.379     46  0.37
  416  435 A   2   5   0   0   0   0   0   0   0   0   2  88   0   0   0   0   0   0   0   2    41    0    0   0.533     17  0.73
  417  436 A  15  34   7   0   2   0   0   0  12   0   2   0   0   0  22   5   0   0   0   0    41    0    0   1.757     58  0.16
  418  437 A  37  12  22   2   2   0   0   0  20   0   5   0   0   0   0   0   0   0   0   0    41    0    0   1.605     53  0.43
  419  438 A   0   0   0   0   0   0   0  85   0   0   5   5   0   2   0   0   2   0   0   0    41    0    0   0.611     20  0.74
  420  439 A   0   2   0   0   0   0  93   2   0   0   0   0   0   2   0   0   0   0   0   0    41    0    0   0.342     11  0.82
  421  440 A   0   0   0   0   0   0   0   0   0   0   0   2   0   2   0   0   0   0  22  73    41    0    0   0.743     24  0.71
  422  441 A   2   0   2   0  66   2   0   0  10   5  10   2   0   0   0   0   0   0   0   0    41    0    0   1.239     41  0.27
  423  442 A   2   2   0   0   0   0   0   5  49   0  12   7   0   0   2   5   0   2   0  12    41    0    0   1.712     57  0.31
  424  443 A   0   0   0   0   0   0   0   0   7   0   5  41   0   0   2  29   2   0  12   0    41    0    0   1.501     50  0.32
  425  444 A   0   0   0   0   0   0   0  10   2   0   2   0   0   2   0  17  46   2  15   2    41    0    0   1.619     54  0.36
  426  445 A   2   2   0   0   0   0   0   0   0   0   0   5   0   0   5   0  54  27   2   2    41    0    0   1.344     44  0.46
  427  446 A  22  22  29  20   2   0   2   0   2   0   0   0   0   0   0   0   0   0   0   0    41    0    0   1.616     53  0.57
  428  447 A   5   0   5   0  80   2   2   0   0   0   2   0   0   0   2   0   0   0   0   0    41    0    0   0.832     27  0.69
  429  448 A  41  44  12   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    41    0    0   1.074     35  0.67
  430  449 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  10  90    41    0    0   0.320     10  0.90
  431  450 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0    41    0    0   0.000      0  1.00
  432  451 A   0   0   0   0   0   0   0   2   2   0  12  59   0   0   7   2   2  12   0   0    41    0    0   1.380     46  0.37
  433  452 A   0   2   0   0   0   0   0   0   2   0  12   0   0  10  15  39  10   5   0   5    41    0    0   1.835     61  0.31
  434  453 A   0   0   0   0   0   0   0   0   0   0  98   2   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.95
  435  454 A   0   0   0   0   0   0   0  93   0   0   5   0   0   0   0   0   0   0   0   2    41    0    0   0.308     10  0.89
  436  455 A   0   2   5   2   0   0   0   2   5   0   0   0   0   0   0   2   2   2  12  63    41    0    1   1.384     46  0.45
  437  456 A  49   0  10   0   2   0   0   0   0   2  10  27   0   0   0   0   0   0   0   0    41    0    0   1.338     44  0.37
  438  457 A   0   0   0   0   2   0   0  15   0   0  68   0   0   0   0   0   0   0   2  12    41    0    0   0.979     32  0.52
  439  458 A   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  440  459 A   0   0   0   0   0   0   0   0   0   0  12   2   0  20   0   0   2   5   0  59    41    0    0   1.217     40  0.44
  441  460 A   0   0   0   0   0   0   0  12  17   7  12   2   0   0   2   2   0  20  22   2    41    0    0   2.020     67  0.29
