Complet list of 1xar hssp fileClick here to see the 3D structure Complete list of 1xar.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1XAR
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-05-12
HEADER     SUGAR BINDING PROTEIN                   26-AUG-04   1XAR
COMPND     MOL_ID: 1; MOLECULE: CD209 ANTIGEN-LIKE PROTEIN 1; CHAIN: A, B; FRAGME
SOURCE     MOL_ID: 1; ORGANISM_SCIENTIFIC: HOMO SAPIENS; ORGANISM_COMMON: HUMAN; 
AUTHOR     H.FEINBERG,Y.GUO,D.A.MITCHELL,K.DRICKAMER,W.I.WEIS
DBREF      1XAR A  216   399  UNP    Q9H2X3   209L1_HUMAN    216    399
DBREF      1XAR B  216   399  UNP    Q9H2X3   209L1_HUMAN    216    399
SEQLENGTH   146
NCHAIN        2 chain(s) in 1XAR data set
KCHAIN        1 chain(s) used here ; chains(s) : A
NALIGN      280
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : B4E2Z5_HUMAN        1.00  1.00    1  146  200  345  146    0    0  348  B4E2Z5     cDNA FLJ52840, highly similar to C-type lectin domain family 4 member M OS=Homo sapiens PE=2 SV=1
    2 : CLC4M_HUMAN 1K9J    1.00  1.00    1  146  251  396  146    0    0  399  Q9H2X3     C-type lectin domain family 4 member M OS=Homo sapiens GN=CLEC4M PE=1 SV=1
    3 : E7ENS9_HUMAN        1.00  1.00    1  146  239  384  146    0    0  387  E7ENS9     C-type lectin domain family 4 member M OS=Homo sapiens GN=CLEC4M PE=2 SV=1
    4 : H7BXE2_HUMAN        1.00  1.00    1  146  229  374  146    0    0  377  H7BXE2     C-type lectin domain family 4 member M OS=Homo sapiens GN=CLEC4M PE=2 SV=1
    5 : H7BXU4_HUMAN        1.00  1.00    1  146  200  345  146    0    0  348  H7BXU4     C-type lectin domain family 4 member M OS=Homo sapiens GN=CLEC4M PE=2 SV=1
    6 : Q2TB20_HUMAN        1.00  1.00    1  146  239  384  146    0    0  387  Q2TB20     CLEC4M protein OS=Homo sapiens GN=CLEC4M PE=2 SV=1
    7 : M0QYX2_HUMAN        0.98  0.99    1  146  184  329  146    0    0  332  M0QYX2     C-type lectin domain family 4 member M OS=Homo sapiens GN=CLEC4M PE=2 SV=1
    8 : B2BSM3_PANPA        0.97  0.99    1  146  251  396  146    0    0  399  B2BSM3     Immunity adhesion receptor L-SIGN OS=Pan paniscus PE=4 SV=1
    9 : CLC4M_GORGO         0.97  0.99    1  146  228  373  146    0    0  376  Q8HY06     C-type lectin domain family 4 member M OS=Gorilla gorilla gorilla GN=CLEC4M PE=3 SV=1
   10 : CLC4M_PANTR         0.97  0.99    1  146  297  442  146    0    0  445  Q8HYC0     C-type lectin domain family 4 member M OS=Pan troglodytes GN=CLEC4M PE=2 SV=1
   11 : CLC4M_HYLSY         0.95  0.98    1  146  274  419  146    0    0  422  Q8HY11     C-type lectin domain family 4 member M OS=Hylobates syndactylus GN=CLEC4M PE=3 SV=1
   12 : H2NXC1_PONAB        0.95  0.97    1  146  159  303  146    1    1  306  H2NXC1     Uncharacterized protein OS=Pongo abelii GN=CLEC4M PE=4 SV=1
   13 : B2BSM5_NOMLE        0.93  0.98    1  146  228  373  146    0    0  376  B2BSM5     Immunity adhesion receptor L-SIGN OS=Nomascus leucogenys PE=4 SV=1
   14 : CLC4M_HYLLA         0.92  0.99    1  146  251  396  146    0    0  399  Q8HY12     C-type lectin domain family 4 member M OS=Hylobates lar GN=CLEC4M PE=3 SV=1
   15 : CLC4M_NOMCO         0.92  0.99    1  146  251  396  146    0    0  399  Q8HY10     C-type lectin domain family 4 member M OS=Nomascus concolor GN=CLEC4M PE=3 SV=1
   16 : B4E2A8_HUMAN        0.81  0.96   32  144    1  113  113    0    0  135  B4E2A8     cDNA FLJ61677, highly similar to CD209 antigen OS=Homo sapiens PE=2 SV=1
   17 : M0QZG5_HUMAN        0.81  0.94    1  144  169  312  144    0    0  334  M0QZG5     CD209 antigen OS=Homo sapiens GN=CD209 PE=4 SV=1
   18 : M0R0P0_HUMAN        0.81  0.94    1  144  103  246  144    0    0  268  M0R0P0     CD209 antigen OS=Homo sapiens GN=CD209 PE=4 SV=1
   19 : F7AB99_MACMU        0.80  0.94    1  144  169  312  144    0    0  334  F7AB99     CD209 antigen (Fragment) OS=Macaca mulatta GN=CD209 PE=4 SV=1
   20 : F7ABX8_MACMU        0.80  0.94    1  144  103  246  144    0    0  268  F7ABX8     CD209 antigen OS=Macaca mulatta GN=CD209 PE=4 SV=1
   21 : B2BSN0_NOMLE        0.79  0.93    1  144   91  234  144    0    0  256  B2BSN0     Immunity adhesion receptor CD209L2 OS=Nomascus leucogenys PE=4 SV=1
   22 : B2BSM9_HYLLA        0.78  0.93    1  144   91  234  144    0    0  256  B2BSM9     Immunity adhesion receptor CD209L2 OS=Hylobates lar PE=4 SV=1
   23 : B2BSN1_HYLSY        0.78  0.93    1  144   91  234  144    0    0  256  B2BSN1     Immunity adhesion receptor CD209L2 OS=Hylobates syndactylus PE=4 SV=1
   24 : F6UHB2_CALJA        0.78  0.92    1  144  115  258  144    0    0  264  F6UHB2     Uncharacterized protein OS=Callithrix jacchus GN=CD209 PE=4 SV=1
   25 : F7I6J1_CALJA        0.78  0.92    1  144  183  326  144    0    0  332  F7I6J1     Uncharacterized protein OS=Callithrix jacchus GN=CD209 PE=4 SV=1
   26 : B2BSM6_PANPA        0.77  0.92    1  144   91  234  144    0    0  256  B2BSM6     Immunity adhesion receptor CD209L2 OS=Pan paniscus PE=4 SV=1
   27 : B2BSM8_PONPY        0.77  0.93    1  144   91  234  144    0    0  256  B2BSM8     Immunity adhesion receptor CD209L2 OS=Pongo pygmaeus PE=4 SV=1
   28 : B2BSN2_PAPHA        0.77  0.92    2  144   92  234  143    0    0  256  B2BSN2     Immunity adhesion receptor CD209L2 OS=Papio hamadryas PE=4 SV=1
   29 : 209L2_MACMU         0.76  0.92    2  144   92  234  143    0    0  256  Q8MIS5     CD209 antigen-like protein 2 OS=Macaca mulatta GN=CD209L2 PE=1 SV=1
   30 : B2BSM7_PANTR        0.76  0.92    1  144   91  234  144    0    0  256  B2BSM7     Immunity adhesion receptor CD209L2 OS=Pan troglodytes PE=4 SV=1
   31 : B2BSN3_CHLAE        0.76  0.92    2  144   92  234  143    0    0  256  B2BSN3     Immunity adhesion receptor CD209L2 OS=Chlorocebus aethiops PE=4 SV=1
   32 : B2BSN4_CALJA        0.76  0.91    2  144   91  233  143    0    0  256  B2BSN4     Immunity adhesion receptor CD209L2 OS=Callithrix jacchus PE=2 SV=1
   33 : F6W6N4_CALJA        0.76  0.91    2  144   91  233  143    0    0  255  F6W6N4     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
   34 : H2RDI9_PANTR        0.76  0.92    1  144   91  234  144    0    0  256  H2RDI9     Uncharacterized protein OS=Pan troglodytes GN=CD209L2 PE=4 SV=1
   35 : F6TG23_HORSE        0.69  0.87    2  144   79  221  143    0    0  226  F6TG23     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100629660 PE=4 SV=1
   36 : F7ABI7_MACMU        0.69  0.79    2  145   92  238  147    3    3  238  F7ABI7     Uncharacterized protein OS=Macaca mulatta GN=CLEC4G PE=4 SV=1
   37 : H0XUL8_OTOGA        0.69  0.84    1  144   91  234  144    0    0  242  H0XUL8     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
   38 : I3N131_SPETR        0.68  0.83    2  144   93  234  143    1    1  239  I3N131     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
   39 : I3NEH4_SPETR        0.68  0.85    1  143    4  145  143    1    1  151  I3NEH4     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
   40 : G3SWJ3_LOXAF        0.66  0.83    1  144   65  207  144    1    1  212  G3SWJ3     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
   41 : G3HWX3_CRIGR        0.64  0.82    4  143    1  139  140    1    1  145  G3HWX3     CD209 antigen-like protein C OS=Cricetulus griseus GN=I79_015486 PE=4 SV=1
   42 : C209D_MOUSE         0.63  0.79    1  144   88  231  145    2    2  237  Q91ZW8     CD209 antigen-like protein D OS=Mus musculus GN=Cd209d PE=2 SV=1
   43 : D3ZXN3_RAT          0.63  0.81    1  144   88  231  145    2    2  237  D3ZXN3     Protein Clec4m OS=Rattus norvegicus GN=Clec4m PE=4 SV=1
   44 : Q3UW57_MOUSE        0.63  0.79    1  144   88  231  145    2    2  237  Q3UW57     Putative uncharacterized protein OS=Mus musculus GN=Cd209d PE=2 SV=1
   45 : G1T070_RABIT        0.62  0.86    2  144   93  234  143    1    1  239  G1T070     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
   46 : I3MYA8_SPETR        0.61  0.81    1  144   62  204  144    1    1  209  I3MYA8     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
   47 : C209E_MOUSE         0.60  0.83    1  144   60  202  144    1    1  208  Q91ZW7     CD209 antigen-like protein E OS=Mus musculus GN=Cd209e PE=2 SV=1
   48 : D3ZCF3_RAT          0.60  0.81    1  144   60  202  144    1    1  207  D3ZCF3     Protein Cd209e OS=Rattus norvegicus GN=Cd209e PE=4 SV=1
   49 : D3ZP17_RAT          0.60  0.78    1  144   93  235  144    1    1  240  D3ZP17     Protein Cd209a OS=Rattus norvegicus GN=Cd209a PE=4 SV=2
   50 : H0UTM1_CAVPO        0.60  0.81    1  144   97  239  144    1    1  244  H0UTM1     Uncharacterized protein OS=Cavia porcellus GN=LOC100715591 PE=4 SV=1
   51 : I3MW17_SPETR        0.60  0.79    1  144   97  239  144    1    1  244  I3MW17     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
   52 : Q2TA59_MOUSE        0.60  0.80    1  141    4  143  141    1    1  151  Q2TA59     Cd209a protein OS=Mus musculus GN=Cd209a PE=2 SV=1
   53 : Q3KNN8_MOUSE        0.60  0.83    1  144   60  202  144    1    1  208  Q3KNN8     CD209e antigen OS=Mus musculus GN=Cd209e PE=2 SV=1
   54 : C209A_MOUSE         0.59  0.78    1  144   91  233  144    1    1  238  Q91ZX1     CD209 antigen-like protein A OS=Mus musculus GN=Cd209a PE=2 SV=1
   55 : C209C_MOUSE         0.59  0.79    1  143   31  172  143    1    1  178  Q91ZW9     CD209 antigen-like protein C OS=Mus musculus GN=Cd209c PE=2 SV=1
   56 : L8Y185_TUPCH        0.59  0.85    2  144   44  186  143    0    0  191  L8Y185     CD209 antigen-like protein 2 (Fragment) OS=Tupaia chinensis GN=TREES_T100020107 PE=4 SV=1
   57 : F1LVS3_RAT          0.58  0.77    1  141   59  197  141    1    2  205  F1LVS3     Protein LOC688858 (Fragment) OS=Rattus norvegicus GN=LOC688858 PE=4 SV=2
   58 : Q3KNN7_MOUSE        0.58  0.83    1  144   60  202  144    1    1  208  Q3KNN7     CD209e antigen OS=Mus musculus GN=Cd209e PE=2 SV=1
   59 : F1LXR5_RAT          0.55  0.77    1  143   30  171  143    1    1  177  F1LXR5     Protein Cd209c (Fragment) OS=Rattus norvegicus GN=Cd209c PE=4 SV=1
   60 : H0W9A9_CAVPO        0.55  0.77    2  143   60  200  142    1    1  210  H0W9A9     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100728135 PE=4 SV=1
   61 : F1M1A9_RAT          0.54  0.71    2  144   58  198  143    2    2  204  F1M1A9     Uncharacterized protein (Fragment) OS=Rattus norvegicus GN=RGD1564571 PE=4 SV=2
   62 : L5KC61_PTEAL        0.54  0.80    2  136   10  144  135    0    0  144  L5KC61     CD209 antigen OS=Pteropus alecto GN=PAL_GLEAN10002121 PE=4 SV=1
   63 : M0RAC1_RAT          0.51  0.68    2  143   64  204  142    1    1  211  M0RAC1     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
   64 : D2HI89_AILME        0.50  0.77    2  144   19  158  143    1    3  158  D2HI89     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_010895 PE=4 SV=1
   65 : M0R5H7_RAT          0.49  0.68    2  143   58  203  148    3    8  210  M0R5H7     Protein LOC100363914 OS=Rattus norvegicus GN=LOC100363914 PE=4 SV=1
   66 : M0R3U8_RAT          0.48  0.66    2  143   48  198  152    4   11  203  M0R3U8     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
   67 : M0RAI7_RAT          0.48  0.66    2  143   58  206  151    4   11  213  M0RAI7     Protein LOC100363914 OS=Rattus norvegicus GN=LOC100363914 PE=4 SV=1
   68 : I3JZF9_ORENI        0.40  0.63   18  141   17  137  127    4    9  139  I3JZF9     Uncharacterized protein OS=Oreochromis niloticus PE=4 SV=1
   69 : F7EEU3_MONDO        0.39  0.54    2  140   50  192  147    9   12  192  F7EEU3     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=CLEC4E PE=4 SV=1
   70 : M3XV14_MUSPF        0.39  0.60    2  145   41  181  147    5    9  181  M3XV14     Uncharacterized protein OS=Mustela putorius furo GN=CLEC17A PE=4 SV=1
   71 : Q3U271_MOUSE        0.39  0.55   18  143   15  144  132    4    8  149  Q3U271     Putative uncharacterized protein OS=Mus musculus GN=Clec4e PE=2 SV=1
   72 : V8N8Q5_OPHHA        0.39  0.62    7  142   10  143  138    5    6  148  V8N8Q5     Uncharacterized protein (Fragment) OS=Ophiophagus hannah GN=L345_15813 PE=4 SV=1
   73 : H3A3R7_LATCH        0.38  0.57   22  140   20  141  128    5   15  141  H3A3R7     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
   74 : H3A3R8_LATCH        0.38  0.58   18  142    1  134  137    5   15  138  H3A3R8     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
   75 : I3K3T8_ORENI        0.38  0.62    3  141   20  159  143    4    7  160  I3K3T8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
   76 : L8IZB8_9CETA        0.38  0.55    2  145  168  322  158    7   17  322  L8IZB8     C-type lectin domain family 17, member A (Fragment) OS=Bos mutus GN=M91_00836 PE=4 SV=1
   77 : G3HWX1_CRIGR        0.37  0.53    1  145  255  399  152    9   14  399  G3HWX1     C-type lectin domain family 4 member G OS=Cricetulus griseus GN=I79_015484 PE=4 SV=1
   78 : G3SMQ2_LOXAF        0.37  0.55    2  146   63  206  154    7   19  212  G3SMQ2     Uncharacterized protein OS=Loxodonta africana GN=CLEC4D PE=4 SV=1
   79 : I3KF21_ORENI        0.37  0.54    4  141   15  162  152    8   18  164  I3KF21     Uncharacterized protein OS=Oreochromis niloticus GN=LOC102078188 PE=4 SV=1
   80 : M3WHV1_FELCA        0.37  0.54    1  142   60  208  153    9   15  219  M3WHV1     Uncharacterized protein OS=Felis catus GN=CLEC4E PE=4 SV=1
   81 : M3ZF81_XIPMA        0.37  0.58    2  142   45  181  151    8   24  184  M3ZF81     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=4 SV=1
   82 : CLC4E_HUMAN 3WH2    0.36  0.54    1  141   63  207  150    9   14  219  Q9ULY5     C-type lectin domain family 4 member E OS=Homo sapiens GN=CLEC4E PE=1 SV=1
   83 : CLC4E_MOUSE         0.36  0.53    2  142   64  208  151    9   16  214  Q9R0Q8     C-type lectin domain family 4 member E OS=Mus musculus GN=Clec4e PE=1 SV=1
   84 : F6RZF6_ORNAN        0.36  0.57    1  142  124  266  150    8   15  270  F6RZF6     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100081235 PE=4 SV=2
   85 : F7I1U1_CALJA        0.36  0.52    1  142   63  208  151    9   14  219  F7I1U1     C-type lectin domain family 4 member E OS=Callithrix jacchus GN=CLEC4E PE=2 SV=1
   86 : G1QZ28_NOMLE        0.36  0.57    2  145   90  230  151    6   17  230  G1QZ28     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=CLEC17A PE=4 SV=1
   87 : G1SWQ7_RABIT        0.36  0.54    3  142   65  208  147    7   10  218  G1SWQ7     Uncharacterized protein OS=Oryctolagus cuniculus GN=CLEC4E PE=4 SV=2
   88 : G3R942_GORGO        0.36  0.53    1  141   63  207  150    9   14  219  G3R942     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101135130 PE=4 SV=1
   89 : G3TN20_LOXAF        0.36  0.52    1  142   71  212  150    8   16  216  G3TN20     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=CLEC4E PE=4 SV=1
   90 : G7N5W2_MACMU        0.36  0.52    1  146   65  212  154    9   14  212  G7N5W2     C-type lectin superfamily member 7 OS=Macaca mulatta GN=EGK_03320 PE=4 SV=1
   91 : G8F4P5_MACFA        0.36  0.53    1  146   65  212  154    9   14  212  G8F4P5     C-type lectin superfamily member 7 OS=Macaca fascicularis GN=EGM_20515 PE=4 SV=1
   92 : H0VD62_CAVPO        0.36  0.57    1  142   63  208  152    9   16  210  H0VD62     Uncharacterized protein OS=Cavia porcellus GN=CLEC4E PE=4 SV=1
   93 : H2Q5D5_PANTR        0.36  0.54    1  141   63  207  150    9   14  219  H2Q5D5     Uncharacterized protein OS=Pan troglodytes GN=CLEC4E PE=4 SV=1
   94 : H2UKT8_TAKRU        0.36  0.58    7  141    1  139  143    6   12  139  H2UKT8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101073695 PE=4 SV=1
   95 : H2VC62_TAKRU        0.36  0.57   10  141   10  148  143    5   15  156  H2VC62     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068741 PE=4 SV=1
   96 : I3JIP1_ORENI        0.36  0.62    2  141    8  146  143    4    7  146  I3JIP1     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
   97 : I3JIP4_ORENI        0.36  0.62    2  141   17  152  143    5   10  154  I3JIP4     Uncharacterized protein OS=Oreochromis niloticus GN=LOC102078189 PE=4 SV=1
   98 : L0N7P8_ONCMY        0.36  0.61    2  141   76  216  148    8   15  216  L0N7P8     CD209 antigen-like protein A OS=Oncorhynchus mykiss GN=cd209A PE=2 SV=1
   99 : L9KY31_TUPCH        0.36  0.54    4  143    1  148  150    8   12  157  L9KY31     C-type lectin domain family 4 member E OS=Tupaia chinensis GN=TREES_T100002741 PE=4 SV=1
  100 : M3YZ82_MUSPF        0.36  0.57    1  142   63  208  150    7   12  212  M3YZ82     C-type lectin domain family 4, member E OS=Mustela putorius furo PE=2 SV=1
  101 : Q4FK29_MOUSE        0.36  0.53    2  142   64  208  151    9   16  214  Q4FK29     C-type lectin domain family 4, member e, isoform CRA_a OS=Mus musculus GN=Clec4e PE=2 SV=1
  102 : S7MVR9_MYOBR        0.36  0.57    2  145  116  256  151    6   17  256  S7MVR9     C-type lectin domain family 17, member A OS=Myotis brandtii GN=D623_10002691 PE=4 SV=1
  103 : U6DAY7_NEOVI        0.36  0.56    1  143   27  173  149    5    8  176  U6DAY7     C-type lectin domain family 4 member E (Fragment) OS=Neovison vison GN=CLC4E PE=2 SV=1
  104 : D2HIZ0_AILME        0.35  0.56    1  142   52  197  152    9   16  200  D2HIZ0     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_011227 PE=4 SV=1
  105 : F1PPJ0_CANFA        0.35  0.57    1  142   63  208  150    7   12  226  F1PPJ0     Uncharacterized protein OS=Canis familiaris GN=CLEC4E PE=4 SV=2
  106 : F6VIW2_HORSE        0.35  0.54    1  142   63  208  151    9   14  211  F6VIW2     Uncharacterized protein OS=Equus caballus GN=CLEC4E PE=4 SV=1
  107 : F7HZI6_CALJA        0.35  0.53    2  146   68  214  154    9   16  215  F7HZI6     Uncharacterized protein OS=Callithrix jacchus GN=CLEC4D PE=4 SV=1
  108 : G1M451_AILME        0.35  0.56    1  142   63  208  152    9   16  218  G1M451     Uncharacterized protein OS=Ailuropoda melanoleuca GN=CLEC4E PE=4 SV=1
  109 : G1QE83_MYOLU        0.35  0.56    2  146   67  211  151    7   12  212  G1QE83     Uncharacterized protein OS=Myotis lucifugus GN=CLEC4D PE=4 SV=1
  110 : G1QMW3_NOMLE        0.35  0.55    1  141   63  207  150    9   14  218  G1QMW3     Uncharacterized protein OS=Nomascus leucogenys GN=CLEC4E PE=4 SV=1
  111 : G3NXR3_GASAC        0.35  0.57   15  144    6  149  147    6   20  156  G3NXR3     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  112 : H0WHL2_OTOGA        0.35  0.53    2  146   60  211  155    9   13  211  H0WHL2     Uncharacterized protein OS=Otolemur garnettii GN=CLEC4E PE=4 SV=1
  113 : H2MGG4_ORYLA        0.35  0.55    2  144   48  186  151   10   20  187  H2MGG4     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
  114 : H2NGE6_PONAB        0.35  0.53    1  141   63  207  150    9   14  219  H2NGE6     Uncharacterized protein OS=Pongo abelii GN=CLEC4E PE=4 SV=1
  115 : H2RRN8_TAKRU        0.35  0.59   18  141   12  141  136    6   18  148  H2RRN8     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  116 : H3D6A6_TETNG        0.35  0.59    2  141   66  208  150    8   17  208  H3D6A6     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
  117 : I3JBT7_ORENI        0.35  0.52    4  144   14  164  153    5   14  167  I3JBT7     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  118 : I3KML2_ORENI        0.35  0.53   18  143    1  134  136    5   12  139  I3KML2     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC102079749 PE=4 SV=1
  119 : L8HVX7_9CETA        0.35  0.53    2  146   60  206  152    7   12  207  L8HVX7     C-type lectin domain family 4 member D (Fragment) OS=Bos mutus GN=M91_11251 PE=4 SV=1
  120 : M3VWI6_FELCA        0.35  0.49    1  146   31  178  154    6   14  178  M3VWI6     Uncharacterized protein (Fragment) OS=Felis catus GN=CLEC6A PE=4 SV=1
  121 : M3W720_FELCA        0.35  0.55    2  146   69  217  153    8   12  223  M3W720     Uncharacterized protein (Fragment) OS=Felis catus GN=CLEC4D PE=4 SV=1
  122 : W5MKA9_LEPOC        0.35  0.55    2  144   45  192  153    8   15  193  W5MKA9     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  123 : W5MQF2_LEPOC        0.35  0.60    4  142    9  140  139    3    7  141  W5MQF2     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  124 : B1AR34_MOUSE        0.34  0.53    2  142  110  250  152    9   22  255  B1AR34     Asialoglycoprotein receptor 1 OS=Mus musculus GN=Asgr1 PE=4 SV=1
  125 : C1BX79_ESOLU        0.34  0.55    1  140   77  211  148    7   21  219  C1BX79     C-type lectin domain family 4 member E OS=Esox lucius GN=CLC4E PE=2 SV=1
  126 : CLC4G_MOUSE         0.34  0.54    1  146  149  294  153    9   14  294  Q8BNX1     C-type lectin domain family 4 member G OS=Mus musculus GN=Clec4g PE=2 SV=1
  127 : E1BHM0_BOVIN4KZW    0.34  0.52    3  146   64  211  153    9   14  214  E1BHM0     Uncharacterized protein OS=Bos taurus GN=CLEC4E PE=1 SV=1
  128 : F1N4H1_BOVIN        0.34  0.52    2  146   69  212  151    7   13  213  F1N4H1     Uncharacterized protein OS=Bos taurus GN=CLEC4D PE=4 SV=2
  129 : F6QUQ3_HORSE        0.34  0.54    1  146   87  236  153    6   10  236  F6QUQ3     Uncharacterized protein OS=Equus caballus GN=CLEC4A PE=4 SV=1
  130 : G1PIL3_MYOLU        0.34  0.53    1  146   66  212  153    8   13  214  G1PIL3     Uncharacterized protein OS=Myotis lucifugus GN=CLEC4E PE=4 SV=1
  131 : G7N5X0_MACMU        0.34  0.54    1  141   63  207  151    9   16  219  G7N5X0     C-type lectin superfamily member 9 OS=Macaca mulatta GN=EGK_03329 PE=4 SV=1
  132 : G7PJQ7_MACFA        0.34  0.54    1  141   63  207  151    9   16  219  G7PJQ7     C-type lectin superfamily member 9 OS=Macaca fascicularis GN=EGM_02944 PE=4 SV=1
  133 : H2RJB7_TAKRU        0.34  0.56    7  141   10  152  149    8   20  161  H2RJB7     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  134 : H2RMX3_TAKRU        0.34  0.56    7  141   10  152  149    8   20  161  H2RMX3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  135 : H2RZS9_TAKRU        0.34  0.58    1  141    7  150  149    6   13  150  H2RZS9     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  136 : H3BYZ6_TETNG        0.34  0.60    2  141    5  145  146    5   11  153  H3BYZ6     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
  137 : H3D482_TETNG        0.34  0.59    7  143    5  143  147    9   18  149  H3D482     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
  138 : I3KV78_ORENI        0.34  0.56   17  143    1  139  142    6   18  139  I3KV78     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  139 : I3KV80_ORENI        0.34  0.59    2  143   19  155  149    6   19  155  I3KV80     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC102082226 PE=4 SV=1
  140 : I3KZX7_ORENI        0.34  0.54    1  141    9  152  149    7   13  154  I3KZX7     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (56 of 57) PE=4 SV=1
  141 : I3LXF1_SPETR        0.34  0.54    1  145  149  293  153    9   16  293  I3LXF1     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=CLEC4G PE=4 SV=1
  142 : K7E980_ORNAN        0.34  0.56    1  145  113  258  154   10   17  258  K7E980     Uncharacterized protein OS=Ornithorhynchus anatinus GN=CLEC4G PE=4 SV=1
  143 : K9J6J5_PIG          0.34  0.52    2  146   87  237  157    8   18  237  K9J6J5     C-type lectin domain family 4 member A isoform 1 OS=Sus scrofa GN=CLEC4A_tv1 PE=2 SV=1
  144 : L8Y105_TUPCH        0.34  0.53    1  145   93  237  152    9   14  237  L8Y105     C-type lectin domain family 4 member G OS=Tupaia chinensis GN=TREES_T100020108 PE=4 SV=1
  145 : M4B0E1_XIPMA        0.34  0.54    2  145   21  161  151    6   17  161  M4B0E1     Uncharacterized protein OS=Xiphophorus maculatus GN=CLEC19A (16 of 18) PE=4 SV=1
  146 : S7MLK6_MYOBR        0.34  0.57    2  146   57  200  151    7   13  201  S7MLK6     C-type lectin domain family 4 member D (Fragment) OS=Myotis brandtii GN=D623_10003161 PE=4 SV=1
  147 : W5MKF3_LEPOC        0.34  0.53    1  140   71  209  152    9   25  217  W5MKF3     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  148 : CLC4D_HUMAN 2LS8    0.33  0.54    2  146   68  214  155    9   18  215  Q8WXI8     C-type lectin domain family 4 member D OS=Homo sapiens GN=CLEC4D PE=1 SV=2
  149 : E1BAZ1_BOVIN        0.33  0.52    2  146   92  237  154   10   17  237  E1BAZ1     Uncharacterized protein OS=Bos taurus GN=CLEC4A PE=4 SV=1
  150 : E9PT25_RAT          0.33  0.50    1  146   87  237  160   12   23  237  E9PT25     Protein Clec4a3 OS=Rattus norvegicus GN=Clec4a3 PE=4 SV=1
  151 : F1C6Y7_PERFV        0.33  0.53    3  140   70  224  159    9   25  224  F1C6Y7     C-type lectin domain family 4 member m (Fragment) OS=Perca flavescens GN=CLEC4M PE=2 SV=1
  152 : F6NE55_DANRE        0.33  0.57    2  141   48  184  149    6   21  188  F6NE55     Uncharacterized protein OS=Danio rerio GN=si:dkey-181c13.1 PE=4 SV=1
  153 : F6T1E5_HORSE        0.33  0.47    1  146   59  209  159    8   21  209  F6T1E5     Uncharacterized protein OS=Equus caballus GN=CLEC6A PE=4 SV=1
  154 : G1PNH3_MYOLU        0.33  0.49    1  146   68  212  156    8   21  212  G1PNH3     Uncharacterized protein OS=Myotis lucifugus GN=CLEC6A PE=4 SV=1
  155 : G1QMT9_NOMLE        0.33  0.54    2  146   68  214  155    9   18  215  G1QMT9     Uncharacterized protein OS=Nomascus leucogenys GN=CLEC4D PE=4 SV=1
  156 : G1TBB7_RABIT        0.33  0.51    1  145  149  294  156    9   21  294  G1TBB7     Uncharacterized protein OS=Oryctolagus cuniculus GN=CLEC4G PE=4 SV=1
  157 : G3QY02_GORGO        0.33  0.53    2  146   68  215  156   10   19  216  G3QY02     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101134765 PE=4 SV=1
  158 : G3T558_LOXAF        0.33  0.49    1  146   71  212  156    9   24  212  G3T558     Uncharacterized protein OS=Loxodonta africana GN=LOC100655828 PE=4 SV=1
  159 : G5CAT3_HETGA        0.33  0.51    1  142   63  206  151    9   16  212  G5CAT3     C-type lectin domain family 4 member E OS=Heterocephalus glaber GN=GW7_12142 PE=4 SV=1
  160 : G7N5W9_MACMU        0.33  0.52    2  146   68  214  154    9   16  215  G7N5W9     C-type lectin superfamily member 8 OS=Macaca mulatta GN=EGK_03328 PE=4 SV=1
  161 : G7PYX0_MACFA        0.33  0.49    1  145   90  231  152    9   17  231  G7PYX0     C-type lectin domain family 4 member G OS=Macaca fascicularis GN=EGM_09184 PE=4 SV=1
  162 : H0X071_OTOGA        0.33  0.52    3  146   75  218  150    6   12  219  H0X071     Uncharacterized protein OS=Otolemur garnettii GN=CLEC4D PE=4 SV=1
  163 : H2NGE5_PONAB        0.33  0.49    1  146   60  208  158    8   21  208  H2NGE5     Uncharacterized protein OS=Pongo abelii GN=CLEC6A PE=4 SV=1
  164 : H2Q5D4_PANTR        0.33  0.53    2  146   68  214  155    9   18  215  H2Q5D4     Uncharacterized protein OS=Pan troglodytes GN=CLEC4D PE=4 SV=1
  165 : H2RRN7_TAKRU        0.33  0.59    1  141    4  153  153    5   15  163  H2RRN7     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  166 : H2VC61_TAKRU        0.33  0.53    3  141    8  166  160    8   22  175  H2VC61     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068741 PE=4 SV=1
  167 : H3BEN7_LATCH        0.33  0.53    1  143   54  197  156    9   25  197  H3BEN7     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  168 : H9H2W9_MACMU        0.33  0.52    4  141   23  161  147    9   17  173  H9H2W9     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=LOC699291 PE=4 SV=1
  169 : I3JBE7_ORENI        0.33  0.50    2  145   25  165  151    6   17  166  I3JBE7     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (16 of 57) PE=4 SV=1
  170 : K9IVN7_PIG          0.33  0.52    2  146   68  211  156    9   23  212  K9IVN7     C-type lectin domain family 4 member A isoform 1 OS=Sus scrofa GN=CLEC4D_tv1 PE=2 SV=1
  171 : L8HTM7_9CETA        0.33  0.51    2  146   92  237  153    8   15  237  L8HTM7     C-type lectin domain family 4 member A OS=Bos mutus GN=M91_11249 PE=4 SV=1
  172 : Q5YIS0_RAT          0.33  0.51    1  146   87  237  160   12   23  237  Q5YIS0     Dendritic cell inhibitory receptor 3 OS=Rattus norvegicus GN=Clec4a3 PE=2 SV=1
  173 : Q80UI7_MOUSE        0.33  0.50    4  142   97  241  151    9   18  245  Q80UI7     C-type lectin domain family 4, member a1 OS=Mus musculus GN=Clec4a1 PE=2 SV=1
  174 : U3K8I3_FICAL        0.33  0.52    1  143   13  158  153    9   17  161  U3K8I3     Uncharacterized protein (Fragment) OS=Ficedula albicollis PE=4 SV=1
  175 : W5N6N7_LEPOC        0.33  0.51    2  143    1  150  155    7   18  154  W5N6N7     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  176 : C6EQI8_MOUSE        0.32  0.54    3  142   53  194  150    9   18  198  C6EQI8     ASL1/Clec4a2 fusion protein OS=Mus musculus PE=2 SV=1
  177 : CLC4A_MOUSE         0.32  0.53    2  142   88  234  154   10   20  238  Q9QZ15     C-type lectin domain family 4 member A OS=Mus musculus GN=Clec4a PE=1 SV=1
  178 : D2YVI6_PSEAU        0.32  0.52    1  140    6  153  151    8   14  163  D2YVI6     Venom C-type lectin mannose binding isoform 4 OS=Pseudechis australis PE=2 SV=1
  179 : F1PZ24_CANFA        0.32  0.52    2  146   69  211  152    9   16  212  F1PZ24     Uncharacterized protein OS=Canis familiaris GN=CLEC4D PE=4 SV=2
  180 : F6S5A9_MACMU        0.32  0.52    2  146   68  214  154    9   16  215  F6S5A9     Uncharacterized protein OS=Macaca mulatta GN=CLEC4D PE=4 SV=1
  181 : F6VNK3_MACMU        0.32  0.52    2  141   94  232  150    9   21  237  F6VNK3     C-type lectin superfamily member 6 OS=Macaca mulatta GN=CLEC4A PE=4 SV=1
  182 : F7C784_XENTR        0.32  0.56    2  145   19  157  147    6   11  159  F7C784     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
  183 : G1M435_AILME        0.32  0.52    2  146   70  213  152    9   15  214  G1M435     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=CLEC4D PE=4 SV=1
  184 : G1R7H8_NOMLE        0.32  0.49    2  142    1  141  148    9   14  219  G1R7H8     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=CLEC4G PE=4 SV=1
  185 : G3NRY5_GASAC        0.32  0.53    1  139   22  158  146    7   16  162  G3NRY5     Uncharacterized protein OS=Gasterosteus aculeatus GN=CLEC19A (4 of 9) PE=4 SV=1
  186 : G3UA54_LOXAF        0.32  0.52    1  141   18  155  146    7   13  160  G3UA54     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  187 : G3VT54_SARHA        0.32  0.54    1  145  139  283  153    9   16  283  G3VT54     Uncharacterized protein OS=Sarcophilus harrisii GN=CLEC4G PE=4 SV=1
  188 : G3VT55_SARHA        0.32  0.54    1  145  115  259  153    9   16  259  G3VT55     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=CLEC4G PE=4 SV=1
  189 : G5B4N6_HETGA        0.32  0.52    1  145  150  299  154    8   13  299  G5B4N6     C-type lectin domain family 4 member G OS=Heterocephalus glaber GN=GW7_02485 PE=4 SV=1
  190 : G7PJQ6_MACFA        0.32  0.52    2  146   68  214  154    9   16  215  G7PJQ6     C-type lectin superfamily member 8 OS=Macaca fascicularis GN=EGM_02943 PE=4 SV=1
  191 : H2RUI1_TAKRU        0.32  0.56    1  141    4  152  153    6   16  161  H2RUI1     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  192 : H3C654_TETNG        0.32  0.51   15  143    1  145  146    6   18  146  H3C654     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
  193 : H9F5W9_MACMU        0.32  0.51    4  141   89  227  150   10   23  239  H9F5W9     Asialoglycoprotein receptor 1 isoform a (Fragment) OS=Macaca mulatta GN=ASGR1 PE=2 SV=1
  194 : I3J0W1_ORENI        0.32  0.50    2  145   32  172  151    6   17  173  I3J0W1     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (3 of 57) PE=4 SV=1
  195 : I3J0W2_ORENI        0.32  0.55    7  145   32  167  146    6   17  167  I3J0W2     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (4 of 57) PE=4 SV=1
  196 : I3J0W3_ORENI        0.32  0.54    2  145   32  172  151    6   17  173  I3J0W3     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (5 of 57) PE=4 SV=1
  197 : I3J0W4_ORENI        0.32  0.54    2  145   24  164  151    6   17  165  I3J0W4     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (5 of 57) PE=4 SV=1
  198 : I3JXV2_ORENI        0.32  0.55    7  145   25  163  146    6   14  164  I3JXV2     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (32 of 57) PE=4 SV=1
  199 : I3K672_ORENI        0.32  0.54    2  141   40  176  147    6   17  178  I3K672     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (37 of 57) PE=4 SV=1
  200 : I3KHN2_ORENI        0.32  0.51    2  145   24  164  151    6   17  165  I3KHN2     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (47 of 57) PE=4 SV=1
  201 : I3KKC1_ORENI        0.32  0.56    2  141   63  207  153    8   21  207  I3KKC1     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC102079474 PE=4 SV=1
  202 : I3KV77_ORENI        0.32  0.54    2  141   57  197  153    8   25  197  I3KV77     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  203 : I3KWC6_ORENI        0.32  0.56    3  140  114  261  156    8   26  261  I3KWC6     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100706232 PE=4 SV=1
  204 : J3QSZ2_HUMAN        0.32  0.51    4  141   40  178  150   10   23  190  J3QSZ2     Asialoglycoprotein receptor 1 OS=Homo sapiens GN=ASGR1 PE=2 SV=1
  205 : K7E579_MONDO        0.32  0.52    1  145  160  304  155    9   20  304  K7E579     Uncharacterized protein OS=Monodelphis domestica GN=CLEC4G PE=4 SV=1
  206 : M4AKA2_XIPMA        0.32  0.49    3  145   45  206  168    9   31  206  M4AKA2     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
  207 : M4APQ7_XIPMA        0.32  0.52    2  141  113  263  154    8   17  273  M4APQ7     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
  208 : M4B0E2_XIPMA        0.32  0.53    2  145   22  162  151    6   17  162  M4B0E2     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=CLEC19A (17 of 18) PE=4 SV=1
  209 : M4B0E6_XIPMA        0.32  0.50    2  145   21  161  151    5   17  163  M4B0E6     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=CLEC19A (18 of 18) PE=4 SV=1
  210 : Q08II9_VERVA        0.32  0.50    3  145   22  161  150    6   17  163  Q08II9     Serum lectin isoform 4 (Precursor) OS=Verasper variegatus GN=VVL-4 PE=2 SV=1
  211 : Q08IJ0_VERVA        0.32  0.51    3  145   22  161  150    6   17  163  Q08IJ0     Serum lectin isoform 3 (Precursor) OS=Verasper variegatus GN=VVL-3 PE=2 SV=1
  212 : Q3V5Y0_VERVA        0.32  0.50    3  145   22  161  150    6   17  163  Q3V5Y0     Serum lectin isoform 1 (Precursor) OS=Verasper variegatus GN=VVL-1 PE=2 SV=1
  213 : Q4S3U4_TETNG        0.32  0.58    1  141    5  153  153    7   16  153  Q4S3U4     Chromosome 20 SCAF14744, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00024492001 PE=4 SV=1
  214 : W5LGD0_ASTMX        0.32  0.53    1  140  150  293  154    7   24  303  W5LGD0     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  215 : W5NX83_SHEEP        0.32  0.53    2  146   69  212  151    7   13  213  W5NX83     Uncharacterized protein OS=Ovis aries GN=CLEC4D PE=4 SV=1
  216 : F6ZC37_HORSE        0.31  0.55    2  144   58  202  151    9   14  202  F6ZC37     Uncharacterized protein (Fragment) OS=Equus caballus GN=CLEC4D PE=4 SV=1
  217 : G1QML2_NOMLE        0.31  0.48    4  141   89  234  153   10   22  239  G1QML2     Uncharacterized protein OS=Nomascus leucogenys GN=CLEC4A PE=4 SV=1
  218 : G3NXQ7_GASAC        0.31  0.53    4  140    3  155  156   10   22  155  G3NXQ7     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  219 : G3P049_GASAC        0.31  0.53    3  141    9  154  153    8   21  156  G3P049     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  220 : G3QUJ1_GORGO        0.31  0.47    1  145   93  237  152    9   14  237  G3QUJ1     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101128939 PE=4 SV=1