  442  461 A   0   0   0   0   0   0   0   0   5   0  17  59   0   0   0  10   0   0   2   7    41    0    0   1.272     42  0.38
  443  462 A   0   2   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.99
  444  463 A   0   0   0   0   0   0   0   7  46  29   7   7   0   0   0   2   0   0   0   0    41   12    2   1.381     46  0.43
  445  464 A   0   0   0   0   0   0   0  14   3   0  66   0   0   0   0   7   0   0   7   3    29    0    0   1.151     38  0.48
  446  465 A  55   3   5   0   0   0   0  10   5   3  10   5   3   0   3   0   0   0   0   0    40    0    0   1.608     53  0.33
  447  466 A  13   0   5   0   0   0  65   0   8   0   0   0   0   5   3   0   3   0   0   0    40    0    0   1.218     40  0.28
  448  467 A   0   0   5   0   2   0  29   0   2   0   2   2   0  44   2   0   0  10   0   0    41    0    0   1.548     51  0.24
  449  468 A   0   0   0   0   0   0   7  32  46   0   2   2   0   0   2   5   0   2   0   0    41    0    0   1.422     47  0.37
  450  469 A   2   0   0   0   0   0   0   2  24  71   0   0   0   0   0   0   0   0   0   0    41    0    0   0.770     25  0.62
  451  470 A   0  66   2   0   0   0   0   0   7  22   0   2   0   0   0   0   0   0   0   0    41    1    0   0.980     32  0.33
  452  471 A  22  20   5   5   3   0   0   3  17   3  15   8   0   0   0   0   0   0   0   0    40    0    0   2.018     67  0.23
  453  472 A   5   2   7   0   0   0   0   0  10  59   2   0   0   0   0   5   0   2   5   2    41    0    0   1.536     51  0.32
  454  473 A   2  12   7   0   0   0   0   2  12   7  15   0   0   0   2   0   0   0   2  37    41    0    0   1.907     63  0.13
  455  474 A   5   2   2   0   0   0   0   0  20   5  32   0   0   0  12   0   2  12   2   5    41    0    0   2.001     66  0.18
  456  475 A   0   0   0   0   0   0   0   2   0   2   2  27   0   5   0   7   0   5  10  39    41    0    0   1.705     56  0.35
  457  476 A   0   0   0   0   0   0   0  66   0   0  12   5   0   0   0   7   0   5   5   0    41    0    0   1.165     38  0.58
  458  477 A  15   0   0  20   0   0   0   0   2   0   5  20   0   0  12  15   5   2   0   5    41    0    0   2.080     69  0.14
  459  478 A  66  12  17   0   0   2   0   0   0   0   0   0   0   0   0   2   0   0   0   0    41    1    0   1.015     33  0.67
  460  479 A   0   0   0   0   0   0   0   0   5   0  15   8   0   0  22  30   5   3   8   5    40    0    0   1.912     63  0.30
  461  480 A   2  93   0   0   2   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.342     11  0.91
  462  481 A   0   0   0   0   0   0   0   0   0   0  41   2   0   5  41   0   7   2   0   0    41    0    0   1.250     41  0.34
  463  482 A  17   5  76   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.751     25  0.80
  464  483 A  12  27   2   0  46   0  12   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   1.313     43  0.64
  465  484 A  68  24   2   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.843     28  0.75
  466  485 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100    41    0    0   0.000      0  1.00
  467  486 A   0   0   0   0   0  44   0   0   5   0   2   0   0  10  37   0   2   0   0   0    41    0    0   1.285     42  0.55