  221 : G7PJQ4_MACFA        0.31  0.52    2  141   94  232  150    9   21  237  G7PJQ4     C-type lectin superfamily member 6 OS=Macaca fascicularis GN=EGM_02940 PE=4 SV=1
  222 : H0V6Q4_CAVPO        0.31  0.56    3  146   89  237  153    7   13  237  H0V6Q4     Uncharacterized protein OS=Cavia porcellus PE=4 SV=1
  223 : H0VQM9_CAVPO        0.31  0.50    2  146   90  237  153    7   13  237  H0VQM9     Uncharacterized protein OS=Cavia porcellus PE=4 SV=1
  224 : H2MPD9_ORYLA        0.31  0.52    3  141  153  301  157    8   26  307  H2MPD9     Uncharacterized protein OS=Oryzias latipes GN=LOC101164113 PE=4 SV=1
  225 : H9F2L9_MACMU        0.31  0.52    6  141    3  140  144    8   14  145  H9F2L9     C-type lectin domain family 4 member A isoform 1 (Fragment) OS=Macaca mulatta GN=CLEC4A PE=2 SV=1
  226 : I3J0W5_ORENI        0.31  0.52    2  145   23  163  151    6   17  164  I3J0W5     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (6 of 57) PE=4 SV=1
  227 : I3JBT5_ORENI        0.31  0.51   18  143    1  141  142    5   17  145  I3JBT5     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC102080798 PE=4 SV=1
  228 : I3K8Z0_ORENI        0.31  0.57    2  141   64  206  153    9   23  206  I3K8Z0     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  229 : I3KPG6_ORENI        0.31  0.59    1  141   48  187  153    9   25  187  I3KPG6     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  230 : I3MH05_SPETR        0.31  0.51    3  146   92  241  156    8   18  241  I3MH05     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
  231 : K7G3H7_PELSI        0.31  0.55    1  140   15  152  146    7   14  155  K7G3H7     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  232 : K7G9H2_PELSI        0.31  0.54    1  143   45  186  152    7   19  188  K7G9H2     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  233 : L9KYQ5_TUPCH        0.31  0.53   18  146  113  257  150    8   26  257  L9KYQ5     C-type lectin domain family 4 member A OS=Tupaia chinensis GN=TREES_T100002758 PE=4 SV=1
  234 : M3Y4C7_MUSPF        0.31  0.47    2  144   78  217  150   10   17  225  M3Y4C7     Uncharacterized protein OS=Mustela putorius furo GN=CLEC12B PE=4 SV=1
  235 : M4AKA8_XIPMA        0.31  0.53    3  140   77  226  156   10   24  226  M4AKA8     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=4 SV=1
  236 : M4B0E0_XIPMA        0.31  0.52    2  145   20  160  151    6   17  160  M4B0E0     Uncharacterized protein OS=Xiphophorus maculatus GN=CLEC19A (15 of 18) PE=4 SV=1
  237 : Q05AQ1_DANRE        0.31  0.52    1  144  102  258  160    8   19  259  Q05AQ1     Immune-related, lectin-like receptor 4 OS=Danio rerio GN=illr4 PE=2 SV=1
  238 : Q1LWY8_DANRE        0.31  0.53    1  144  102  258  160    8   19  259  Q1LWY8     Uncharacterized protein OS=Danio rerio GN=illr4 PE=4 SV=1
  239 : Q24K30_DANRE        0.31  0.53    1  144  102  258  160    8   19  259  Q24K30     Immune-related lectin-like receptor-like OS=Danio rerio GN=illr4 PE=2 SV=1
  240 : Q5YIS1_RAT          0.31  0.51    1  140   87  229  151   11   19  235  Q5YIS1     Dendritic cell inhibitory receptor 2 OS=Rattus norvegicus GN=Clec4a2 PE=2 SV=1
  241 : Q8C1G3_MOUSE        0.31  0.53    3  141    7  147  147    7   14  152  Q8C1G3     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=Clec4a2 PE=2 SV=1
  242 : Q8JZX6_MOUSE        0.31  0.49    1  146   87  237  160   12   23  237  Q8JZX6     C-type lectin domain family 4, member a3 OS=Mus musculus GN=Clec4a3 PE=2 SV=2
  243 : Q923C7_MOUSE        0.31  0.53    3  146  117  262  154    9   18  262  Q923C7     C-type lectin domain family 4 member A OS=Mus musculus GN=Clec4a2 PE=2 SV=1
  244 : U6DQK5_NEOVI        0.31  0.47    1  142    7  140  147    6   18  146  U6DQK5     C-type lectin domain family 4 member K (Fragment) OS=Neovison vison GN=CLC4K PE=2 SV=1
  245 : W5K5L4_ASTMX        0.31  0.59    1  141   30  173  152    5   19  173  W5K5L4     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=4 SV=1
  246 : C3ZYF2_BRAFL        0.30  0.54    7  144    1  143  145    4    9  151  C3ZYF2     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_251564 PE=4 SV=1
  247 : CLC4A_RAT           0.30  0.47    2  142   88  236  158   12   26  240  Q67EQ0     C-type lectin domain family 4 member A OS=Rattus norvegicus GN=Clec4a PE=2 SV=1
  248 : D2I5A2_AILME        0.30  0.52    2  145  153  294  154    8   22  294  D2I5A2     Putative uncharacterized protein OS=Ailuropoda melanoleuca GN=PANDA_020842 PE=4 SV=1
  249 : D2YVI4_PSEAU        0.30  0.48    4  140    9  155  151    8   18  158  D2YVI4     Venom C-type lectin mannose binding isoform 2 variant 1 OS=Pseudechis australis PE=2 SV=1
  250 : D2YVI5_PSEAU        0.30  0.48    4  140    9  155  151    8   18  158  D2YVI5     Venom C-type lectin mannose binding isoform 2 variant 2 OS=Pseudechis australis PE=2 SV=1
  251 : D2YVK9_9SAUR        0.30  0.49    4  140    9  155  151    8   18  158  D2YVK9     Venom C-type lectin mannose binding isoform 2 OS=Notechis scutatus PE=2 SV=1
  252 : D2YVL4_RHING        0.30  0.49    4  140    9  155  151    8   18  158  D2YVL4     Venom C-type lectin mannose binding isoform 2 variant 1 OS=Rhinoplocephalus nigrescens PE=2 SV=1
  253 : D2YVL5_RHING        0.30  0.49    4  140    9  155  151    8   18  158  D2YVL5     Venom C-type lectin mannose binding isoform 2 variant 2 OS=Rhinoplocephalus nigrescens PE=2 SV=1
  254 : E7F6K3_DANRE        0.30  0.52    1  142   40  181  157    9   30  187  E7F6K3     Uncharacterized protein OS=Danio rerio GN=si:ch73-111e15.1 PE=4 SV=1
  255 : E7F856_DANRE        0.30  0.52    2  141   87  226  158   10   36  226  E7F856     Uncharacterized protein OS=Danio rerio PE=4 SV=1
  256 : F6UNH5_XENTR        0.30  0.56    2  145   31  175  151    7   13  178  F6UNH5     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
  257 : G1NXU0_MYOLU        0.30  0.47    4  141  179  343  173    8   43  350  G1NXU0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  258 : G3P102_GASAC        0.30  0.52   13  140   13  145  142    8   23  145  G3P102     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  259 : I3JIJ6_ORENI        0.30  0.51    1  143    4  149  151    5   13  154  I3JIJ6     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC102076957 PE=4 SV=1
  260 : I3JRF0_ORENI        0.30  0.52    2  145   24  164  151    5   17  165  I3JRF0     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (20 of 57) PE=4 SV=1
  261 : I3JRF1_ORENI        0.30  0.52    2  145   29  169  151    5   17  169  I3JRF1     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (20 of 57) PE=4 SV=1
  262 : I3JRF2_ORENI        0.30  0.51    2  145   26  166  151    6   17  166  I3JRF2     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (21 of 57) PE=4 SV=1
  263 : I3JV35_ORENI        0.30  0.44    1  144  116  274  164    7   25  283  I3JV35     Uncharacterized protein OS=Oreochromis niloticus PE=4 SV=1
  264 : I3JXU7_ORENI        0.30  0.45    2  142   30  167  148    5   17  168  I3JXU7     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (31 of 57) PE=4 SV=1
  265 : I3JXV3_ORENI        0.30  0.53    2  145   31  171  151    6   17  172  I3JXV3     Uncharacterized protein OS=Oreochromis niloticus GN=CLEC19A (33 of 57) PE=4 SV=1
  266 : I3JXV4_ORENI        0.30  0.53    2  145   29  169  151    6   17  169  I3JXV4     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (33 of 57) PE=4 SV=1
  267 : I3KXG2_ORENI        0.30  0.51    1  141   10  152  148    6   12  155  I3KXG2     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (53 of 57) PE=4 SV=1
  268 : I3KY65_ORENI        0.30  0.51    2  145   18  158  151    6   17  158  I3KY65     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=CLEC19A (54 of 57) PE=4 SV=1
  269 : K1R1G9_CRAGI        0.30  0.50    2  143   20  168  151    9   11  170  K1R1G9     Collectin-12 OS=Crassostrea gigas GN=CGI_10023840 PE=4 SV=1
  270 : K7FXU3_PELSI        0.30  0.53    3  142   43  183  152    9   23  184  K7FXU3     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  271 : K9MQ70_9PERC        0.30  0.51    2  144   23  163  150    7   16  165  K9MQ70     C-type lectin OS=Trachidermus fasciatus GN=CTL1 PE=2 SV=1
  272 : M1EIB5_MUSPF        0.30  0.50    2  144   30  169  151   11   19  170  M1EIB5     C-type lectin domain family 4, member D (Fragment) OS=Mustela putorius furo PE=2 SV=1
  273 : M3ZLX8_XIPMA        0.30  0.49    7  142   26  165  146    9   16  166  M3ZLX8     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=CLEC19A (1 of 18) PE=4 SV=1
  274 : M4B0D9_XIPMA        0.30  0.52    2  145   24  164  151    6   17  164  M4B0D9     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=CLEC19A (14 of 18) PE=4 SV=1
  275 : Q2TUM0_RAT          0.30  0.51    1  140   87  229  151   11   19  235  Q2TUM0     Dendritic cell inhibitory receptor 2 OS=Rattus norvegicus GN=Clec4a2 PE=2 SV=1
  276 : Q2TUM1_RAT          0.30  0.48    2  142   88  236  158   12   26  240  Q2TUM1     Dendritic cell inhibitory receptor 1 OS=Rattus norvegicus GN=Dcir1 PE=2 SV=1
  277 : Q3V5X9_VERVA        0.30  0.49    3  145   22  161  150    6   17  163  Q3V5X9     Serum lectin isoform 2 (Precursor) OS=Verasper variegatus GN=VVL-2 PE=2 SV=2
  278 : Q56TZ2_RAT          0.30  0.48    2  142   88  236  158   12   26  240  Q56TZ2     Dendritic cell inhibitory receptor 1 OS=Rattus norvegicus GN=Clec4a PE=2 SV=1
  279 : Q5YIR8_MOUSE3VYK    0.30  0.51    1  146   87  236  158   11   20  236  Q5YIR8     C-type lectin domain family 4, member a4 OS=Mus musculus GN=Clec4a4 PE=1 SV=1
  280 : W5L584_ASTMX        0.30  0.51    3  141  130  279  157   10   25  285  W5L584     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1  251 A Y     >        0   0  207  119    6  YYYYYYYYYYYYYYY YYYYFFFYYFF  F   F  Y YY YYY YYYYYYYYYY YYY           
     2  252 A Q  H  >  +     0   0  159  218   69  QQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQ QQQQQKQQQQQKQKEKKQQQQQQQQQ KQ
     3  253 A E  H  > S+     0   0   46  240   58  EEEEEEEEEEEEEEE EEKEEEEEEDDDDDDDDDIDEEEK EEEDEDDEEEEDEEGQDDEKQKQKKK ES
     4  254 A L  H  > S+     0   0  100  257   44  LLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLVLLLMLLLLLLLLLLLLLMLLLVILLLLLLL LL
     5  255 A T  H  X S+     0   0   54  257   75  TTTTTTTTTTTTTTT TTTSSSSTTSSSSSSAASTSTTTTSMMMRTSSINTTSTTTMSASDTDTDDD SR
     6  256 A D  H  X S+     0   0   89  258   93  DDDDDDEDDDDDDDD RWQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQWQWQQQ CE
     7  257 A L  H  X S+     0   0   22  267   52  LLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLALLLLLLLLLLLFLLLLLLLLLLLMLMVVV FL
     8  258 A K  H  X S+     0   0  129  267   63  KKKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKKKKEKKKKKKKKKKKKKKKKKKGKKKKNKNKKK PR
     9  259 A T  H  X S+     0   0   44  267   80  TTTTTTATTTTTTTT AAAAAAAAAAAAAAAAAAAAAAAAPATAAASSATAASASAISPVAAVAAAA DG
    10  260 A A  H  < S+     0   0   30  268   72  AAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAGAEEGGQEEEGGEEGGGGEGQSGEQRKTGTGgG Al
    11  261 A F  H >< S+     0   0  120  191   75  FFFFFFVFFFFFFFF VVTVVVVVVVVVVVVVVVIVVMVVIVVVVVVIVFVVVVIVVVILLMLLLtL .c
    12  262 A E  H >< S+     0   0  116  220   71  EEEEEEEEEEEEEEE EEEEEEEEEEEEEEEEEEAEDDDDNHHHADDDDDDDDDNADDNADAKAKEK ST
    13  263 A R  T 3< S+     0   0  139  234   73  RRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRLRRRRCRdddHRRSRRRRRRRRSRHHHGCGHHH rR
    14  264 A L  T <  S+     0   0   42  136   68  LLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLlllLLLLLLLLLLLLLLLLLLLLLLL i.
    15  265 A a    <   +     0   0   39  167   85  CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC S.
    16  266 A R        +     0   0   37  227   79  RRRRRRRRRRCCCCC HHRRRRRRRRRRRRRRRRHRRRRHRQQQRRRRRRRRRRRRRRRRRRRLRRR NV
    17  267 A H  B     +A  144   0A  75  235   79  HHHHHHHHHHRHRRR PPPPPPPPPRPPPRPPPRPPPPPPPPPPRPLLSPPSLSPPPLPPPPPPPPP CT
    18  268 A b        -     0   0   33  273    3  CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    19  269 A P    >   -     0   0   50  276   32  PPPPPPPPPPPPPPP PPPPPPPPPPPPPPPPPPPPPPPFPAPASPPPPPPPPPPPPPPSSPPPPPPPPP
    20  270 A K  T 3  S+     0   0  185  276   94  KKKKKKKKKKKKKKK WWWWWWWWWWWWWWWWWWWWWWWWWRRRWWWWWWWWWWWWWWWWWWWWwwwALE
    21  271 A D  T 3  S+     0   0  140  278   70  DDDDDDDDDDDDDDD EEEEEEEEEEEEEEEEEEGEDDDEDDDDDDDDDDDDDDDEEDDDDDNKdddGNG
    22  272 A W    <   -     0   0   36  280    5  WWWWWWWWWWWTWWW WWWWWWWWWWWWWWWWWWWWWWLWWWWWWWWWWWWWWWWWWWWWWWQWQQQWWW
    23  273 A T  E     -B   30   0B  32  279   88  TTTTTTTTTTT.TTT TTTTTTTTTTTTTTTTTTRTATTTTTTTTTTTTTTTTTTMTTTTMNSESSSSKV
    24  274 A F  E     +B   29   0B  48  280   91  FFFFFFFFFFFFFFF FFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFAFFHFHVSFFFLFFLLLLLMNP
    25  275 A F  E >   -B   28   0B  12  280   19  FFFFFFFFFFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
    26  276 A Q  T 3  S-     0   0  115  280   59  QQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQNNNQQNNQQQQNQQQHNQQQQQQQQQSQE
    27  277 A G  T 3  S+     0   0   25  280   53  GGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGEGGGGGGGGGGGRGGGGGRGRRRHFG
    28  278 A N  E <   -BC  25 142B  39  280   71  NNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNHHNNSSSHHNNNKHSNSNNRNNNNSNRNNNSSK
    29  279 A b  E     -BC  24 141B   0  280    8  CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    30  280 A Y  E     -BC  23 140B   2  280    0  YYYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
    31  281 A F  E     - C   0 139B  36  280   45  FFFFFFFFFFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFYFFFFIFFFFFLFY
    32  282 A M  E     - C   0 138B  41  281   55  MMMMMMMMMMMMMIIMMMMMMMMIIMIIIMIMMMFIFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFF
    33  283 A S        -     0   0    1  281   50  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
    34  284 A N  S    S+     0   0  129  280   78  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKKKNKKKKKKKKVKKVKVKNKKKKTQKQIIIGNP
    35  285 A S  S    S-     0   0   54  281   73  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSYSSSSSSSASSASAFSSSFSFTYTSSSRDT
    36  286 A Q        +     0   0   80  281   81  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQQQLQRKQKKKSTT
    37  287 A R  B     -E  135   0C  91  281   75  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRLRRRRWQRRRRRRRKRRKRKQRRRQKESRDKKKGMK
    38  288 A N     >  -     0   0   38  281   65  NNNNNNNNNNNNNNNNNNNNDDDNNNNNNNNNNNNNNNNNNNNNNNDDSNNSDSNKNDNNKTNINNNSTS
    39  289 A W  H >> S+     0   0   10  281    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    40  290 A H  H 3> S+     0   0   93  281   79  HHHHHHHHHHHHHHHHHHHHHHQPPHHHHHHHHHHHHNHYHHHHHHHHNHHNHNNQNHKTKKMKMMMHTD
    41  291 A D  H 3> S+     0   0   80  281   56  DDDDDDDNNNDDDDDDDDNNDDDNNDDDDDDDDDDDDDDDENNNDDDNDEDDDDDDDDDDEAEDEEESAE
    42  292 A S  H <>S+     0   0    0  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    47  297 A Q  H ><5S+     0   0  119  281   87  QQQQQQQRQRQQQRQKKKQQQQQQQQQQQQQQQQEQQQQQNQKQQQKQHQQHKHREQKREKKKQKKKIEQ
    48  298 A E  H 3<5S+     0   0  146  281   75  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEENEENENKEEEKEDDYNYYYDTE
    49  299 A V  T <<5S-     0   0   68  281   76  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVAAVVVVVEVVLLLMEMMVAEVMVLMVMLMMMMLMMMQVN
    50  300 A R  T < 5S+     0   0  218  281   44  RRRRRRRRRRGRGGGGGGGGGGGGGGGGGGGGGGEGGGGGGGGGGGGEGGGGGGDGDGGEGSGRGGGGGY
    51  301 A A      < -     0   0   14  281   22  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAS
    52  302 A Q  E     -D  140   0B  78  281   49  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQDHH
    53  303 A L  E    S-D  139   0B   1  280    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL.LLLLLLLLLLL
    54  304 A V        -     0   0    0  281   30  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVLVVVVVVVVVAV
    55  305 A V        -     0   0    3  281   52  VVVVVVVVVVVIVVVVVVVVVVIIIVIVVVVVVVVVVIVVVIIIIVITVIVVIVVITIVIVIVVVVVVVI
    56  306 A I        +     0   0    2  281    9  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIVIVIIIIVIIIIIVVIVIIIIIIIIIII
    57  307 A K        +     0   0  106  280   68  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEKKKNKKEEEQNKKKENKKK.REKVEKNKNKKKDNS
    58  308 A T  S  > S-     0   0   51  281   49  TTTTTTTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSTTTSSSSSNSSSSKSSSKSSNNSSSSSTS
    59  309 A A  H  > S+     0   0   29  281   85  AAAAAAAAAAAAAAAAAAAAAAADDAAAAAADDAAATAAADDDDAAHPEDADHDSDDHSDNANTNNNPQF
    60  310 A E  H  > S+     0   0  101  281   35  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDEEEEEEEEEEEEEDEEEDEDEEEEEEEEA
    61  311 A E  H  > S+     0   0    8  281    6  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEDEEEDEEEEEEEEEEE
    62  312 A Q  H  X S+     0   0    6  279   31  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEQQQEQQQQQQQQQQQ
    63  313 A N  H  X S+     0   0   50  278   62  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNSNSTTTSSSSNSS.SNQSTSQRSDSKSSSNNN
    64  314 A F  H  X S+     0   0    2  279    7  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFNFFSFFFSFFFFFFFFFFF
    65  315 A L  H  X S+     0   0    0  279   29  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLFLLLFLLLLLLLLILV
    66  316 A Q  H  X S+     0   0   19  281   90  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQLKGQLLQQNKQQQAYA
    67  317 A L  H  X S+     0   0   18  281   89  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLVQQQQQQQQKQQQQQQAVQQERLRSGGGSQK
    68  318 A Q  H  X S+     0   0   16  281   90  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTTQTTTTTTTTTTTQTTQQLTQTTQTWIIIFTA
    69  319 A T  H  X>S+     0   0    3  163   81  TTTTTTTTTTTTTSSSSSSSSSSSSSSSSSSSSSASTSTT.SSSSSSSSSSTSSTTLSTSCTSNSSST..
    70  320 A S  H  <5S+     0   0   54  188   70  SSSSSSSSSSSLYSSSSSSSSSSSSSSSSSSSSSSSSKKSSKKKKDKKKKDSKKSTKKSKKSKVKKKEKH
    71  321 A R  H  <5S+     0   0   73  208   75  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRKRRRKRRENKTKATASIKKKKIKKKKSNKKKKKKRKKKEPG
    72  322 A S  H  <5S-     0   0   50  249   92  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSKRSERRRKQNNRKQKNRESKNENKGKNKKKRSS
    73  323 A N  T  <5 +     0   0  141  257   75  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKGGNKGGGGGSGGGGRSGKNSSKGRNGNGGGTGP
    74  324 A R      < -     0   0   85  259   76  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRPRRRPRRHSHLGPPPSSYYYFSGYYGRAYGLNCNQnNnWkR
    75  325 A F        -     0   0  105  227   68  FFFFFFFFFFFFFFFFFFFFFFFLLFFFFLFLLLLFF..FY.......TAAY.TYY..Y..L.R.F.IfV
    76  326 A S  E     -Fg 121 136D   3  262   86  SSSSSSSSSSSSSATTTTTTAAAAATAAAAAAAATASTTTATTTTATTWWWTTWAN.TATTTST.W.GYY
    77  327 A W  E     -Fg 120 137D   0  196    3  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW...WW.WWWWWWWWWWw.w..W
    78  328 A M  E     -     0   0D   0  271   32  MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMIMMMMMLMMMMLMMMMIMIMIMMMIMMM.IL
    79  329 A G  E    S+     0   0D   0  274    2  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGG.GG
    80  330 A L  E     + H   0  91D   0  280    6  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    81  331 A S  E     -FH 118  90D  14  281   65  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSISISSSSSSSSSSSSSNTN
    82  332 A D    >   +     0   0    7  281   23  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDYDYYYDDD
    83  333 A L  T 3   +     0   0   84  280   87  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMMMLLLLILLMLMLLLLLRRLNHNNNIQR
    84  334 A N  T 3  S-     0   0  122  280   78  NNNNNNNNNNNNNNNNNNNNNNNKKNNNNNNHHNKNTNNKKHHHNNNNNNNSNSKKKNKKKKKHNNNEVD
    85  335 A Q  S <  S+     0   0   96  280   82  QQQQQQQQQQQQQQQQQQHHQQQQQQQQQQQEEQHQHKKHRNNNKKKKKKKKKKHHQKREEHKNKKKQVR
    86  336 A E  S    S-     0   0  134  281   42  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEDE
    87  337 A G  S    S+     0   0   51  260   39  GGGGGGGGGGGGGGGGGGGGGGGGGGGDDGDNNGGDGGAGGAAAAGGGSSGSGSGDSGGGGGSGSSSGGG
    88  338 A T        -     0   0   73  274   80  TTTTTTTTTTTTTTTTTTTTTTTTTTTTMTMTTTTTTTTIETTTTAEETTATETRVTEIAQTKSKKKTQD
    89  339 A W        +     0   0   21  280    5  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    90  340 A Q  E     -HI  81  96D 109  280   73  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQLHHHHHHHSYYHRSYYYHHQYHSLHQKQQQKQK
    91  341 A W  E >   -H   80   0D   6  280    1  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    92  342 A V  T 3  S+     0   0   45  281   39  VVVVVVVVVVVVVVVVVVVVVLVVVVVVVVVVVVVVVVVVVVVVVVLLVVVVLVVVVLVMVLVVVVVVVL
    93  343 A D  T 3  S-     0   0   68  281    5  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
    94  344 A G  S <  S+     0   0   42  281   45  GGGGGGGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGGGGGGDGGGGGDGGGDGNGSGGGGDG
    95  345 A S        -     0   0   33  281   56  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTS
    96  346 A P  B     -I   90   0D  99  281   49  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSHPPPAPPPPPPPPPHPPPHPPPPPPppPPP
    97  347 A L        -     0   0   17   83   32  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLQLLLrr...
    98  348 A S    >   -     0   0   42  188   78  SSSSSSSSSSSSSSSLLLLLSSSSSSSSSSSSSSLSQFSLLSSSLSSSTASTSTLQSSLLQLQ.QVV.F.
    99  349 A P  G >  S+     0   0  113  194   84  PPPPPPPPPPSPSSSPPPPPPPPPPSSTTSTPPSPTSFLLFPPPLLDDLFLLDLFTDDFYYLG.GFF.N.
   100  350 A S  G 3  S+     0   0   62  280   89  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSRRSSSSSSNSSTSNSSSSSSSSKESS.RNNLKV
   101  351 A F  G X  S+     0   0   18  281   88  FFFFFFFFFFFFFFFFFFFFFFFLLFFFFFFLLFFWFFFFFFFFFLFLFLLFFFFFFLFFFFFQLFFTAT
   102  352 A Q  G X  S+     0   0   85  281   87  QQQQQQQQQQQQQQQKKKKKKKKRRKKKKKKRRKVPMMMMMTATMTERMMTMEMMTRETSWMKLRRRLLL
   103  353 A R  G 3  S+     0   0  178  281   84  RRRRRRRRRRRRRRRQQQQQQQQRRQQQQQQRRQKCNKKKKRQRKRKNKQRKKKKKKKKMNKNSTTTQSS
   104  354 A Y  G <  S+     0   0   31  281   36  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYHYFYYYYYYYYYYYYYYYYYFYYYYYYHFYYYYFF
   105  355 A W  B <  S-j  126   0D  19  281    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   106  356 A N    >   -     0   0   37  281   72  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNMKNNNMSKSNNKKNLSNFKSSSADD
   107  357 A S  T 3  S+     0   0  126  281   81  SSSSSSSSSSSSSSSRRRKKRRRQQRRRRRRRRREQKEPKKRRRPPKEKKPKKKKRKKKEAKVEAAASVP
   108  358 A G  T 3  S+     0   0   62  281   34  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGE
   109  359 A E    <   +     0   0   40  281   21  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQQQEQQEQEEEEQEEEEEEEEEQEE
   110  360 A P  S    S-     0   0   39  281    5  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPpP
   111  361 A N        -     0   0   68  281   35  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNnNNNNNNNNNNNNNNNNNNNNNNNNNHKNKKKdnN
   112  362 A N  S    S+     0   0  155  240   55  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSaNSNSNNNNNNNNNNNNNNNNNNNNNSMNMMMhIN
   113  363 A S  S    S+     0   0  100  252   92  SSSSSSSSSSSSSSSVVVVVIIIIIIIIIIIIIISRIHLSEVVVHRVIVNRLVLEILVEILSRRRRRHAL
   114  364 A G  S    S-     0   0   38  281   56  GGGGGGGGGGGGGGGGGGGGGGGGGRGGGRGGGRGGRGGGGGGGGGGDGNGGGGWGRGWENGGGGGGLGF
   115  365 A N  S    S+     0   0   94  255   71  NNNNNNNNNNDNDDDEEEEEEEEEEKEEEEEEEEEREEQEEDDDEGGGDEGEGEEENGEENENDNNNRVD
   116  366 A E        +     0   0   54  277   10  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQQQKQQEQEEEQQEEEEKEKKKEEE
   117  367 A D        +     0   0   21  280   44  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDKDDDDDDDDDDDDDDDDDDDDDDVDDDDDDD
   118  368 A d  E     -FK  81 129D   0  280    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC.CCCCCCCCCCCCCCCCCCCCCRCCCCCccC
   119  369 A A  E     + K   0 128D   0  278   87  AAAAAAAAAAAAAAAAAAAAVVVAAVVVVVVVVVAVVAAAAAAAGVVVAVVAVAAVVVAA.AAVAAAidA
   120  370 A E  E     -FK  77 127D   6  281   79  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEMEEEEEEEEEEEEEEEEEEEEEEEEAEIEIIIRSS
   121  371 A F  E     +FK  76 126D   1  281   91  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFMFFFFFFFFFVFFLFVFFFFLYFFLVLFLRRRDSM
   122  372 A S  E >   - K   0 125D  18  281   83  SSSSSSSSSSSSSSSSSSSSNNNNNNNNNNNNNNRLGRDRRSSSSRRRRRRRRRRNTRRKFRTYTTTPNN
   123  373 A G  T 3  S-     0   0   55  281   87  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGDGGGGSDNEGSDDDGSFDGGDGDSDDDGAK
   124  374 A S  T 3  S+     0   0  107  281   89  SSSSSSSSSSSSSSSNNNNNNNNNNNNNNNNNNNKTQDDEDDDDNRNDDDRDNDDNENDDSDYDYYYTNG
   125  375 A G  E <  S- K   0 122D   6  281   65  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGgGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSrg
   126  376 A W  E     -jK 105 121D   0  280    3  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWwWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWww
   127  377 A N  E     - K   0 120D  37  281   20  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNNNKNNNNKNNNNNNNNNNNNNNNNNNN
   128  378 A D  E     + K   0 119D   0  281    6  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDADAAADDD
   129  379 A N  E     - K   0 118D  30  281   86  NNNNNNNNNNNNNNNDDDDDDDDDDDDDDDDDDDSALSASVLLLNSAANASTATAANAANISLNLLLEML
   130  380 A R    >   -     0   0  103  281   79  RRRRRRRRRRRRRRRKKKKKKKKRRKKKKKKKKKKPGRKKPSRSKKKKKRKKKKPGKKPKTKSRPPPRTS
   131  381 A d  T 3  S+     0   0   16  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   132  382 A D  T 3  S+     0   0   88  281   80  DDDDDDDDDDNNNNNNNNNNSSSSSSSSSSSSSSSDHDDDTDDDEDEDDDDTETTDDETESDSNSSSDFD
   133  383 A V  S <  S-     0   0   45  281   92  VVVVVVVIVIVVIVVLLLLLAAAAAAAAAVAAAVLsHLINVKTKVYQNNIYNQNIVNQNLHIRTHHHDFK
   134  384 A D        +     0   0   90  281   80  DDDDDDDDDDDDDDDAAAAAAAAAAAAAAAAAAASkLESSNLRLEKRWKKKKRKKEKRKHESEEEEESKT
   135  385 A N  B     -E   37   0C  10  281   91  NNNNNNNNNNNNNNNKKKKKKKKKKKKKKKKKKKKDRKKKKLILNKKKKKKKKKKKKKKKAKSNSSSYMT
   136  386 A Y  E     -g   76   0D  49  281   96  YYYYYYYYYYYYYYYFFFFFFFFFFFFFFFFFFFFGFFFFYFFFFFFFFFFFFFYFFFYFFFLFLLLQYY
   137  387 A W  E     -g   77   0D  12  280   41  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW RWWWWWRW
   138  388 A I  E     -C   32   0B   0  280   16  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIINIVIIIIIVVIIIIVIIIIVIIIIV ITIIIVII
   139  389 A c  E     -CD  31  53B   0  280    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCC
   140  390 A K  E     +CD  30  52B  28  279   54  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEKKKKKKKKKKKKKKKKKKKKKKKKK KEMMMEEE
   141  391 A K  E     -C   29   0B  46  260   65  KKKKKKKKKKKKKKKKKKKKKKKKKMKKKMKKKMKKKKKTKKKKQRKKKKRKKKKKKKKKK KKKKKK R
   142  392 A P  E     -C   28   0B  99  209   74  PPPPPPPPPPPPPPPSSSSSSSSSSSSSSSSSSSPRSSSTSVVVPFITPSF ILSS ISPP PPPPP  K
   143  393 A A        -     0   0   19  178   78  AAAAAAAATAIATTTAAAAAAAAAAAAAAAAAAATHAAAAASSSAAAAEVA ASAA AAEA ASAAA  C
   144  394 A A  B     -A   17   0A  52  154   75  AAAAAAAVVVAAAAAAAAAAAAAAAAAAAAAAAATNTG A TTTNATTTTA TT A T  S  S     S
   145  395 A a              0   0   87  102   46  CCCCCCCCCCCCCCC                    C                                 C
   146  396 A F              0   0  112   59   19  FFFFFFFFFFFFFFF                                                       
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1  251 A Y     >        0   0  207  119    6        L  Y F FF  FFYYFF      F  FFFF F F   F     F    YF  YFFF  Y    F
     2  252 A Q  H  >  +     0   0  159  218   69       QRK ENTKRTQ TTPPPT  KNK MKQMMMMKMET EDT H  RSKN KNQ RTNTT  QQ  QL
     3  253 A E  H  > S+     0   0   46  240   58      NSAE DNEEAESQEESSEE  EEE DESDDDEEDEE NEE N  EEEE QTAEETCEE  LE  QS
     4  254 A L  H  > S+     0   0  100  257   44      LLLNILLLLVLLLLTLLIL  LLNMFLLFFFLKFKL LLL LL KGELLQLLLKLYLL  QK  IF
     5  255 A T  H  X S+     0   0   54  257   75      TLESTMTSSSSVSSSTTSS  EEENSSMSSSSSSSS TQS SS PTSDPKLESPENSS  KD  TS
     6  256 A D  H  X S+     0   0   89  258   93      EEAKEDKCCACECCLCCCC  RRNSCCECCCCECDC ETC SS ESKWDDCACECDCC  KQ  QD
     7  257 A L  H  X S+     0   0   22  267   52   L  MLVLLFKYYLYLYYLVVEYL LLLSSYLSSSRLSLY LKY LT LMLLLLKVYLVEYYLLILL VG
     8  258 A K  H  X S+     0   0  129  267   63   D  TRKKKSLNSQNRSNLMMNNN QQNKSSRSNNNKNKN SLN KK KRKKFTKKNKKSNNKKDQT RR
     9  259 A T  H  X S+     0   0   44  267   80   D  KGQGKCSYERNGDYGEEEYD RSKSDEGDDDESDGY CTY TT GGVMIEDRDGEGDDEEQAM NA
    10  260 A A  H  < S+     0   0   30  268   72   K  ElQSeyDgagglGgSggggEPLLKsGalGgGgagGg dVg Ev TNsEGGIQgGnSggggVSs Ev
    11  261 A F  H >< S+     0   0  120  191   75   L  Lc..lvFsstscLsVmmlsFVCFIkLscLsLsss.s gFs .s .TrNCS..s.mVssli.Yl .l
    12  262 A E  H >< S+     0   0  116  220   71   F  ETNTTSAVVSIRGVKEEIVSENNKHGVAGVGVTVDV SEV .D EEGDTE.NVTEKVVYY.DT .L
    13  263 A R  T 3< S+     0   0  139  234   73   P  RRRWrgkKKSKRSKNDDKKpSQQGtSKRSKSKWKTK gRK DP rNSSKR.SKWeNKKEERSD .R
    14  264 A L  T <  S+     0   0   42  136   68   .  L.S.rv......V......a....lV..V.V..... v.. .. tVTL...S..v.....KL. ..
    15  265 A a    <   +     0   0   39  167   85   C  Q.C.EK...C..K..WW..DCKK.VK..K.K...W.CK.. .C WWWQ..CC..W.....KK. ..
    16  266 A R        +     0   0   37  227   79   G  RVENKN.NNQNVNN.SSNNKNTTRKNNVNNNNNNNNRS.N VS NANT.TKENNS.NNKKIFK .G
    17  267 A H  B     +A  144   0A  75  235   79   P  LTQCTC.CCPCTCC.CCCCKKTTRNCCTCCCCCCCCHC.C LK CCCKVCAQCCCCCCSSVSKATS
    18  268 A b        -     0   0   33  273    3  CN CFCCCCC.CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCYCCCCCCCCICCCCCCCCCCCCCCCCCC
    19  269 A P    >   -     0   0   50  276   32  PH QNPPPPP.PPPPPPPPPPPPPQPPPCPPPPPPPPPPPLPSPREEEPPPKPPPPPPPPPPRREPPPPP
    20  270 A K  T 3  S+     0   0  185  276   94  LT KQETVAL.LLILELLLTTLLTPAAEpSLESTSLVTILPVkLINEDVCTiCIQPLVKLSSIINfTAVM
    21  271 A D  T 3  S+     0   0  140  278   70  NQ DRGSDGSqNNDNGNKNPPNNGGGGGnNNGNDDNGDGNGNsNGNGGGAGgDNDSKGSGNNGGGgGGGF
    22  272 A W    <   -     0   0   36  280    5  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    23  273 A T  E     -B   30   0B  32  279   88  KEVVSLLRRIVEKKELKEKTTQEKMQRREVKLVVVVRVRETKTETKEKRKRVIVKLFRIVEETTKVKSSW
    24  274 A F  E     +B   29   0B  48  280   91  HYEEKPFAIHYYHTHPYYHSSHYKLKKEHHHPHHHHAHAYFHYYLKQQASSFLERPHASHYYLLKYMKSN
    25  275 A F  E >   -B   28   0B  12  280   19  YYFFFFFFFFFFYFFFFFFFFFFFLFFFFFYFFFFFFFFFMFFFFFHHFFFFFYFFFFFFFFFFFFFFFF
    26  276 A Q  T 3  S-     0   0  115  280   59  QNQQCQQQSQGQQEQEQQQQQQQQKSSEQQQEQQQQQQQQNQSQNDGGQGQSSEGQQQRQQQNNDGRNSN
    27  277 A G  T 3  S+     0   0   25  280   53  SGRRCGGSSSGSSGSGSSSSSSSGSCCFSSSGSSSSCSSSSSGSNLGESSDCGGCGSSSSSSNNFGSCHG
    28  278 A N  E <   -BC  25 142B  39  280   71  SKSSSKSNSSSSSSSKSSSSSSSSASSSSSSKSSSSNSSSLSSSFGKKNSSKSSSSSNHSSSFFSNSSSR
    29  279 A b  E     -BC  24 141B   0  280    8  CCCCCCCCCCFCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCFCCCCCCCCCCCCCCCCCCCCCCFCCCC
    30  280 A Y  E     -BC  23 140B   2  280    0  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
    31  281 A F  E     - C   0 139B  36  280   45  FYLLLYYIFLYFFFFYFFFFFFFYYLLYFFFYFFLFFFFFFFYFFFYFFFLYYWYYLFFFFFFFYQYLHK
    32  282 A M  E     - C   0 138B  41  281   55  FFFFLFFILFIFFFFFFFFIIFFIFLLIFFFFFFFFPFPFFFIFFFFFPIPFFFIFFPVFFFFFVVILLY
    33  283 A S        -     0   0    1  281   50  SSSSSSSLSSSSSSSSSSSSSSSSsSSTSSSSSSSSLSFSpSSSSSSSFSLSSSSSSFSSSSSSSSSSPV
    34  284 A N  S    S+     0   0  129  280   78  TLSSEPENNTATTPTPTTTTTTTAdEENTTTPTTTSTTHTiTTTSKTTNTNIKSTEPNATTTCCTSAEEA
    35  285 A S  S    S-     0   0   54  281   73  TKSSSSTDDNTDTTDSDDNVVNDGTRRENNTNNNNNDNDDQNTDELNSDQDDESVTDDNNDDEETTGRST
    36  286 A Q        +     0   0   80  281   81  TKKKSTQKSTQTTKTTTTAMMTTKKSSNTTTTTTTTNTKTRTKTLTKKNQNERVLQTNNITTLLTKKSFH
    37  287 A R  B     -E  135   0C  91  281   75  LGLLDKAKGMRILSSKMIMQQKIKRGDKMMLKMMMMKMKIRLKIKKSSKNKKRRKAMKRKIIKKKKKTRL
    38  288 A N     >  -     0   0   38  281   65  TTDDSSVTSSSSTSSSSSTSSNSKNSSTSSTSSSSTTSTSSTSSSNSSTFTNDPSTSTNSPPSSSSRSSS
    39  289 A W  H >> S+     0   0   10  281    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    40  290 A H  H 3> S+     0   0   93  281   79  SSTTHDDDTAQASHVDIATTTPAKDHHMTASDATTTATVAPARAENNNASAKSTTDRASSTTEEKGKDDA