  468  487 A   0   0   0   0   0   0   0   0   2   0  88   0  10   0   0   0   0   0   0   0    41    0    0   0.432     14  0.84
  469  488 A   0   0   2   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.93
  470  489 A  90   0  10   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.320     10  0.94
  471  490 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0    41    0    0   0.000      0  1.00
  472  491 A  90   2   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.375     12  0.93
  473  492 A   0   2   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.115      3  0.99
  474  493 A   0   5   5   0   0   0   0  76  15   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.787     26  0.57
  475  494 A   0   0   0   0   0   0   0  68   2   0   0   0   0   0   0   0  10   0  15   5    41    0    0   1.007     33  0.54
  476  495 A   0   2   0   0   0   0   0  17   0   0   2   0   0  17   2   0  44   0   7   7    41    0    0   1.619     54  0.34
  477  496 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  478  497 A   0   2   0   0   0   0   0   0   2   0   5   0   0   0   2   5  10  73   0   0    41    0    0   1.022     34  0.57
  479  498 A  12   5   2   0   0   0   0   0  17   0   5  41   0   0   0   2   2  12   0   0    41    0    0   1.746     58  0.24
  480  499 A  22   0   5   0   0   0   0   0   0   0  17  56   0   0   0   0   0   0   0   0    41    0    0   1.106     36  0.42
  481  500 A   0  44  39  10   5   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    41    0    0   1.194     39  0.65
  482  501 A   0   0   0   0   0   0   0   0   0   0   7  93   0   0   0   0   0   0   0   0    41    0    0   0.262      8  0.87
  483  502 A   0   0   0   0   0   0   0   0  41   0  24  10   0   0   0   0   0   0   2  22    41    0    0   1.360     45  0.36
  484  503 A   2  10   0   5   0   0   0   0   0   0   0   0   0   0   2   0  80   0   0   0    41    0    0   0.730     24  0.57
  485  504 A  10   0  85   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.509     17  0.87
  486  505 A   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    41    0    0   0.000      0  1.00
  487  506 A   0   0   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   2   0    41    1    0   0.115      3  0.94
  488  507 A   0   5   0   0   3   0   0   5  10   5  45   8   0   0   0   0   3   3   3  13    40    0    0   1.862     62  0.26
  489  508 A   0   3   0   3   3   0   0   0   8   8  15   3   0   0   5   3   0   8  22  22    40    0    0   2.150     71  0.19
  490  509 A   0   0   2   2   0   0   0   7   2   7  17   7   0   0   0   0   0  10   5  39    41    0    0   1.889     63  0.30
  491  510 A   0   2   0   0   2   0   2   2  51   2  29   2   0   0   0   0   5   0   0   0    41    0    0   1.393     46  0.33
  492  511 A  39   0   2   0   0   0   0   0   0   2   2  34   0   0   5   2   2   0   5   5    41    0    0   1.629     54  0.23
  493  512 A   0   0   0   2   2   0  17  24   7   0   0   2   0  27   0   0   2   5   5   5    41    1    0   1.995     66  0.10
  494  513 A  10  15   3   5   0   0   0  10  41   0   0   5   0   0   3   0   0   0   8   0    39    0    0   1.810     60  0.19
  495  514 A   3   0   0   0   0   3   0   0   8   0  10   3   0   0  45   3  15  13   0   0    40    0    0   1.697     56  0.25
  496  515 A   8  75   8   3   5   0   0   0   0   0   3   0   0   0   0   0   0   0   0   0    40    0    0   0.939     31  0.77
  497  516 A  25   3   0   0  35   0  10   0  13   0   3  10   0   0   0   0   0   3   0   0    40    0    0   1.711     57  0.21
  498  517 A   3   0   0   0   5   0   0   0  17   0  68   5   0   0   0   0   0   0   3   0    40    0    0   1.054     35  0.46
  499  518 A   8   3   5   0   0   0   0   3   3   0   8  60   0   0   0   5   0   5   3   0    40    1    0   1.513     50  0.37
  500  519 A   3   0   0   0   0   0   0  79   0   0   3   0   0   0   0   0   0   3   0  13    39    0    0   0.728     24  0.76
  501  520 A   5   3   0   0   0   0   0  80   3   0   0   5   0   0   0   0   0   5   0   0    40    0    0   0.812     27  0.65
  502  521 A  10   0   0   0   0   0   0   3  22   3  10  17   0   3   3   0   5  20   5   0    40    0    0   2.092     69  0.20
  503  522 A   5   8   3   0   0   0   0   0  15   3   0  57   0   0   0   8   0   0   0   3    40    0    0   1.418     47  0.34
  504  523 A   3   0   0   0   0   0   0   0   5   0   3  13   0   3  20  10   5  28   3  10    40    0    0   2.066     68  0.21
  505  524 A  17   8   8   0   0   0   0   3   5   0   3   0   0   0   0   0   0   0  15  43    40    0    0   1.676     55  0.20
  506  525 A  68   3   3   0   3   0   0   0   3   0   0   0   0   0   5  10   8   0   0   0    40    0    0   1.209     40  0.38
  507  526 A   3   3   5   0   0   0   0   0   5   0  15   5   0   0  35  22   5   0   3   0    40    1    0   1.863     62  0.21
  508  527 A  28  36  13   3   0   0   0   3   8   0   3   0   0   0   3   0   0   5   0   0    39    3    2   1.713     57  0.39
  509  528 A   0   0   0   0   0   0   0   3   0   0   3   8   0   0  17   6  14   8   3  39    36    0    0   1.813     60  0.31
  510  529 A  57   3  35   0   0   0   0   0   3   0   0   0   0   0   0   3   0   0   0   0    40    0    0   0.962     32  0.75
  511  530 A   0   0   0   0   3   3  13   0   0   0  18  10   0  31   3  10   0   0  10   0    39    0    0   1.917     63  0.14
  512  531 A   0   0   3   0   0   0   0   3   8   3  13   3   0   0   0  21   3  15  26   5    39    0    0   2.045     68  0.26
  513  532 A  28  21  44   8   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    39    0    0   1.241     41  0.68
  514  533 A   5   0   0   0   0   0   0   3  10   0  21  23   0   3  15   5   5   0  10   0    39    0    0   2.063     68  0.17
  515  534 A   0   0   0   0   0   0   0   0   3   3  86   3   0   0   6   0   0   0   0   0    36    0    0   0.588     19  0.72
  516  535 A   3   0  14   0   0   0   0   0  19   0   6  58   0   0   0   0   0   0   0   0    36    0    0   1.167     38  0.40
  517  536 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0    32    0    0   0.000      0  1.00
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
    12   234   252     1 gDp
    12   398   417     4 sDDSLa
    13   233   259     1 nDe
    13   278   305     1 sAp
    13   395   423     7 tAPGAVQGs
    14    77    96     1 gSl
    14   232   252     1 gKk