    41  291 A D  H 3> S+     0   0   80  281   56  SWTTSETERSSLSSSESLSKKSLDESSQASSESSSAESELELDLAQKEQKKDGEDTAQEESSAAQEDEAD
    42  292 A S  H <>S+     0   0    0  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    47  297 A Q  H ><5S+     0   0  119  281   87  SRVVTQSTKSQSSLSQSSSSSSSKVTTQSSSQSSSSSSTSRSWSRIRISVTKVQLGSSSSSSRRTQKRRL
    48  298 A E  H 3<5S+     0   0  146  281   75  DDSSDEAGDNYADSAENAAVVDAMNDDEFNDEDDNYGDGANAGAQSATGADKNLDGSGESAAQQSQTDDS
    49  299 A V  T <<5S-     0   0   68  281   76  MNMMQNHMKMQMMEMNVMMMMMMKQQQLMMMNMMMMMMLMKMKMVKKKMMMQQERQMMMMMMVVRKKRRQ
    50  300 A R  T < 5S+     0   0  218  281   44  GRGGGYGGGGGGGGGYGGGGGGGKGGGGGGGYGGGGGGGGGSGGGGGGGGGGANGGGGNGGGGGGGRGGG
    51  301 A A      < -     0   0   14  281   22  AASSASAAAAAAASASAAAAAAAAGAAAAAASAAAAAAAAAAAAAGGGGAAASAGAAGAAAAAAGAAAAA
    52  302 A Q  E     -D  140   0B  78  281   49  HQHHDHYNDHDHHHHHHHHGDHHDDDDDHHHHHHHHHHHHDHDHDDDDHHHDSHDHHHHHHHDDDDDDDN
    53  303 A L  E    S-D  139   0B   1  280    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    54  304 A V        -     0   0    0  281   30  VVVVVVVVVVVVVVVVVVVVVVVALVVVVVVVVVVVMVVVAVVVVAVVAVVVAVVVVALVVVVVLLAVMV
    55  305 A V        -     0   0    3  281   52  VVVVVIITVVIVVIVIVVVVVVVIVVVIVVVIVVVVTVTIVIIIVVKKTVTIIVIIVTVVIIVVIIIVVS
    56  306 A I        +     0   0    2  281    9  IIIIIIVIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIVLIIIIIIIVIVIIIIIIVVVIIIII
    57  307 A K        +     0   0  106  280   68  DNNNDSKSDNNNDNNNNNNNNNNKDDDNNNDSNNNNSNSNDNDNDNDDSNTNNTNRNSTNNNDDNNKDDH
    58  308 A T  S  > S-     0   0   51  281   49  TDSSSNGTCTSSTDSSTSTTTTSTSSSSTTTSTTTTTTTSTSNSTSSSTTSNNSSGTTTSSSTTSSTSSN
    59  309 A A  H  > S+     0   0   29  281   85  QMAAPSPENQRQQQEFQQEKKAQQLPPKERQIRQQQEQEQRLKQSKRSGEERVRRLQGKEQQSSGRQPAI
    60  310 A E  H  > S+     0   0  101  281   35  EGDDEDEAKEEEEQEAEEEEEEEEENKEEEEDEEEQAEAEEEEEEEEEAAAEDDENEAEEEEEEEEEEEE
    61  311 A E  H  > S+     0   0    8  281    6  EEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEEkEEEEEEEEEEEEEEEEEEEEEEEEEEdkE
    62  312 A Q  H  X S+     0   0    6  279   31  QQQQQQQQQQ.QQQQHQQQQQQQMQQQQQQQQQQQQQQQQhQNQQQQQQQQQLQQQQQEQQQQQQQMtqE
    63  313 A N  H  X S+     0   0   50  278   62  ENNNIDGNTE.EENENEEEDDEERLNNVVEENEEEENENESEAEKAESNNNEKNAGENDKEEKKAVTETN
    64  314 A F  H  X S+     0   0    2  279    7  FFFFFFFFFF.FFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFFFFFFFFFFFYFFFFFFFFFFFFFFCFF
    65  315 A L  H  X S+     0   0    0  279   29  LLIIIVLILL.LLLLVLLLIILLLIIIILLLVLLLLILILILVLLVLLILIILLILLIILLLLLVAIMLV
    66  316 A Q  H  X S+     0   0   19  281   90  FQVVAASISFESFTFAASFTTFSNTVVNFFFVFFFFIFTANFRSSNGKTVVWSQKSYTTFAASSNNNVSR
    67  317 A L  H  X S+     0   0   18  281   89  RTRRSKQQKYQYRQYKHYHQQYYNMSSGHFRKFFFHQFQYNHKYKGKIQQQRSRSQYQQHYYKKTQSKMS
    68  318 A Q  H  X S+     0   0   16  281   90  TRNNFAHsLAFKTnKAAKTNNRKLAIIlKATAAAAAFAFKNMFKNWKAFQFQKhfHTFKAKKNNLFLQIL
    69  319 A T  H  X>S+     0   0    3  163   81  KARRT...T.T............FTTTqK...K.......H...VLVL....I.....L...IVLKFTTI
    70  320 A S  H  <5S+     0   0   54  188   70  PRKKQH..K.RK..K.KK.LL.KSPQQTP...P..K...KNK.KKKRD...TS...K.PK..KKKKGATS
    71  321 A R  H  <5S+     0   0   73  208   75  KNEEKGT.SKKPK.P.PPKKKKPSGYYKKKK.KKKP.K.PPP.PKTRF...KS..TP.VPKKKKTYSLKN
    72  322 A S  H  <5S-     0   0   50  249   92  RAFFRSR.EPFKP.K.RKPIIPKNRKKNRPP.RPPRLPLKSRQKDSMLLLLGV..RRLKKPPEEDMDSEF
    73  323 A N  T  <5 +     0   0  141  257   75  KRFFTPG.TKQMK.M.KMRNNETKRTTNRKK.RKKEDKDMLKKMTQMLDNDNH..GKDNGKKTTQWKNTD
    74  324 A R      < -     0   0   85  259   76  EHWWWRR.WrKrr.rhkrrsskrEDWWVErrhErrkrrrrdrkrWNtnrerKW..RkrVkmmWWNIEiWh
    75  325 A F        -     0   0  105  227   68  F..I.V.f.fRffffvfffyyyfVSII.FffvFffffffftf.fI.kifyf.Lly.ffYfff...GVe.p
    76  326 A S  E     -Fg 121 136D   3  262   86  Y..G.YgsSYAFYgFYFFYFFYFWgGG.FYYHYYYYsYsFgH.FGAFFsFsnGnrgYsYYFF..ALWA.T
    77  327 A W  E     -Fg 120 137D   0  196    3  .W.L.WwfW.W..w.W........w..W...W....f.f.w.w..WWWf.fw.www.f......W..W.W
    78  328 A M  E     -     0   0D   0  271   32  ILISILLLIIIIIIILIIILLIIII..IIIILIIIILILIIIII.IIILLLI.IILILIIIIIIM.IIII
    79  329 A G  E    S+     0   0D   0  274    2  GGGDGGGGGGGGGGGGGGGGGGGGG..GGGGGGGGGGGGGGGGG.GGGGGGG.GGGGGGGGGGGG.GGGG
    80  330 A L  E     + H   0  91D   0  280    6  LLLILLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL.LLLL
    81  331 A S  E     -FH 118  90D  14  281   65  TTSINNKTMTTSTSSNTSTSSTSTRSSTTTTSTTTTRTSSRTSSNFTTRSTTTTSRTRSTSSNNSTTNNS
    82  332 A D    >   +     0   0    7  281   23  DDDVDDANDDDDDDDDDDDDDDDDDDDDDDDDDDDDNDHDDDDDDDDDSDDDDDGADSDDDDDDDDDDDD
    83  333 A L  T 3   +     0   0   84  280   87  QVI.IRVQGQRQQTQRQQQPPQQGVIISQQQRQQQQEQEQVQRQVISSETEASQRVQEPQKKVVTVEKKI
    84  334 A N  T 3  S-     0   0  122  280   78  VDI.ENRNSVIVVEVAVVVKKVVGDEEVVVVEVVVVNVNVELLVEEAANQDSENERVNKVVVEEVAGEEH
    85  335 A Q  S <  S+     0   0   96  280   82  VIV.QVRTNTQVVVVQIVAGGVVLEQQTVNVHNTKTATPVEVRVTTEVPGHMIGVHTLGVVVTTTTSQQK
    86  336 A E  S    S-     0   0  134  281   42  EEEEEElEEEEEEEEEEEEWWEEEEEEEEEEEEEEEEEEEEEEEEEQEDNEEEPKlEDKDEEEEEDEEEE
    87  337 A G  S    S+     0   0   51  260   39  GGGGGGqGGGGGGGGGGGGRRGGGGGGGGGGGGGGGGGGAGRGDGGGGGDGGN.RqGGRGGGGGGGGGGG
    88  338 A T        -     0   0   73  274   80  QEQQTDGQTQSQQKQDQQQHHQQQTTTTQQQDQQQDQQLQIQSQTTRRQNQIT.SGQQQQQQTTNVQTTR
    89  339 A W        +     0   0   21  280    5  WWWWWWYWWWWWWHWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWYWWWWWWWWWWWWWW
    90  340 A Q  E     -HI  81  96D 109  280   73  QKSSKRQQTQKQQKQRKQQQQRQKKKKKQQQKQQQQRQQQKRIQKKLLHQSMKKRRQHQKHHKKTKKKKM
    91  341 A W  E >   -H   80   0D   6  280    1  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    92  342 A V  T 3  S+     0   0   45  281   39  VVVVVLVVVVVVVIVLVVVVVVVVTVVVVVVLVVVVVVVVLVQVAVVVVIVVVVVVVVVVVVTTVVVVVS
    93  343 A D  T 3  S-     0   0   68  281    5  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
    94  344 A G  S <  S+     0   0   42  281   45  DGGGGGGRGGGGDGNGGGGQQGGGGGGGGGDGGGGGQGRGGGGGDGGGKQKGGGGGGKQGGGGGGGGGGG
    95  345 A S        -     0   0   33  281   56  TSSSTSVTSTTTTSTSTTTTTTTTSTTTTTTSTTTTMTTTTTTTNTSSKTTSTTTATKATTTNNTTSTTS
    96  346 A P  B     -I   90   0D  99  281   49  PSPpPpSPSPAPPDPPPPPPPPPPRPLPPPPPPPPPPPPPRPPPPvPPPPPRTDPSPPPPPPPPRKPPPV
    97  347 A L        -     0   0   17   83   32  ...lLl.......I...........L...................t..................AV....
    98  348 A S    >   -     0   0   42  188   78  FY.FTR.F.F.LFTF.FLFYYLL..T..FFF.FFFLFFFL.L.L.TLLFYF.VY..FFYFLLLLTS....
    99  349 A P  G >  S+     0   0  113  194   84  TR.FLQ.N.T.TTFT.MTKNNST..L..TST.SSTTNSNT.I.T.KNNNKD.IE..TNNTTTTTTT....
   100  350 A S  G 3  S+     0   0   62  280   89  ENYLKVLPLELKEVKLEKEKKLKLLKLLEEEVEEEKPELKLELKLCKEPEPLMTLLKPKEKKKKTSLLLV
   101  351 A F  G X  S+     0   0   18  281   88  SGNFPSTHTATSSYSTSSSNNSSTTLTTSSSTSSSSRSHSTSRSTRSSQNHTSGTNSQSSSSGGFFTTTG
   102  352 A Q  G X  S+     0   0   85  281   87  LFLWTRFLLLQLLYLALLLVVSLTETLTLLLLLLLLILMLELTLKKLLIVITEFTFLIILLLYYCPTLLF
   103  353 A R  G 3  S+     0   0  178  281   84  SRLRRASVRSSSSYSNSSSTTSSTSRKASSSSSSSSVSESGSSSGKSTVRVGIQSSSVTSSSLLRSAIMV
   104  354 A Y  G <  S+     0   0   31  281   36  FYFFYYNFYFYFFYFFFFFFFFFFYYYNFFFFFFFFFFFFYFFFYYYFFLFYYNYHFFFFFFYYYYFNYN
   105  355 A W  B <  S-j  126   0D  19  281    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   106  356 A N    >   -     0   0   37  281   72  DKSSAVNHEDRDDNDEDDDHHDDGNAAGDDDEDDDDHDYDNDYDHQNFHHHDNRENDHHDDDDYQSGQGN
   107  357 A S  T 3  S+     0   0  126  281   81  ARPPSSSKAEFVARAPEVTSSAVDDPSRVVAPVVVIEVKADVPVEPDFKQEDFPDSAKPAVVEKPSDEKA
   108  358 A G  T 3  S+     0   0   62  281   34  GGGGGLGGEGGGGGGEGGGGGGGNGHGGGGGEGGGGNGGGGGGGTGTHRNGNGEGGGRGGGGKNGGNGSG
   109  359 A E    <   +     0   0   40  281   21  EEEEQPEEQEEEEEEEEEEEEEEQEQQQEEEEEEEEEEEEEEEEQQEEEEEQEQEEEEEEEEQQQEQNQE
   110  360 A P  S    S-     0   0   39  281    5  PPPPPcpPpPpPPpPPPPPPPPPPPPPpPPPPPPPPpPPPPPpPppPpPPPpPpPpPPPPPPpppPppPp
   111  361 A N        -     0   0   68  281   35  NnnndndRdNhNNdNNNNNNNNNnNddgNNNNNNNNnNNNNNnNngDeNNNnNhNdNNSNNNddgndsNn
   112  362 A N  S    S+     0   0  155  240   55  NdaaaNSNkNFNNSNDNNN..NNyNkkNNNNNNNNNNNNNNNFNa.NDN.NQNGNSNNNNNNtk.k.HNV
   113  363 A S  S    S+     0   0  100  252   92  ILPPFLRHWIKIIYIIIIL..IIDHWLNLLILLIILQIHISLRIW.WPDFYNVLARLDPLIIWW.K.WGA
   114  364 A G  S    S-     0   0   38  281   56  vSQQPyGQGvgavGaHvaassvagGSSgvvvNvvvaGvQaGagaGGGDQSkGGggGvQSfaaGGGSgGGG
   115  365 A N  S    S+     0   0   94  255   71  vDGGKnQEEvnlvRlNllvddvlnNTKdvvvDvvvv.vKlNvelENEGKAnIEgeHvK.vllEEN.nEEK
   116  366 A E        +     0   0   54  277   10  EEEEEEEEEEEEEEEEEEEEEEEQEEEQEEEEEEEEEEEEEEEEEQDEEEEQEEEEEEEEEEEEQEQEQE
   117  367 A D        +     0   0   21  280   44  DHDDNNDHDDDDDDDDDDDRRDDDDNNDDDDDDDDDNDNDDDDDDDDDKENDDDDDDKRDDDDDDNDDDH
   118  368 A d  E     -FK  81 129D   0  280    1  cCcccCCccccccCcCcccccccccccccccCcccccccccccccccCccccCCsCcccccccccccccc
   119  369 A A  E     + K   0 128D   0  278   87  sAaaiAVqtdqddVdAdddffddlriiydddVddddydndrdkdaqs.nwvpGAiIdnydddaahnhvvn
   120  370 A E  E     -FK  77 127D   6  281   79  SHTTRSMEGSNSSMSTSSSRRTSASRRHSSSSSSSSNSDSGSYSDDHADENKEHDMSDASSSDDDHHRRN
   121  371 A F  E     +FK  76 126D   1  281   91  NLGGFMMKKSFSSMSMASSSSSSSNYYPSSSMSSSSQSQSNSYSTSGRKNVSLFVMSKSKSSTTLGATTF
   122  372 A S  E >   - K   0 125D  18  281   83  SWSSYNLDDNDNNLNNNNNEENNRPGNTNNNTNNNNDNNNPNDNTGYMDRQHTTPLNDKNNNTTSTTDDS
   123  373 A G  T 3  S-     0   0   55  281   87  RGLLEKHKTPSPSSPKPPPEEPPDFGGSSPSKPPPPKPKPFPYPWGLGKGDSETLHPKQPPPWWGEGMES
   124  374 A S  T 3  S+     0   0  107  281   89  KNTTNGSWERERRHRGKRRWWWRGKITQRRRQRRRRWRWRQREREVKPWWKFGDASRWWRRREEALNKGP
   125  375 A G  E <  S- K   0 122D   6  281   65  NgaatggGekrqkgqgkqkGGkqSSYSgqkkgkkkqAkTqAknqagSvAGwqKgAgqAGqqqaagSgkrk
   126  376 A W  E     -jK 105 121D   0  280    3  WwwwwwwWwwwwwwwwwwwWWwwWWWWwwwwwwwwwWwWwWwwwwwWwWWwwLwWwwWWwwwwwwWwwww
   127  377 A N  E     - K   0 120D  37  281   20  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSFSNNNNNNNNSNNNNNNNNNNNN
   128  378 A D  E     + K   0 119D   0  281    6  DDDDDDDGDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   129  379 A N  E     - K   0 118D  30  281   86  IVAAFLAFRVAVIAVLVVVVVVVEAGGELVILVVVVVVFVAVVVIDTIFVFLVDVAVFVMAAIIDEERHY
   130  380 A R    >   -     0   0  103  281   79  PYPPPSPPSPQTPPTSPTPHHPTHPKDKPPPSPPPAPPSTPPETSASSPFPDGVSPPPYATTSSASHSYP
   131  381 A d  T 3  S+     0   0   16  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   132  382 A D  T 3  S+     0   0   88  281   80  FTSSQDTQDFAFFSFYFFFHHFFNPEESFFFNFFFLNFNFSFTFNTKKDDNNGRDTFDHFFFNNTSNSSS
   133  383 A V  S <  S-     0   0   45  281   92  YYRRNKnFAFNLYsFKFLFVVFLVYAANYFYKFFFFFFFLYLNFKAVVSTFSERHnFSGLFFKKAIVTSH
   134  384 A D        +     0   0   90  281   80  SPQQSTrQTNDNSlSTNNSPPSNEASIKNSSASNNRENENDNANPDSNKKESIPErNKANSSSPESESSS
   135  385 A N  B     -E   37   0C  10  281   91  MCFFLTDTLVNYMDYTMYLQQRYNLCLQMIMTIMMHAMAYLMNYLQHHTRRWKYNDMTQMYYLLQLNFHF
   136  386 A Y  E     -g   76   0D  49  281   96  PYKKQYGSRFYFPNFYLFFKKPFNKQKNFFPYFFFFSFSFKFFFQTRRSNRQRRSGFSTFFFQQTFNKQS
   137  387 A W  E     -g   77   0D  12  280   41  WYWWWWWRWRWRWWRWRRRSSWRWWWWWRWWWWRRRRRRRWRWRWWSSWSRRWWFWRWSWRRWWWWWWWS
   138  388 A I  E     -C   32   0B   0  280   16  IIIIVIIIIIIIIIIIIIVIIIIMIVVIIIIIIVIIIVIIIIMIVVIIIIIIIVIIVIVIIIVVVIMIIV
   139  389 A c  E     -CD  31  53B   0  280    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   140  390 A K  E     +CD  30  52B  28  279   54  EEEEEEEKEEEEEEEEEEEKKEEEQEEEEEEEEEEEKEREQEEEEEEEKEKEEEEEEKKEEEEEEEKEEL
   141  391 A K  E     -C   29   0B  46  260   65  MK KKRKKKMKMMKIRMMMMMMMMMKKKMMMRMMMMIMKMGMKMKKKKIMLTKT KMIMMRRKKKKIKNK
   142  392 A P  E     -C   28   0B  99  209   74  PS S KRP PN PRPKP PKKP      PPPKPPPPPPP TPK   PPTKPQSK RPTTP      SNT 
   143  393 A A        -     0   0   19  178   78  E    CSG       C   KK       E  CE   G G PAT   AAGKGA   SEGKD      PPP 
   144  394 A A  B     -A   17   0A  52  154   75       SIR       S   II          S    T K SEG   A TITV   SITIK          
   145  395 A a              0   0   87  102   46       CCV       C   YY          C    T I  I      AYP    CFAYS          
   146  396 A F              0   0  112   59   19         F           II               F L  L      FLF    YYFII          
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1  251 A Y     >        0   0  207  119    6  FF F  Y  Y  YF Y FF F Y F Y    Y F   F      YYFFF F             F     
     2  252 A Q  H  >  +     0   0  159  218   69  RRRRQECKKT DSNKRKNQKR SKA M QRKT IE NLRKKQRRTVRRRKA  Q HH HEKE  R EQN 
     3  253 A E  H  > S+     0   0   46  240   58  VAAAEENEEEEQSEEAEEEEAESENEL KEEE SNDESEENTEANLAAEEN  R RR HKEEH ANDEEE
     4  254 A L  H  > S+     0   0  100  257   44  LLLLMKVKNLILLGKLKGIKLLLKVIIMVKNLLLLLLLIKMLKLVLVVLKV MF VV VVLRMMVILMLL
     5  255 A T  H  X S+     0   0   54  257   75  EAEEKSSSSEAKTTSDSKSSEKTSFASAKSSEHSTGNGSSTSSETPAAESF AK QQ AKEDPAASEKVQ
     6  256 A D  H  X S+     0   0   89  258   93  GACALDNETCALCRENEGCEAVCELALALETCCSVICLKETSKAYNAANEL AL LL KLRRMAAASLLL
     7  257 A L  H  X S+     0   0   22  267   52  ISMVQVQLLTLEFVLTLLDLVFFLKLLLLLLTVPLLTLLLELLVLIVVALK LLLLLVRLLLLLVLLQAQ
     8  258 A K  H  X S+     0   0  129  267   63  KKKRRKSKEKKKSTKKKKNKRTSKSKYQRKEKKCFAKVKKESERQGRRRKS QRHRRKARQNKQKGKRTR
     9  259 A T  H  X S+     0   0   44  267   80  FIEFGGTSGWSNEESVSDNSFQESKSSGGGGWNTHPSVGSTEGLRKRRLSK GGGEELAGMTEGTSMGNG
    10  260 A A  H  < S+     0   0   30  268   72  QGnQGDLaKdhNgKaQaWgaSGgaGhFnNGKdhDSEvaSaAIGQGGGGQaG nNSSSQSNmnGnGTiGNN
    11  261 A F  H >< S+     0   0  120  191   75  N.m....s.smLv.sNs.ss.SvsImSs...lv.F.mr.s..S......sI s....L..kl.s..s...
    12  262 A E  H >< S+     0   0  116  220   71  G.EN.TETDEIQSVTGT.VT.IPTDIGE.TDEE.SDEG.T..TN..NNNTD E....E..QD.EN.D...
    13  263 A R  T 3< S+     0   0  139  234   73  SndS.WEWWdkKeWWSWHKW.WAWSeRR.WWddRaKdsRWW.WNQWSSSWS R....S..KK.RS.E...
    14  264 A L  T <  S+     0   0   42  136   68  .sdS..D..vg.v...........Lg.....vv.lVva.....S..SSS.L ............S.T...
    15  265 A a    <   +     0   0   39  167   85  CCWC..C..WC.W..C....C.W.EC.....WWGCWWNG....C..CCC.EC..........C.CCW...
    16  266 A R        +     0   0   37  227   79  ETSQ.NRNSSR.GGNEN.NSENGNKR.A.NSSSWRSSLSSSRNE.GSSESKPA.......K.RTSGP...
    17  267 A H  B     +A  144   0A  75  235   79  PPCP.CPCCCH.CCCPCCCCPCCCSH.C.CCCCTCCCQCCCQCP.CPPQCSKC.......TAQCPRK...