    14   277   298     1 yDt
    14   284   306     8 nKSLPPQANw
    15    77    96     1 gSl
    15   232   252     1 gKk
    15   277   298     1 yDt
    15   284   306     8 nKSLPPQANw
    16    29    55     2 dAKe
    16   278   306     1 yDg
    16   279   308   148 gRGPEDSVIFEDFEGDKTLAARGWTATGDLTSASPAKGTLPGQNPVTGYLGQQLLNTFLNGDATIGTLTSSPFEISHKYINFLVGGGSNLNETAIRLKVN
     +                   GQTVHTSTGSNSEGLAWQSWDVSALQGKTAVIEIIDNSTGGWGHINVDQi
    16   285   462     8 qPATSTIANw
    16   395   580     4 sPAAGk
    17   233   256     1 gNk
    17   278   302     1 ySg
    17   279   304   150 gTTAPPSDSIIFADFEGTGTFTDLGWTPSGDLIGQSPVSGTLPGQQSVSGYLGKRLVNTFLDGDATTGTLTSRSFTISKRYINFLIGGGHDFNNTAVYLK
     +                   IDGEIVRSATGTNSETLSWQSWDVSSFLNQTAVIQIIDTATSGWDHINVDEi
    17   285   460     8 tMARSQVANw
    17   397   580     4 pAASGs
    18   232   256     1 dDd
    18   277   302     1 fSg
    18   278   304   150 gTTPPPRDSIIFADFEGTGTFADLGWTPSGDLIGQSPANGTLSGQNPVTGYLGKRLVNTFLNGDATTGTLTSKSFLISKRYINFLIGGGHDINNTAVHLK
     +                   VDGQILRSATGTNSESLSWQSWDVGSLLNQSAVIQIVDTVTGGWGHINVDEi
    18   284   460     8 sMARSQVANw
    18   396   580     4 pAIAEa
    19    29    55     2 dAKe
    19   278   306     1 yDg
    19   279   308   148 gRGPEDSVIFEDFEGDKTLAARGWTATGDLTSASPAKGTLPGQNPVTGYLGQQLLNTFLNGDATIGTLTSSPFEISHKYINFLVGGGSNLNETAIRLKVN
     +                   GQTVHTSTGSNSEGLAWQSWDVSALQGKTAVIEIIDNSTGGWGHINVDQi
    19   285   462     8 qPATSTIANw
    19   395   580     4 sPAAGk
    20    29    42     2 dAKe
    20   278   293     1 yDg
    20   279   295   148 gSGPEDSVIFEDFEGDKTFAARGWTATGDLTSASPSKGTLPGQNPVTGYLGQQLLNTFLNGDATIGTLTSTPFEISHKYINFLVGGGNNVNETAIRLKVD
     +                   GQVVHTSTGSNSEGLTWQSWDVSTLQGKRAVIEIIDNSTGGWGHINVDRi
    20   285   449     8 kRATNTIANw
    20   395   567     4 sPPTAk
    21   233   260     1 gDk
    21   278   306     1 hGg
    21   279   308   148 gGPPDGSFIFEDFEGNHSFSDRGWIATGDFIGTSPVAGTLPGQNPVTGYLGNQLVNTFLNGDATTGTLTSPSFTISYKYINFLIGGGDNINQTAIQLKID
     +                   GNVVYAATGSNSEQLTWQHWDVSAFQNQTAVIEIIDLATGGWGHINVDEi
    21   285   462     8 tPATNNNANw
    21   395   580     3 gTNGs
    22    29    55     2 dTDe
    22   278   306     1 yDg
    22   279   308   148 gSGPNDGMIFEDFEGDESLAARGWATTGDFINASPVRGTLSGQNAVTGFQGQQLFNTFLNGDATTGAITSAPFDITYKYINFLVGGGNDINETAIRLNVN
     +                   GKTVHASTGSNDEHLTWQSWDVSSLKGQRAVIEIIDNASDGWGHINVDQi
    22   285   462     8 tRATNQIANw
    22   398   583     1 nGl
    23    77    96     1 gSl
    23   232   252     1 gKk
    23   277   298   146 yDTSAPEDSVVFEDWNETSFAESSWKPTDDFVEQQPSNGQVLTLWQKGDETVGSLSSKKFTVSKKYIAFKIGCCNNPSNPETYGTTKDQETAINLIVDGQ
     +                   VVRSTTGVNGGDVIWASWNVASLIGKTAYIELVDRATGGWGHLDVGEi
    23   283   450     7 kSLPPQANw
    24    77    96     1 gSl
    24   232   252     1 gKk
    24   277   298     1 yDt
    24   278   300   144 tSAPEDSVVFEDWNETSFAESSWKPTDDFVEQRPSNGQVLTLWQKGDETVGSLSSKKFTVSKKYIAFKIGCCNNPYNPETYGTTKDQETAINLIVDGQVV
     +                   RSTTGVNGGDIIWASWNVASLIGKTAYIELVDRATGGWGHLDVGEi
    24   284   450     7 kSLPPQANw
    25   193   225     1 gKn
    25   409   442     1 gDk
    26   193   225     1 gKn
    26   409   442     1 gEk