    18  268 A b        -     0   0   33  273    3  CCCCCCCCCCC.CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    19  269 A P    >   -     0   0   50  276   32  PSPPPPPPPPLNPPPPPPPPPPPPRLPPPPPPPCPPPPPPPDPPPPPPPPRRPPPPPPPPPPLPPPEPPP
    20  270 A K  T 3  S+     0   0  185  276   94  KPKKPIWIKKPlSSIDITLVTVAIIPPVMEKKKpKKKFFVKSFTMEDDTVIDVPMMMMSMSAPVDLAPEM
    21  271 A D  T 3  S+     0   0  140  278   70  SSNSFGGDNDGgTTDKDPNGSGSDGGDNFGNDNgGDDEGGNGGSFNSSSGGGNFFFFFGFRGGNSGGFFF
    22  272 A W    <   -     0   0   36  280    5  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    23  273 A T  E     -B   30   0B  32  279   88  LKTLFRERGKTIKKRLRSQRLRKRTTDVWRGKKRTRRSRRKKRLYILLLRTEVWYYYYTWSSTVLLEFYF
    24  274 A F  E     +B   29   0B  48  280   91  TASPSALAPPFFPSALAPHTSASALYFENAPPPRSLLFATPSASSAAAPTLEEYSSSSQNMKVEAIRSSS
    25  275 A F  E >   -B   28   0B  12  280   19  FFFYFFFFFFMYFFFFFFFLFFFFFMFHFFFFFFFFFFFLFFFFFSFFFLFFHFFFFFYFFFIHFFYFFF
    26  276 A Q  T 3  S-     0   0  115  280   59  QEGQNQSQSDNQGGQEQQQQEQGQNNSENQSDDQMGGNQQSDQENNEERQNEENNNNNGNSNNEENGNNN
    27  277 A G  T 3  S+     0   0   25  280   53  GGSGGSTSSSSSSSSGSSSSGSSSNSGRGSSSSRNSSGSSSGSGGTGGGSNGRNGGGGNGCCSRGSGGDN
    28  278 A N  E <   -BC  25 142B  39  280   71  SSNSRSKNNNLSSSNSNSSNSHSNFMSSRNNNHSSHHHNNNSNSRSSSSNFQSRRRRRRRSSMSSSSRRR
    29  279 A b  E     -BC  24 141B   0  280    8  CCCCCCCCCCCFCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    30  280 A Y  E     -BC  23 140B   2  280    0  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYCYYYYYYYYYYYYYYYYYYYYYYYYFYYYYYYYYYYY
    31  281 A F  E     - C   0 139B  36  280   45  FYFFKFYFFFYLFFFFFFFFFLFFFYFWKFFFFFFLLKLFFYFFKFFFYFFYWKKKKKLKLLFWFFFKKK
    32  282 A M  E     - C   0 138B  41  281   55  FMIFYPFPIPFIVIPFPIFPFPIPFFMFYAIPTLFVVVPPIIPFYIFFFPFFFYYYYYYYLLFFFFFYYY
    33  283 A S        -     0   0    1  281   50  SSSSVFSLSsaSSSLSLSSLSLSLSpSSVFSsSSsppFLLSVLSVSSSSLSSSVVVVVNVSSaSSsSVIV
    34  284 A N  S    S+     0   0  129  280   78  ERVVAHTTNdmATKTETTTTVNSTSiTRAHNdRLessKNTTTNVAFTTETCNRAAAAANAGElRTtNAAA
    35  285 A S  S    S-     0   0   54  281   73  PTEPTDDDGSSVEEDRDEDDPDEDELASTDGSDADSSTDDETDPTKNNPDENSTTTTTHTRRSSTVSTTT
    36  286 A Q        +     0   0   80  281   81  PTSKLNTNAVRQQGNPNLTNKNENLRSGRSAVTRTSSLNNSENKSLKKQNLTGPHNNHQRSSRGKKTLKQ
    37  287 A R  B     -E  135   0C  91  281   75  SAGAMKLKKERKNNKDKKMKTNKKKRRKMKKEAMMAAKKKAEKTVSTTAKKSKMMMMMMMGTRKAKSKMM
    38  288 A N     >  -     0   0   38  281   65  SLTATTSTSSSGFFTTTNTTTMVTSPPATTSSSNTSSSTTSNTTSNHHTTSKASSSSTTTSSSAHNSTTN
    39  289 A W  H >> S+     0   0   10  281    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    40  290 A H  H 3> S+     0   0   93  281   79  EHDEAVNANMQNTSAEATPAAASAELHAAANMSAPNNRAAQTGAATDDPAEEAAAAAASADDMADHTAAA
    41  291 A D  H 3> S+     0   0   80  281   56  ADEEDEDEDEEEKKEQEDSEAEKEAERDDQDEKEEKKEEEKEEADEQQEEAEDNDDDEQDEEDDKKDDDD
    42  292 A S  H <>S+     0   0    0  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    47  297 A Q  H ><5S+     0   0  119  281   87  AASAVTRSLSTKVVSASSSSASVSRLERVTLSSSSSSrTSAKTAVAAALSRQRLVVVVQVRRKRAIAVLV
    48  298 A E  H 3<5S+     0   0  146  281   75  NESGNGKGRGKDGRGLGEGGDGKGQKSLSERGLGRRReSGRSNDAGQQGGQLLSSSSSTSDDRLKKDNSS
    49  299 A V  T <<5S-     0   0   68  281   76  LKVAQLQMMIRRMMMIMMMMAMMMVQKEELMIRMMMMDMMMMMADVEENMVQEQQQQQIEKRQEERLQTE
    50  300 A R  T < 5S+     0   0  218  281   44  SEKGGGGGNGEGGGGSGGGGSGGGGGEDKGNGGGGGGGGGENGGGGQQDGGGDGRRRRNKGGGDQGGGDG
    51  301 A A      < -     0   0   14  281   22  AATAAAAAAASTAAAGAAGAAAAAAGAAAAAAASSAASAAASAAAAAAAAAAAAAAAAAAAASAAASASA
    52  302 A Q  E     -D  140   0B  78  281   49  HHHHNHDHHHDDHHHHHHHHHHHHDDHHNHHHHQQHHHHHHNHHNHHHHHDDHNNNNNNNDDDHHDDNNN
    53  303 A L  E    S-D  139   0B   1  280    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    54  304 A V        -     0   0    0  281   30  VVLVVVVMLVALVVMVMMVTVVVMVALVVALVLVVVVAATLVAVVLVVVTVVVVVVVVAVAVLVVVVVAV
    55  305 A V        -     0   0    3  281   52  IIVISTITVVVIVVTITTVTITVTVKVVSTVVVVIVVSTTVIIISVIIITVQVSSSSSSSVVVVIVKSSS
    56  306 A I        +     0   0    2  281    9  IIIVIIIIIIILILIVIIIIVIFIVLVVIIIIIIIIIIIIIIIVIIVVIIVVVIIIIIVIIIIVVIIIII
    57  307 A K        +     0   0  106  280   68  ENTGHSNSNHDNNNSGSSNSGSNSDDNTYSNHQNEQQQSSNNSGHNNNGSDSTHHYYYHYEDNTNDDHHH
    58  308 A T  S  > S-     0   0   51  281   49  GSTDSTNTTSSNTTTGTTTTGTTTTSNSSTTSSSTSSSTTTSTGSTNNDTTSSTSSSSSSSSSSNNSSSS
    59  309 A A  H  > S+     0   0   29  281   85  LRKLLEREKQRREKELEKEELEEESRAWEEKQQKQQQWEEREELLKLLLESRWSEEENYEPPRWLQRLLL
    60  310 A E  H  > S+     0   0  101  281   35  EEAEEATAAEEEAAAEADEAEAAAEENEEAAEEALEEAAAERADQEEEDAEKEDEEEEEEEEEEEQEEED
    61  311 A E  H  > S+     0   0    8  281    6  EEEEEEEEEEtEEEEEeEEEEEEEEkEEEeEEEEQEEEEEEEEEEEEEEEEEEEEEEEEEEDeEEEEEEE
    62  312 A Q  H  X S+     0   0    6  279   31  QQQQEQQQQQsQQQQQqQQQQEQQQtQQEtQQQQQQQSLQQQLQQQQQQQQQQEEEEEYEQQaQQQQEQE
    63  313 A N  H  X S+     0   0   50  278   62  GNDVNNENDDNNNNNGNQENGNNNKEQKNQDDDEEDDANNDKNGMLTTGNKEKSKEEEQNNTEKTEMNNN
    64  314 A F  H  X S+     0   0    2  279    7  FFFFFFFFFFLFFFFFFFFFFFFFFLYFFFFFFFFFFYFFFFFFFLFFFFFFFFFFFFFFYAMFFFFFFF
    65  315 A L  H  X S+     0   0    0  279   29  LLILVIIIILILIIILIILILVIILIFVVLILILLIIVIIILILVILLVILLVVVVVVIVLLIVLILVVV
    66  316 A Q  H  X S+     0   0   19  281   90  SIITKTSITPNRIVISINFTTIVISNSQKETPTYTTTAITFEITEYTTTTSTQRKKKKRKISKQTSEKNK
    67  317 A L  H  X S+     0   0   18  281   89  LSQRMQSQQRNTQQQRQQYQRQQQKNSHSKQRNEKGGNQQQNRRNQQQRQKDHSSSSSGSTNMHQHILSD
    68  318 A Q  H  X S+     0   0   16  281   90  HNKNLFhFKIYyqqFnFkTFNFqFNYiHLQKITQRIILFFNIFNLKNNhFNRhLLLLLVLliShntRLML
    69  319 A T  H  X>S+     0   0    3  163   81  ....I...................V...I.L..IF..I...T..IL..r.VV.IIIIIII.....dLIII
    70  320 A S  H  <5S+     0   0   54  188   70  ....R...L.Q.......K.....KQ..K.K..KA..S...D..KD..D.KK.GKKKKSK..R..MRKKK
    71  321 A R  H  <5S+     0   0   73  208   75  .S.TN...K.D.......P.T...KK..N.T.LQN..R...D.TNK..R.KQ.NNNNNSN..D..RENSS
    72  322 A S  H  <5S-     0   0   50  249   92  .DLRFL.LTLR...L.L.KLGL.LDS.IF.HLNPGLLNLLLSLRFR..GLEM.SFFFFAF..P..STFFT
    73  323 A N  T  <5 +     0   0  141  257   75  TDDGDD.DDDA...D.D.KDGD.DTS.GD.SDPPYDDVDDQYDGDFTTYDTM.DDDDDTD..S..GIDDD
    74  324 A R      < -     0   0   85  259   76  rReRhr.rstr...r.r.krRr.rWr.ph.AtrrSttfrreFrRpArrwrWr.phhhhhh..r..rkppq
    75  325 A F        -     0   0  105  227   68  l.y.tfcyyysdlfyyyfyf.ffy.synyFYyyyWyyhffy.f.rYllpf.lvplhhrlypesvlstvfr
    76  326 A S  E     -Fg 121 136D   3  262   86  gtYgNseFYFgFssFgFaYsgssF.ghTTsYFYYIFFVssF.sgTYggYs.FnTTTTTTTTAgnggFNTT
    77  327 A W  E     -Fg 120 137D   0  196    3  ww.wWfw...wWff.w.y.fwff..wwWWf.......Wff.WfwW.wwWf.WwWWWWWWWWWwwwwWWWW
    78  328 A M  E     -     0   0D   0  271   32  LIVLILMLVIIILLLLLVILLLLLIIIMILVIV..IIILLVILLIMIILLIIMIIIIIIIIIIMIIIIII
    79  329 A G  E    S+     0   0D   0  274    2  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGIGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    80  330 A L  E     + H   0  91D   0  280    6  LLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLGLLLLLLLLHLLLLLLLLLLLLLLLGLLLLLLLLLLL
    81  331 A S  E     -FH 118  90D  14  281   65  RSSRSSTRSSRTSSRRRSTRRTSRNRSHSTSSSLTWWSIRSKIRSSTTRRNTHSSSSSSSNNRHTTTSTI
    82  332 A D    >   +     0   0    7  281   23  ASDADHDDDDDDDDDADDDDADDDDDDDDSDDDFDDDDDDDRDADDAAGDDDDDDDDDDDDDDDADYDDD
    83  333 A L  T 3   +     0   0   84  280   87  VVLVAEVERPVQPPEVEPQEVEPEVVTQLERPPAQTTPEEPDEVIPTTVEVSQILIILALKKAQTKSALI
    84  334 A N  T 3  S-     0   0  122  280   78  RRQRQNANTGEEQQNRNEVTRNQNEDENHNTGKETGGENTENNRHERRRTEVNHHHHHQHEEDNREKQHH
    85  335 A Q  S <  S+     0   0   96  280   82  HDGRKPVALHQVGGARAGVAHTGATEEGKHLHGKVHHKHAGDHHKRTTSATTGMKKKKQKEQVGSTTKKK
    86  336 A E  S    S-     0   0  134  281   42  sgKaDEEKtREENNKrKKEKlENKEEEPEEtRHVERRREKQdElETrraKEEPEEEEEEEEEEPrEEDEE
    87  337 A G  S    S+     0   0   51  260   39  qkNqGGGGr.GDGGGeGHGGqGNGGGM.GGr.GGG..RGGRnGqGYnnqGGS.GGGGGGGGGG.nGGGGG
    88  338 A T        -     0   0   73  274   80  SHNSTLTQHQIKNNQGQQQQGQNQTTE.RQHQQQDQQVLQHGRGAQGGSQTT.RRRRRYRKTS.GTSTSS
    89  339 A W        +     0   0   21  280    5  YHWYYRWWWWWWWWWYWWWWYWWWWWWWWWWWWWWWWWWWWWWYWWYYYWWWWWWWWWWWWWWWYWWYWW
    90  340 A Q  E     -HI  81  96D 109  280   73  KRQQFQIRQQKIQQRQRQQRQRQRKKKKMHQQQQRQQRSRQRSQMQTTQRKLKMMMMMFMKKTKIVLFMM
    91  341 A W  E >   -H   80   0D   6  280    1  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWSWWWLWWWWWWWWWWWWWWWWWWWWWWWWWWW
    92  342 A V  T 3  S+     0   0   45  281   39  IIVVSVVVVVVVIIVVVVVVVVIVATVVSVVVVVEVVSVVVVVVSVVVVVTVVSSSSSMSIVLVILPSSS
    93  343 A D  T 3  S-     0   0   68  281    5  DDDDDNDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNDDDD
    94  344 A G  S <  S+     0   0   42  281   45  GEQGGRGQEQGGKQQGQRSQGQKQDGGGGKEQQKGQQGKQRGKGGQGGGQGGGGGGGGGGGGGGGNRGGG
    95  345 A S        -     0   0   33  281   56  VTTVSTTTITRSTTTVTSTTVTTMNSTTCTITTTSTTSTTTTTVSSSSVTNSTSCCCCTCTTTTTVSSSS
    96  346 A P  B     -I   90   0D  99  281   49  PDPPRPQPPPTSPPPPPPPPSPPPPRDDAPPPPPPPPRPPPLPSKPKKSPPpDVAAAARAPPRDKTPTKA
    97  347 A L        -     0   0   17   83   32  ........................LL.........................e........L.........
    98  348 A S    >   -     0   0   42  188   78  ..Y..F.FYY.PYYF.FY.F.FYFTTYY.FYYYY.YY.FFYHF..Y...FLQY.......T..Y..L...
    99  349 A P  G >  S+     0   0  113  194   84  ..N..N.NNN.SKTN.NN.N.NENKERE.NNNDN.EE.KNNNN..D...NTGE.......L..E.EN...