    27    77    96     1 gSl
    27   232   252     1 gKk
    27   277   298     1 hDa
    27   278   300   144 aSAPIDSVVFEDWNETSFAESSWKPTGDFVQQQPSNGQVLTLWEKGDESVGTLSSKRFTVSKKYIAFKIGCCNNPYNPETYGTTADQETAINLIVDGQVV
     +                   RSTTGVNGGDIVWTSWNVANLIGKTAYIQLVDRATGGWGHLDVGEi
    27   284   450     7 kSLPPQANw
    28   205   259     1 gNe
    28   248   303     2 dINw
    29   192   226     1 gKn
    29   472   507     1 gLk
    30   190   194     1 gAe
    30   256   261     2 aVLw
    30   274   281     2 nRAd
    30   355   364     1 gTf
    31   154   173     1 gRg
    31   209   229     1 gDp
    31   252   273     1 aAp
    31   253   275     7 pAGVSTLGd
    31   259   288     7 aAALQQCLw
    31   358   394     1 lLl
    31   372   409     6 aEILPGSa
    32    77   102     1 gQv
    32   232   258     1 gNt
    32   250   277     2 tAGs
    32   273   302     1 yDs
    32   274   304   152 sLPPAGSTVFQNFEGSSYSALGWTATGALAGQAPARETIPGMEGNQLADTYGTGDSSVSTLTSPPFTITTSYINFLVSGGYHPYDPATYGTSMDTETAVN
     +                   LLINGKVVQSTTGSNGIELVWRSWDVSGYNGQVAQIQIVDNNTGTTGWGHILVd
    32   280   462     8 sDVSKQEANw
    32   392   582     1 kPg
    32   405   596     1 gAn
    33    40    62     2 pHDt
    33   189   213     1 gSd
    33   192   217     1 qHi
    33   210   236     1 eDp
    33   223   250     7 gDRNGVNPd
    33   257   291     3 dAIKw
    33   275   312     2 pNEd
    34   153   172     2 gEQg
    34   208   229     1 gDq
    34   251   273     1 pVp
    34   252   275     7 pGGISALGd
    34   258   288     7 aAALQQCLw
    34   357   394     1 lPd
    34   371   409     4 iLPGSa
    35   158   171     2 gGGe
    35   257   272     4 eGLQEd
    35   263   282     3 rEYGw
    36   233   255     1 gNe
    36   275   298    20 nTPPPSPTSTSVSTSASTGTQt
    36   278   321     1 tTs
    36   279   323   307 sCCPGPTEDVTFQDFEGTADFASRGWVATGELVGAAPAQGTLSGQQTVSGYTGTRLVNTFLNGDSTTGTLTSPPFTITRPFINFLIGGGNAPGAECINLK
     +                   IQGQSQAVRTATGRNEEKLLSHTWDVTEYIGQTAVLEIVDQQTGGWGHILIDEITFTGDATPSPPSGDGVFDFNGTSTFASRGWTATGDLVGKSPAQGTL
     +                   MGQQLVSGYRGNFVNTFYDGDATTGTLVSPTFTITKKRINFLIGGGNAPGLQCINLKVDGQVVRTATGSDSEQLLPKSWDVTGLIGESAVIEIADLSTTS
     +                   WGHILVDEi
    36   285   636     8 vSEEPRGTNw
    36   396   755     2 sASs
    37    41    47     2 pHDt
    37   190   198     1 gSd
    37   193   202     1 pHi
    37   211   221     1 eDl
    37   224   235     7 gDRNGVNPd
    37   258   276     3 dTIKw
    37   276   297     2 sNEd
    38   175   209     1 gDd
    38   197   232     4 sWRWPs
    38   220   259   123 aTGDLIGTSPVAGTLPGQNPVTGFLGNQLVNTFLNVDSTTGILTSPSFDISYNYINLLVGGGDNINQTAIRLKIDGNIVHATTGSNSEHLPGKTGIAVIE
     +                   IIDLATGDWGHINVGEISFANSRAt
    39   155   174     1 gPy
    39   208   228     1 gDp
    39   251   272     1 aAp
    39   252   274     7 pAGVSSLGd
    39   258   287     7 tAALRRCLw
    39   357   393     1 lPd
    39   371   408     4 iLPGSa
    40    29    80     1 dEn
    40   220   272     7 yTMLISINp
    40   268   327     1 aAd
    40   291   351     6 gEEVGDGf
    40   311   377     1 gLt
    40   358   425     7 tGLATDKLg
    40   394   468     3 gFKNp
    40   463   540     1 sVg
//