   100  350 A S  G 3  S+     0   0   62  280   89  LLELYPLPEGLFEEPLPEFPLQKPGSTTVPEGQVLEEFPPELPLVKLLLPKFTVVVVVFVKLVTLVTFMV
   101  351 A F  G X  S+     0   0   18  281   88  STSSNHTRSNNGNNRSRSSRSHNRYFTGSQSNNTTSSLDRSSHSDSTTGRGVGHNSSSTSPTEGTESNDN
   102  352 A Q  G X  S+     0   0   85  281   87  FFAFFMERAAEFVVRFRVLTFMVRLSPFFMAAAAQIIYITSENFYVFFFTYLFYFFFFFFSLEFFPLFFF
   103  353 A R  G 3  S+     0   0  178  281   84  STTSKEGVTTGNRRVSVSSVSVRVSSHKVVTTTASTTRLVTGLSTTSSSVLTKSVVVVTVRIGKSRSNLT
   104  354 A Y  G <  S+     0   0   31  281   36  HYFHLFYFFFFNLLFHFFFFHFFFYYFNYFFFSFFFFSFFFFLHYFYYHFYFNNYNNYQYYNYNYYFFYF
   105  355 A W  B <  S-j  126   0D  19  281    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWRWWWRWWWWWWWWWWWWWWWWWWWWWWWWWWW
   106  356 A N    >   -     0   0   37  281   72  NSHNNHSHHHNQHHHNHHDHNHHHHNDRRHHHHLFHHKHHHYRNGHNNNHYHRLHDDHCHEQNRNMANDL
   107  357 A S  T 3  S+     0   0  126  281   81  TPSQAKAKEEDSQQKTKHVDQKLKEDDPAEEESKTNNLEDPEEQPPIILDKNPAAAAAQASEIPEDPTGS
   108  358 A G  T 3  S+     0   0   62  281   34  GGGGGGGNGGGGNGNGNGGKGNGNTGGEGGGGDGHGGGDNHGGGGGGGGNNREGGGGGGGNGGEGGGGGG
   109  359 A E    <   +     0   0   40  281   21  EEEEEEEEEEEEEEEEEEEEEEEEQEQQEEEEEEEEEEEEEEEEEEEEEEQEQEQEEQEEQNEQEEQEQE
   110  360 A P  S    S-     0   0   39  281    5  pPPpPPppPpPPPPpppPPppPPppPppppPpPPpPPPPpppPppppppppppPPPPPppppPppppPPp
   111  361 A N        -     0   0   68  281   35  dNNdNNenNdNnNNndnNNndNNnnNghnhNdSSqSSNNndnNdnddddnddhNDNNDnndsNhdpgNDn
   112  362 A N  S    S+     0   0  155  240   55  SDDSNN.S..Nn..SSS.NYANHSaNdGGQ....D..N.Y.E.AS.SSSYkvGNNNNNHGrHNGSd.NNK
   113  363 A S  S    S+     0   0  100  252   92  RALLSH.Q..QAFFQRQ.IQRYSQWHHLGR...GISSL.Q.A.RR.RRRQWRLLTSSARGWWQLRY.AAP
   114  364 A G  S    S-     0   0   38  281   56  RgSGgQNGnNGGSSGGGtaGGEAGGGTgGKnNggKGGlnGPGnGGNRRGGGGgeggggGGGGNgKHgggP
   115  365 A N  S    S+     0   0   94  255   71  Qq.RsK..k.NNAA.Q.dl.RE..EN.gA.k.tdGNNnk.NTeRRNNNQ.E.gnfnnnNAEENgNTesnK
   116  366 A E        +     0   0   54  277   10  EEEEEEEEEEEEEEEEEEEEEEEEEEEEE.EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEVEEE
   117  367 A D        +     0   0   21  280   44  DDHDANDNRQDDEENDNRDNDNQNDDDDHNRQFNDKKYNNRDNNHHNNDNDDDHHHHHHHDDDDNDDPND
   118  368 A d  E     -FK  81 129D   0  280    1  CCcCcccccccCcccCccccCccccccCcccccccccccccCcCccCCCcccCccccccccccCCccccc
   119  369 A A  E     + K   0 128D   0  278   87  VVaVtngyahrAwwyVyfdyVywyarhAnnahpsprrwnykGvVisIIVyaiAnttttvnivrAInttnn
   120  370 A E  E     -FK  77 127D   6  281   79  MVSMNDVNPESKNNNMNRSNMAKNDSRHNEPENEHWWSANTHNMNVMMMNDNHNNNNNNNRRDHMEENMN
   121  371 A F  E     +FK  76 126D   1  281   91  MMPMYQNQSNNVQPQMQDSQMDPQTNYFFQSNVKTKKWQQPLVMDKIILQTGFFWLLYFFTTNFINNSYF
   122  372 A S  E >   - K   0 125D  18  281   83  LLRLGNDDRTPNRGDLDEDDLDADTPSTDDRTKSDTTSDDKWQLPALLLDTNTGLSSSSDPDPTLFPGTR
   123  373 A G  T 3  S-     0   0   55  281   87  HSKHPKVKKGFPGGKDKNPKRKGKWFYDTKKGGLPGGGKKRIDHGNYYHKWIDPEDDNGTAMFDYFAPHT
   124  374 A S  T 3  S+     0   0  107  281   89  SNWTSWKWWWMGWWWSWWRWTWWWEKGDNWWWWNLWWYWWWEKTTWTTTWENDVALLLSNNKNDSREAHD
   125  375 A G  E <  S- K   0 122D   6  281   65  ggGgkANAGGSGGAAgAGrAgSGAaSRgkGGGGNnGGlAAGkwgvGgggAaCgkkkkkkknkSggAvrKk
   126  376 A W  E     -jK 105 121D   0  280    3  wwWwwWWWWWWWWWWwWWwWwWWWwWWwwWWWWWwWWwLWWwrwwWwwwWwWwwwwwwwwwwWwwWwwWw
   127  377 A N  E     - K   0 120D  37  281   20  NNNNNNNNNSNANNNNNNNNNNNNNNNNNKNSSNHNNNNNNNNNNNNNNNNSNNNNNNNNNNNNNNYNNN
   128  378 A D  E     + K   0 119D   0  281    6  DDDDDNNDDDDDDDDDDDDDDDDDDDDDDDDDVDDDDDDDDDDDDNDDDDDDDDDDDDDDDDDDDDDDDD
   129  379 A N  E     - K   0 118D  30  281   86  ATVAKLIVCSAYVVVAVAVVAIVVIADDVFCSASAIIQFVVVFAHAAAAVIRDEHRRYGVRRADALRKYE
   130  380 A R    >   -     0   0  103  281   79  PPRPVSKPSSPPFFPPPSTPPSIPSPRVPSSSPRPSSNPPHYPPFPPPPPSAVPQQQQTPSSPVPERVVY
   131  381 A d  T 3  S+     0   0   16  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCSCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   132  382 A D  T 3  S+     0   0   88  281   80  NHNDTNENNSNGDDNGNGFNDNENNPTQSKNSDDTSSRNNITNDSHNNSNNSQSSSSSDSGSNQAGDTSS
   133  383 A V  S <  S-     0   0   45  281   92  stQnVFSFEDYSSSSnFEFFsYTSKYTRVLEDGWMLLSFFVDFsYEnnsFKHRRVVVLSVATWRnSDDLV
   134  384 A D        +     0   0   90  281   80  mlHrKESEFKETSKErETSEkEREPAPPTEFKDKKKKKEEHQEkNSnnlEPPPGNNNNRTSSNPnRDATL
   135  385 A N  B     -E   37   0C  10  281   91  DEQDYAVAHQLFRRADAQMADRRALLYYYTHQHRYQQRTAQYTDVQDDDALEYYLLLLFYLFLYDQLHFI
   136  386 A Y  E     -g   76   0D  49  281   96  GKKGSSLSKKKKHNRNSRLSGGNSQKRRTSKKRYPKKYRSRKKGPNNNGSQRRPAAAAPTLKKRYNRSSP
   137  387 A W  E     -g   77   0D  12  280   41  CWFWSRWRFLWWSSRWRSRRWRSRWWFWSRFLLRRSSFRRSAGWFSWWWRWSWSSFFSFSWWWWWWSFFS
   138  388 A I  E     -C   32   0B   0  280   16  IVIIVIIIIVIIIIIIIIVIIIIIVIIVVIIVIIIVVVIIVIIIVVIIIIVIVVVVVVIVVIIVIIIVVV
   139  389 A c  E     -CD  31  53B   0  280    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   140  390 A K  E     +CD  30  52B  28  279   54  EEKEKKEKKQQEEEKEKEEKEKEKEQEEAKKQEEEQQKKKEEKE EEEEKEEEVAAAAVAEEEEEEEKKV
   141  391 A K  E     -C   29   0B  46  260   65  KKMKAK IMV RMMIKIMMIKTMLKMKTTIMVMANMM LIMRLK MKKKIKKTKTTTTRTKK TKKKLKS
   142  392 A P  E     -C   28   0B  99  209   74  RRMRRP PMK  KKPRPTPPRSNP  E RPMKRAKKK PP KPA  RRRP P RQRRR R    RA RHR
   143  393 A A        -     0   0   19  178   78  RQKSPG GKK  KKGRGK GHGKG  T VGKK AG   GG LG   QQRG E NIIIM V    QP PCK
   144  394 A A  B     -A   17   0A  52  154   75  SSIGVK TII  IVTSTI ANIIT    AIII      TT TT   QQRT   ATNNN A    QT YVI
   145  395 A a              0   0   87  102   46  CCYCCI TYY  YYTCTY TCAYT    CAYY      AT CA   CCCT   CCCCC C    CY CCC
   146  396 A F              0   0  112   59   19    L  L LLL  LLL LL L FLL     FLL      FL  F      L                    
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1  251 A Y     >        0   0  207  119    6    YY     F        F YY    YYYL Y YF        Y    Y   F   F       L   Y 
     2  252 A Q  H  >  +     0   0  159  218   69    NQRR   RK Q  R RE GR Q QNNNN T DE KQ     RDD  YHHQPHHHLQE ER QDK KK 
     3  253 A E  H  > S+     0   0   46  240   58  EESNEE  QANEEH K EDNSI EHKRRRDDEDIN ES     TEE  KRRKKRRRSKEDHE KDEEEEQ
     4  254 A L  H  > S+     0   0  100  257   44  LLVLKKLLLLMLLL F LMLRL LLLEEELLLLLI LLLLLLLNLLM IVVVTVVVFVLLIK LLLLLLL
     5  255 A T  H  X S+     0   0   54  257   75  QQLTPSETPETEEP K ETKEE IPKQQQNGEGQT NLSSSSSSTIA VEEKPQQQSKVLES KNNQNNT
     6  256 A D  H  X S+     0   0   89  258   93  QLEEEECHQATCCMNL RTCDA IMLNNNCICIMD CELLLLLNNKA KLLLDLLLDLAEAK LCCLCCN
     7  257 A L  H  X S+     0   0   22  267   52  QQVELLVFFVEVIIML LTVLA HILLLLTLTLVLMILLLLLLTLLL VLLLVLLLDLIMLLLLTIQIIM
     8  258 A K  H  X S+     0   0  129  267   63  RRRNKKKLKREKKRTR QRRCQ TKRSSSKAKASNTKRVVVVAQLKK KRRRKHRRRRKKLKERKKRKKE
     9  259 A T  H  X S+     0   0   44  267   80  GGDHGGKLDLTSTETG SDNSK STGRRRNPWPQMANGVVVVLQYGS AGGGDGEEAGESQGVGNNGNND
    10  260 A A  H  < S+     0   0   30  268   72  NNQIGTngSQAnnGEA lNnRg DEGAAAvEaEGEVvlaaaaaPDqn SNNNQNSSvNRnVTAGvvNvgN
    11  261 A F  H >< S+     0   0  120  191   75  ..LL..mvC..tt... kLmFt ...LLLt.l..IVmclllll..ns I.......l.Fs....tm.mm.
    12  262 A E  H >< S+     0   0  116  220   71  ..QHTEEQVN.QK.E. QQECA HE.NNNEDED.KDETNNNNN..DQ D.......Q.PQ.T..EE.EE.
    13  263 A R  T 3< S+     0   0  139  234   73  ..kTWeeNKNWeg.T. KRgHG KG.NNNdKdK.qseReeeee.krNKD.......H.NPNWD.de.ed.
    14  264 A L  T <  S+     0   0   42  136   68  ..f..tv..S.vi... ..vV. ......aVvV.rfs.nnnnn..i..P...T...........as.sv.
    15  265 A a    <   +     0   0   39  167   85  ..D..WWC.C.WWCA. ..WC. CC.SSSCWWW.LPW.SSSSS..C..C...C.....Q...C.CW.WWC
    16  266 A R        +     0   0   37  227   79  ..R.NNSGKESSSRW. K.TA. NR.AAASSSS.KSSVSSSSS..DT.Y...D...G.HG.ND.SS.SSG
    17  267 A H  B     +A  144   0A  75  235   79  ..AKCCCRTPCCCHS. T.CP. PH.QQQCCCC.LSCTCCCCC..TCTK...K...N.SC.CE.CC.CCQ
    18  268 A b        -     0   0   33  273    3  CCRYCCCCCCCCCCCCCC.CCCCCCCCCCCCCC.CCCCCCCCC..CCCCCCCCCCCCCCCCCCCCCCCCC
    19  269 A P    >   -     0   0   50  276   32  PPKDPAPQPPPPPLCPEAKPRQPPLPPPPLPPP.KPPPPPPPPP.PPPEPPPEPPPPPPPPPTPLPPPPL
    20  270 A K  T 3  S+     0   0  185  276   94  MMnlVVKSETKKKPpMESlEMPKKPLEEEKKKK.PKKEQQQQQq.SIEDMMMGMMMPMPRLFPLKKMKKP
    21  271 A D  T 3  S+     0   0  140  278   70  FFneGGNGGSNNNGnFGGnKGGNMGFDDDDDDD.EGNGDDDDDggGGGGFFFGFFFFFNDLGGFGNFNDN
    22  272 A W    <   -     0   0   36  280    5  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWYWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    23  273 A T  E     -B   30   0B  32  279   88  FFKKRRKRTLKKKTKWERVKTEKQSFQQQKRKRKKTKLLLLLLTFNLTNYYWEYYYWWTEIRAFKKFKKV
    24  274 A F  E     +B   29   0B  48  280   91  SSKKASSLMSPSSFPSLMASLQSWFSYYYSLPLYYMPPPPPPPYYREMQSSIQSSSSISHSAWSSPSPPL
    25  275 A F  E >   -B   28   0B  12  280   19  FFFFFFFFFFFFFMFFHFFFFFFYMFHHHFFFFFFWFFRRKRRFYIYFNFFFHFFFFFFFFFYFFFFFFM
    26  276 A Q  T 3  S-     0   0  115  280   59  NNDGRQSNREGSSNSNGSDSQHGQSEAAAGGGGKKRGENNNNNQQGESGNNNGNNNSNGGNQDEGGNGVN
    27  277 A G  T 3  S+     0   0   25  280   53  NNLSSSSMGGSSVSSGGCGSDRSNSGGGGSSSSESGSGGGGGGSSAGPEGGGGGGGSGTENSGGSSNSSS
    28  278 A N  E <   -BC  25 142B  39  280   71  RRGSNnNSSSNHHLNRKSSSRRNSSRKKKYHYHNSIHKFFFFFSSSSSERRCTRRRRCSSHNRRYHRHHT
    29  279 A b  E     -BC  24 141B   0  280    8  CCCFCcCCCCCCCCCCCCLCCCCCCCCCCCCCCFIYCCCCCCCFFCCCCCCCCCCCCCCCCCCCCCCCCC
    30  280 A Y  E     -BC  23 140B   2  280    0  YYYYYFYYYYYYYYYYYYFYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFYYYYYYY
    31  281 A F  E     - C   0 139B  36  280   45  KKFFFPFLLFFFLHFKYFHFFLFYYKYYYFLFLYYKWYKKKKKYYYWLYKKKNKKKKKLWKFLKFWKWFF
    32  282 A M  E     - C   0 138B  41  281   55  YYFFPLIHLFIIFFIYFLVFQFVFFYFFFTVTVFIAVFVVVVVLFFFLFYYYFYYYYYVFYPYYTVYVIF
    33  283 A S        -     0   0    1  281   50  VVSSFNSsSSSSSpSVSSSSSSSapFsssspspSSFtSFFFFFSSSSSSVVVSVVVVVWSVLVFstVtla
    34  284 A N  S    S+     0   0  129  280   78  AAKTN.TqTVTTNyTANESTRSTnfGtttdsdsQTNySNNNNNNNKRTSAAAIAAAAANRSNNGdyAydl
    35  285 A S  S    S-     0   0   54  281   73  TTLEDDEHRPEHDSETNKGDSTEEYSNNNSSLSVETSTDDDDDEEESRSTTTSATTTTEDNDVSSSTSSP
    36  286 A Q        +     0   0   80  281   81  QQTQNNSLDKSSFSSRKTKALTSERRTTTKSVSPKKKTLLHHHSTTGYEHHHKHHHPHKQRNKRKKQKKR
    37  287 A R  B     -E  135   0C  91  281   75  MMKKKKAKGTAKKKAMSGKKGQKRTVLLLAAAAKKKAKKKKKKKKALGSMMMSMMMMMRKMKQVAAMAAK
    38  288 A N     >  -     0   0   38  281   65  NNNTTTPTSTSPTTSASSSSTRSTSTDDDTSSSTSNSSNNNNNSSTTSSSSSSSTTSSTTTTSTTSNSSS
    39  289 A W  H >> S+     0   0   10  281    0  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWFWWWWWWWWWWWWWWWWWWWWWWHWWWWWWWWWWW
    40  290 A H  H 3> S+     0   0   93  281   79  AANSAAQHEAQNNLQANDQNDQSTNGFFFDNNNYSNSDNNNNNTTGPENAAANAAASAEDVDAGDNANNS
    41  291 A D  H 3> S+     0   0   80  281   56  DDQDQEEDNAKEEDKDEEQDAAENEEKKKEKEKSDDEEDDDDDDENQNEDDDKDDDDDDEDKVEEEDEEA
    42  292 A S  H <>S+     0   0    0  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    47  297 A Q  H ><5S+     0   0  119  281   87  VVIRSTALRAASYKALRRLSAQSMRVIIISSFSMRGFQrrrrrKRIQRRVVVRVVVLVIKVMLVSFVFST
    48  298 A E  H 3<5S+     0   0  146  281   75  SSSEGGRRDDRSRRRSADQRSSQDRSSSSRRHRSNESEkkkkkGDGLATSSSASSSSSRASRSSRSSSHK
    49  299 A V  T <<5S-     0   0   68  281   76  EEKRMMMRQAMMMIMQKRKMLQMRQEDDDMMMMRKYMNPPPPPRKLEQRQQQKQQQQQYQQMLEMMEMMK
    50  300 A R  T < 5S+     0   0  218  281   44  GGGGGGEGGSEEEGEGGGGEGNGNGGGGGGGGGDQGGYGGGGGKRKDGGRRRGGRRGRGDDGDGGGGGGE
    51  301 A A      < -     0   0   14  281   22  AAGAGAAAAAAAAGAAGAAAAAASGAGGGAAAASAGASCCCCCAAAAAGAAAGAAAAASSAAGAAAAAAA
    52  302 A Q  E     -D  140   0B  78  281   49  NNDDHHHDDHHHHDHNDDDHMDHTDNHHHHHHHQDTHHHHHHHDDMHDDNNNDNNNNNKHNHNNHHNHHD
    53  303 A L  E    S-D  139   0B   1  280    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    54  304 A V        -     0   0    0  281   30  VVAVAALAVVLLVALVVVMVLVLVAVVVVLVVVTLVLVAAAAAIILVVVVVVVVVVVVVVVAAVLLVLVL
    55  305 A V        -     0   0    3  281   52  SSVITTVVIIVVVVVSKVIVQVVKISIIIVVVVSIMVISSSSSTIIVIKSSSKSSSSSEISTSSVVSVVV
    56  306 A I        +     0   0    2  281    9  IILIIIIIIVIIIIIIIIIIVIIIVIIIIIIIIVIPIIIIIIIIILVIIIIIIIIIIIIIIIMIIIIIII
    57  307 A K        +     0   0  106  280   68  HHNNSSNNDGNNNDNREDNNTNNDNHNNNHQHQANRHSDDDDDNNRGNDHHHDYHHHHENHSTHHHHHHN
    58  308 A T  S  > S-     0   0   51  281   49  SSSSTTTNSGTTSSTNSSSNSDSSNSNNNSSSSSSDSSDDDDDNNDSSSSSSSSSSNSTTSTSSSSSSSS
    59  309 A A  H  > S+     0   0   29  281   85  LLKRGEQLLLREKRRTRSQKHQKLRLRRRQQQQERAKFSSSSSRKPWLSEEERENNMEGRLERLQKLKQK
    60  310 A E  H  > S+     0   0  101  281   35  DDEEAAEQEDEEEEEEEEEEAMAEENDDDDEEESEDEAEEEEEQQTKKDEEEEEEEEEEAEANNDEDEAE
    61  311 A E  H  > S+     0   0    8  281    6  EEEEEEEeEEEEEkEEEEeEeEEEkEEEEEEEEEETEeeeeeeEEeEEEEEEEEEEEEEEEEEEEEEEEE
    62  312 A Q  H  X S+     0   0    6  279   31  EEQQQQQyQQQQQmQQQQkQvQQKtHQQQQQQQQQNQgaaaaaQQkQQ.EEDQQEEEDNQHLYHQQHQQQ
    63  313 A N  H  X S+     0   0   50  278   62  NNAKNNDEQGDDDNDSTDNDSNDDRNEEEDDDDEEADPEEEEEDDRKK.EEENNEEIEGLNNNNDDNDDE
    64  314 A F  H  X S+     0   0    2  279    7  FFFFFFFYKFFFFLFFFFFFYYFFFFFFFFFFFFFFFFYYYYYFFFFF.FFFFFFFFFFYFFFFFFYFFF
    65  315 A L  H  X S+     0   0    0  279   29  VVVLIIILFLIIIIIVLLVLMLILLVLLLIIIILILIQVVVVVVIALL.VVVLVVVVVIVVIIVIIVIII
    66  316 A Q  H  X S+     0   0   19  281   90  KKNITLFPLTFIINFKEVNTKAIKTNMMMNTTTYNFTASSSSSMMQQSQKKKQRKKRKRQKSRNNTQTTT
    67  317 A L  H  X S+     0   0   18  281   89  DDGDQQQKSRQQQNQNRSQQVSKSIFSSSTGGGKASGLDDDDDTKRQIRSSSRTSSSSNRAQDFTGSGSD
    68  318 A Q  H  X S+     0   0   16  281   90  LLWQFFNrSNNNNYNLRfFNPKDQNLKKKIIIIMNLIEYYYYYLiGHIFLLLRLLLLLnrLFlLIILINt
    69  319 A T  H  X>S+     0   0    3  163   81  IIL....sI..LL.LIL....A...ITTT.L..A.H..LLLLL...MNLIIIVIIIIIl.I.yI..I..a
    70  320 A S  H  <5S+     0   0   54  188   70  KKK....IN..KKQQMR....D..QKNNN.D..G.N..RRRRR...YTQKKERKKKEES.K.KK..K..L
    71  321 A R  H  <5S+     0   0   73  208   75  SST....RRT.KIDEND....S.PDNKKK.T..G.A..SSSSS...PRTNNNENNNINP.K.AN..S..R
    72  322 A S  H  <5S-     0   0   50  249   92  TTS.LLLPRRLDIPEFV..M.VLLLFYYYLHLLL.VLSGGGGG...VHKFFFIFFFFFS.SLSFLLVLLY
    73  323 A N  T  <5 +     0   0  141  257   75  DDQEDDQWRGQISSSDM.KDARNPSDKKKNADDF.SNQGGGGGT.SDSTDDDMDDDDDD.DDGDNNDNNn
    74  324 A R      < -     0   0   85  259   76  qqNkrrewSReDArAht.KkSHqtrpGGGiAttYfdrwNNNNNr.R.WGhhhthhhhhd.irkpirlrtp
    75  325 A F        -     0   0  105  227   68  rrAdffygW.yY.sYhkqLy..yfsw...yYyy.enyf.....ee...Ywwrktwwarvyrfqwyyryyn
    76  326 A S  E     -Fg 121 136D   3  262   86  TTWFspFgIgFY.gFTFTLF..YFgTsssFFFF.AFFPVVVVVFFHT.FTTTFTTTTTrTTsTTFFTFFg
    77  327 A W  E     -Fg 120 137D   0  196    3  WW.Wff.w.w..Yw.WWWW.WW.WwWwww....WWW.WWWWWWWWWW.WWWWWWWWWWwWWfWW..W..w
    78  328 A M  E     -     0   0D   0  271   32  IIIILLVI.LVIVIVIIIIMMIVLIIIIII.IIIIFIPIIIIIIIIIIIIIIIIIIIITIILVIIIIIIM
    79  329 A G  E    S+     0   0D   0  274    2  GGGGGGGGGGGGGAGGGGGGGGGGGGGGGG.GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    80  330 A L  E     + H   0  91D   0  280    6  LLLLLLLLLLLLLLLLLLLLLFLLLLLLLLILLLLLLWLLLLLLLLLLLLLLLLLLLLGLLFALLLLLLL
    81  331 A S  E     -FH 118  90D  14  281   65  TIFTRTSTSRSSSRSSTNTSTTSSRTTTTSGSWTTHWRNNNNNTTKNSTSSSTNSSSSTTSIHTSWTWLK
    82  332 A D    >   +     0   0    7  281   23  DDDDNNDDDADDDDDDDDDDDDDWDDDDDDLNDKDDDEDDDDDDDRDDDDDDDDDDDDDDDDDDDDDDDD
    83  333 A L  T 3   +     0   0   84  280   87  IIIQEEPIKVPPPGPKSKSPQQPDVMKKKHWPTTAQSIPPPPPSIEQKSIILSLLLILATIESMHSLSAE
    84  334 A N  T 3  S-     0   0  122  280   78  HHEDNNEQDREEEDEHAEEEAGEPEHSSSSDGGGVHGGRRQRREKSNDAHHHAYHHHHYSHNAHSGHGGH
    85  335 A Q  S <  S+     0   0   96  280   82  KKTTLPGTIHGGGEGKVETGLTGSEKTTTETDHSKEHIKKKKKKKSGTEKKKVKKKRKDGKHQKEHKHQT
    86  336 A E  S    S-     0   0  134  281   42  EEEEDEQEElQQQEQEEEEEEEQREEEEENgQREEERAQQKQQEENPEEEEAEEEEEAEQEGKENRHRRE
    87  337 A G  S    S+     0   0   51  260   39  GGGSGGRGGqRRKGRGGGGGGGGRGGGGG.r..GGG..RRRRRGG..GGGGGGGGGGGG.G.GG..G..G
    88  338 A T        -     0   0   73  274   80  SSTVQQHNTGHDQMHTRRTRAVHSVGQQQQQQQDDSQ.CCCCCQTA.TRRRSRRRRRSN.TGTGQQSQQV
    89  339 A W        +     0   0   21  280    5  WWWWWWWWWYWWWWWWWWWWWWWWWWWWWWWWWWWFW.WWWWWWWWWWWWWWWWWWWWWWWQWWWWWWWW
    90  340 A Q  E     -HI  81  96D 109  280   73  MMKKHHQTKQQQQRQMVKKQMHQVKILLLQQQQYKEQ.QQQQQKKKTKLMMMLMMMMMIRMSFIQQMQRK
    91  341 A W  E >   -H   80   0D   6  280    1  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW.WWWWWWWWWWWWWWWWWWWWWWWLWWWWWWWW
    92  342 A V  T 3  S+     0   0   45  281   39  SSVVVVVVIVVVVVVSVVVVVVVEVSVVVIVIVVVLVFTTTTTVVLVIVSSSVSSSSSSVSVTSIVSVIL
    93  343 A D  T 3  S-     0   0   68  281    5  DDDDDDDNDDDDDGDDDDDDDDDDDDDDDDDDDDDDSEDDDDDDDDDDDDDDDDDDDDMDDNDDDSDSDN
    94  344 A G  S <  S+     0   0   42  281   45  GGGGKKQNGGRQHGRGGGGQGNQGGGNNNQQQQNGGQSRRRRRGGGgGGGGGGGGGGGTGGKGGQQGQQG
    95  345 A S        -     0   0   33  281   56  SSTQKTTVTVTTSTTCSTTTTTTSTSRTTTTTTTSSTLSSSSSSSTdTSCCCSCCCSCGTSTSSTTCTTT
    96  346 A P  B     -I   90   0D  99  281   49  AAVKPPPPPSPPPRPPPPRPHTPGRKQKKPPPPpAAPRRRRRRTIQPLPAAAPAAAVAKIKAKKPPAPPI
    97  347 A L        -     0   0   17   83   32  .................................d...........MH.......................
    98  348 A S    >   -     0   0   42  188   78  ....FFY...YYY.Y.L..YP.Y...LLLYYYYK..Y........TL.L...L.....PY.F..YY.YY.
    99  349 A P  G >  S+     0   0  113  194   84  ....NNNL..NNN.N.NL.NA.NP..SSSNEDEV.LNL.......FS.N...N.....IT.N..NN.NN.
   100  350 A S  G 3  S+     0   0   62  280   89  VVVLPPEQLLEEELEVETMQTTESLYTTTEEDEQLGALNNNNNLLSALEVVVEVVVAVTMVPFYEAAAKM
   101  351 A F  G X  S+     0   0   18  281   88  DNTTQHSDTSSSTSSRSSTSNASPTTDDDSSNSSTTSTSSSSSTTLFTSSSSSRSSRSTNDHATSSKSST
   102  352 A Q  G X  S+     0   0   85  281   87  FFTHMISGAFSVAESFLLTAAFISEFIIIVITIATYAVYYYYYTSCLALFFFLFFFFFFSFNFFVAFAAE
   103  353 A R  G 3  S+     0   0  178  281   84  TTTKVVTGASTAAGTVETSTSTSLGSRRRTTTTRENTSLLLLLGGRRKTAAVKVVVFVERVLDSTTKTTG
   104  354 A Y  G <  S+     0   0   31  281   36  FFYFFFFYYHFFFYFYFFYFYLFFFLYYYFFFFFFNFFTTTTTFFNNYFYYYFYYYNYSDTLQLFFLFFY
   105  355 A W  B <  S-j  126   0D  19  281    0  WWWWWWWWWWWWWWWWWWWWWWWSWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   106  356 A N    >   -     0   0   37  281   72  LLQKHHHMYNHQFNHSSSNHQAHTNNNNNHHHHIWAHDQQQQQAAGSYFHHHKLHHKHRSNHSNHHSHHM
   107  357 A S  T 3  S+     0   0  126  281   81  SSPTKEPQRQPERDPPKPSPTPPKVSGGGKNKNPTPKPPPPPPSSVPRDVVPGPAATPTPQEYSKKTKKD
   108  358 A G  T 3  S+     0   0   62  281   34  GGGHRGLGDGHGKGHTGRGGGGGEGGQQQGGGGGGGGEGGGGGFSGRDDGGAPNGGGAGGGGGGGGGGGG
   109  359 A E    <   +     0   0   40  281   21  EEQEEEEEAEEEQEEQEQEEEEKYEQEEEEEEEEEQEEEEEEERGEQAQQQEEQQQEEEQQEEQEEEEEE
   110  360 A P  S    S-     0   0   39  281    5  ppPpSPpPnppPpPPpppPPPppaPppppPPpPPPPpPPPPPPssppnpPPpppPPPppppPPpPppppp
   111  361 A N        -     0   0   68  281   35  nnNdNNdNgddNnNSnedNSShngNnnnnNSdSNNNdNNNNNNeenhgeDDnhnDDNndhnKNnNdndqd
   112  362 A N  S    S+     0   0  155  240   55  KKSANN.NgA..SN.QHq....pSNDEEE....NNN.NNNNNNnnD.gDNNGPWNNNGDGH.ND..F.DD
   113  363 A S  S    S+     0   0  100  252   92  PPYYDY.ASW..LL.GPWGHGINKLGYYY.S.SYYW.ILLLLLGGK.SPGGGDKGGDGYLL.FG..E.WM
   114  364 A G  S    S-     0   0   38  281   56  PPgGQQPgtRPdGNdGDGgSgRnGNGtttnGNGgQNDFgggggggNGtDggGGGggGGggAngGnDGDEG
   115  365 A N  S    S+     0   0   94  255   71  KKnQKKNeeRDn.NdNGEtEkEd.NNgggeN.NnNN.DnnnnnrtQQeGnnV.InnEVegNenNe.N..I
   116  366 A E        +     0   0   54  277   10  EEQEEEEEEEEE.EEEEEEEEEE.EEEEEEEEEEDQEEEEEEEEEEEEEQQEEEEEEEEEEEEEEEEE.E
   117  367 A D        +     0   0   21  280   44  DDDDKNRDDNRHRDRHDDNHNDQ.DHDDDKKQKHDDKDNNNNNNNSDDDHHHDHHHNHHDNNHHKKNKRD
   118  368 A d  E     -FK  81 129D   0  280    1  cccccccccCcccccccccccCcCcccccccccccccCcccccccCCccccccccccccCcccccccccc
   119  369 A A  E     + K   0 128D   0  278   87  nnqansampVkflrktgirslAs.ptnnnnrrriayhAsssssrkTApmnnngnttnnfVtvntnhkhhp
   120  370 A E  E     -FK  77 127D   6  281   79  NNDEDAPKDMTHSNTNGRTTTHAAKNNNNHWQWKNELSRRRPPHHEHDGVVNESNNNNRMNQLNHLNLKT
   121  371 A F  E     +FK  76 126D   1  281   91  FFSAKQKNLMPYFNPVATYSLLDYSYWWWRKSKMSYNMSSSSSPPTFQHFFYAFLLYYRYYDFYRNANTI
   122  372 A S  E >   - K   0 125D  18  281   83  RRGYDDRSKLKRGPKVKDNLQNQFNGNNNDTTTSDRSNGGGGGEEMRNWEEDDDLLHDRHYKAGDSHSTN
   123  373 A G  T 3  S-     0   0   55  281   87  TTGYKKRKTHRREFRPDGSQDEQQPNIIIKGGGSIKGKYYYYYLLEATGTTTTLDDTTLYIWGNKGTGGP
   124  374 A S  T 3  S+     0   0  107  281   89  DDVKWWGAQTWWWKWDLNEWGDWKFNNNNWWWWLLHWGKKKKKIIGNQIKKNPKLLVNSDATRNWWDWWM
   125  375 A G  E <  S- K   0 122D   6  281   65  kkgTAAwTngGGGAGkktkGQgGgmfSSSGGGGqTKGgNNNNNGGPgnmKKkkKkkkkkgkGdfGGkGGq
   126  376 A W  E     -jK 105 121D   0  280    3  wwwWWWwWwwWWWWWwwwwWWwWiwwWWWWWWWwWWWwWWWWWWWWwwwWWwwWwwwwwww.vfWWwWWw
   127  377 A N  E     - K   0 120D  37  281   20  NNNNSNNYNNNNNNNNFNNNYNNYNNFFFNNSNNAGNNNNNNNILNNNFNNNFNNNNNNNNNNNNNNNNN
   128  378 A D  E     + K   0 119D   0  281    6  DDDDDDDDDDDDNDDDDDDNDDDIDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   129  379 A N  E     - K   0 118D  30  281   86  EEDIFFVALAVIIVVHARAIAEVSAHAAAIIIIAYGILEEEEEHVRNVYHHVACRRWVADASNRIIQIIV
   130  380 A R    >   -     0   0  103  281   79  YYAPPPNSPPHSSSHTVSPLPPHRPVFFFPSPSSPQPSNNNNNNTNLSPKKPFSTTPPVHLPVLPPNPPP
   131  381 A d  T 3  S+     0   0   16  281    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   132  382 A D  T 3  S+     0   0   88  281   80  SSTFDNLSNDIHHTIASRSKTQDSNSTTTHSSSDHDSDAAAAADDEVNKSSSSSSSSSSSSNTFHSNSKS
   133  383 A V  S <  S-     0   0   45  281   92  VVARYFGLTsVLTYVTKNNDEMHAYNIIIDLDLNHRGKSPSSSADDMTVLLRNTLLSRTREFKTDGDGDH
   134  384 A D        +     0   0   90  281   80  LLDRKEPQAkHGKHHNPSERERPENRAAARKKKKPQKSRRTTTSASPATNNTPVIISTALLEKQRKRKEP
   135  385 A N  B     -E   37   0C  10  281   91  IIQNTTQKLDQKKLQLHFKQHYEILFFFFHQQQLVNQTRRRRRYHLFLLLLYHLLLFYQYYTLLHQIQHL
   136  386 A Y  E     -g   76   0D  49  281   96  PPTKSRRERGRGRKRPRPFRHRRSKARRRKKNKLVYQYAAAAAQQHHRRAATKPPPATPHAKPAKQPQNK
   137  387 A W  E     -g   77   0D  12  280   41  SSWWWRSWWWSTSWSYSWWSWWSWWSRRRSSSSFGFSWFFFYYWWYWWSSSSSSSSSSFWFSFFSSSSSW
   138  388 A I  E     -C   32   0B   0  280   16  VVVVIVVLIIVVVIVVIVIVVIVIIVIIIVVIVIIIVILLLLLIIIIIIVVVIVVVVVIAVIVVVVVVVI
   139  389 A c  E     -CD  31  53B   0  280    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   140  390 A K  E     +CD  30  52B  28  279   54  AVEEKKEEEEEEEEEAEEEEEEKEEAEEEQQHQKEQQEKKKKKEEKEEEAAAEAAAVAEEQKAAQQAQQE
   141  391 A K  E     -C   29   0B  46  260   65  SSK IIM KKMMMMMTKKKM KMK TTTT MVMRRTMR     KKRT KTTTKTTTKTKRSLRT MSMVK
   142  392 A P  E     -C   28   0B  99  209   74  QR  TH   R MM  RA  M AMM RRRR  KKP VKK     S T  ARRRARRR RNPRPPR KRKK 
   143  393 A A        -     0   0   19  178   78  IK  GG   R EK  IG  K AEA TASS  KK  P C       L  AIIVV II VV TG T  I K 
   144  394 A A  B     -A   17   0A  52  154   75  MI  TT   N II  T   I  IA VSSS  II  G S       S   TTAV TT A  VA G  M I 
   145  395 A a              0   0   87  102   46  CC  A    C YY  C   Y  Y  C     YN    C       C   CCC  CC C     C  C Y 
   146  396 A F              0   0  112   59   19      F      LL      L  L        LL                                   L 
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1  251 A   0   3   0   0  40   0  57   0   0   0   0   0   0   0   0   0   0   0   0   0   119    0    0   0.779     25  0.94
    2  252 A   0   1   0   3   0   0   0   0   1   2   1   6   0   4  12  14  38   6   6   3   218    0    0   2.114     70  0.31
    3  253 A   0   1   1   0   0   0   0   0   5   0   6   2   0   2   5   7   4  47   6  13   240    0    0   1.891     63  0.42
    4  254 A   9  63   5   5   4   0   0   1   0   0   0   1   0   0   1   7   1   2   2   0   257    0    0   1.441     48  0.55
    5  255 A   2   2   1   2   1   0   0   2   5   4  29  21   0   0   1   6   5  11   4   4   257    0    0   2.229     74  0.24
    6  256 A   1  12   2   2   0   2   0   1   8   0   3   2  17   0   3   4  19  10   5  10   258    0    0   2.411     80  0.06
    7  257 A  10  58   4   3   3   0   4   0   1   0   3   4   0   0   1   2   3   2   0   1   267    0    0   1.712     57  0.47
    8  258 A   2   2   0   1   1   0   0   1   2   0   7   3   1   1  15  48   4   3   8   1   267    0    0   1.894     63  0.36
    9  259 A   4   2   1   2   1   1   2  16  17   2  10  11   1   1   3   3   2   8   5   7   267    0    0   2.583     86  0.19
   10  260 A   5   3   1   0   0   0   0  25  22   1   7   2   0   1   1   2   6   8  11   3   268   77   83   2.288     76  0.27
   11  261 A  24  18   6   8  12   0   1   1   0   0  18   5   4   0   1   2   0   0   2   0   191    0    0   2.104     70  0.25
   12  262 A   7   0   2   0   0   0   1   4   4   1   3  10   0   3   0   4   5  30  10  15   220    0    0   2.288     76  0.29
   13  263 A   0   0   0   0   0   9   0   4   1   2  10   2   1   4  31  13   2   8   6   8   234   99   43   2.215     73  0.26
   14  264 A  16  54   2   0   1   0   0   1   3   1  10   4   0   0   1   1   0   0   4   1   136    0    0   1.601     53  0.31
   15  265 A   1   1   0   0   0  17   0   1   1   1   5   0  63   0   0   6   2   2   1   1   167    0    0   1.321     44  0.15
   16  266 A   3   1   0   0   0   1   0   5   3   1  18   4   2   2  29   6   2   4  18   1   227    0    0   2.230     74  0.20
   17  267 A   1   3   0   0   0   0   0   0   2  23   5   6  38   7   5   4   4   0   1   0   235    0    0   1.915     63  0.21
   18  268 A   0   0   0   0   0   0   1   0   0   0   0   0  98   0   0   0   0   0   0   0   273    0    0   0.140      4  0.96
   19  269 A   0   3   0   0   0   0   0   0   1  82   2   0   1   0   3   1   1   3   1   1   276    0    0   0.912     30  0.68
   20  270 A   5   9   5   8   2  18   0   0   3   8   5   5   1   0   1  17   3   6   1   3   276    0   14   2.545     84  0.05
   21  271 A   0   0   0   0  10   0   0  27   0   1   6   1   0   0   1   2   1   9  16  26   278    0    0   1.895     63  0.30
   22  272 A   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   1   0   0   0   280    1    0   0.146      4  0.95
   23  273 A   7   8   2   1   4   3   4   1   1   0   5  28   0   0  11  15   3   7   1   0   279    0    0   2.316     77  0.12
   24  274 A   1   8   1   3  23   1   8   0   8  10  17   2   0   8   1   4   2   3   1   0   280    0    0   2.395     79  0.08
   25  275 A   0   1   1   2  85   0   5   0   0   0   0   0   0   4   1   0   0   0   0   0   280    0    0   0.722     24  0.81
   26  276 A   0   0   0   0   0   0   0  11   1   0   8   0   0   1   2   1  44   8  20   3   280    0    0   1.716     57  0.40
   27  277 A   0   1   0   0   1   0   0  46   0   0  34   1   4   1   4   0   0   2   5   1   280    0    0   1.497     49  0.46
   28  278 A   0   1   0   1   4   0   1   1   0   0  37   1   1   7  11   5   0   0  29   0   280    0    1   1.754     58  0.28
   29  279 A   0   0   0   0   3   0   0   0   0   0   0   0  96   0   0   0   0   0   0   0   280    0    0   0.200      6  0.92
   30  280 A   0   0   0   0   1   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   280    0    0   0.099      3  1.00
   31  281 A   0  10   1   0  57   3  14   0   0   0   0   0   0   1   0  13   0   0   0   0   280    0    0   1.338     44  0.54
   32  282 A   7   5  12  10  44   0  11   0   1   7   0   1   0   0   0   0   0   0   0   0   281    0    0   1.762     58  0.44
   33  283 A  10   5   0   0   5   0   0   0   1   3  72   1   0   0   0   0   0   0   1   0   281    1   28   1.079     36  0.49
   34  284 A   3   1   3   0   1   0   1   1  11   2   6  23   1   1   3   9   1   5  25   3   280    0    0   2.321     77  0.22
   35  285 A   2   1   0   0   1   0   1   2   2   2  32  16   0   1   3   1   1   9   8  16   281    0    0   2.127     70  0.26
   36  286 A   1   6   0   1   1   0   0   2   1   2   9  16   0   5   5  14  27   2   8   0   281    0    0   2.264     75  0.19
   37  287 A   1   5   2  14   0   0   0   4   8   0   4   3   0   0  23  28   2   1   1   1   281    0    0   2.108     70  0.24
   38  288 A   1   0   0   0   1   0   0   0   2   2  35  23   0   1   1   1   0   0  27   5   281    0    0   1.671     55  0.35
   39  289 A   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   281    0    0   0.047      1  0.99
   40  290 A   1   1   0   3   1   0   1   2  20   3   6   9   0  20   1   3   4   4  12   8   281    0    0   2.380     79  0.20
   41  291 A   0   2   0   0   0   0   0   0   6   0   8   1   0   0   1   8   5  25   6  36   281    0    0   1.852     61  0.44
   42  292 A   0   0   0   0   0   0   0   2  30   0  68   0   0   0   0   0   0   0   0   0   281    0    0   0.715     23  0.65
   43  293 A  14   8   8   1   0   0   0   1   2   0   1   1   0   0  21   2   7  29   1   2   281    0    1   2.087     69  0.17
   44  294 A   0   9   1   1   1   0   1   1   2   0   4  23   0   0  10  24   9   7   2   4   281    0    0   2.215     73  0.19
   45  295 A   0   1   0   0   8   0  10   0  25   0   3   1   0   7   1   4   1   3  28   8   281    0    0   2.073     69  0.17
   46  296 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   281    0    0   0.000      0  1.00
   47  297 A  11   5   4   1   1   0   0   1   6   0  21   5   0   1  13   8  20   2   0   0   281    0    6   2.276     75  0.13
   48  298 A   1   3   0   0   0   0   2  10   6   0  17   2   0   1   8   5   4  25   6  11   281    0    0   2.295     76  0.24
   49  299 A  19   5   2  32   0   0   1   0   2   2   0   0   0   0   6   7  13   7   2   2   281    0    0   2.104     70  0.24
   50  300 A   0   0   0   0   0   0   2  71   0   0   2   0   0   0   9   2   1   5   3   4   281    0    0   1.167     38  0.56
   51  301 A   0   0   0   0   0   0   0   8  82   0   7   1   2   0   0   0   0   0   0   0   281    0    0   0.670     22  0.78
   52  302 A   0   0   0   1   0   0   0   0   0   0   0   1   0  41   0   0  26   0  11  19   281    1    0   1.430     47  0.51
   53  303 A   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   280    0    0   0.000      0  1.00
   54  304 A  74  10   1   3   0   0   0   0  11   0   0   1   0   0   0   0   0   0   0   0   281    0    0   0.886     29  0.69
   55  305 A  50   0  24   0   0   0   0   0   0   0  13   9   0   0   0   3   1   0   0   0   281    0    0   1.344     44  0.48
   56  306 A  12   2  85   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   281    1    0   0.532     17  0.91
   57  307 A   0   0   0   0   0   0   2   3   0   0   9   3   0  11   2  20   3   4  30  13   280    0    0   2.033     67  0.32
   58  308 A   0   0   0   0   0   0   0   2   0   0  56  28   0   0   0   1   0   0   9   4   281    0    0   1.180     39  0.50
   59  309 A   0  10   1   1   1   2   0   2  16   4   6   1   0   1  11   8  13  14   3   5   281    0    0   2.477     82  0.15
   60  310 A   0   0   0   0   0   0   0   0  13   0   0   1   0   0   0   2   2  69   2   9   281    0    0   1.127     37  0.65
   61  311 A   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   2   0  95   0   1   281    2   20   0.256      8  0.93
   62  312 A   0   1   0   1   0   0   1   0   2   0   1   1   0   2   0   1  78   8   1   1   279    1    0   0.983     32  0.69
   63  313 A   1   1   1   1   0   0   0   3   3   0   8   4   0   0   1   6   3  20  36  13   278    0    0   2.003     66  0.38
   64  314 A   0   2   0   0  91   0   5   0   0   0   1   0   0   0   0   0   0   0   0   0   279    0    0   0.447     14  0.93
   65  315 A  18  52  26   1   2   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   279    0    0   1.161     38  0.70
   66  316 A   4   2   6   2   8   0   2   1   4   1  10  14   0   0   3   9  25   2   7   0   281    0    0   2.404     80  0.10
   67  317 A   1  15   1   1   2   0   4   5   1   0  13   3   0   4   8   7  23   1   4   4   281    0    0   2.423     80  0.11
   68  318 A   0  14   8   1  10   1   3   0   5   0   1  10   0   4   3   7  19   0  11   0   281  118    7   2.435     81  0.09
   69  319 A   4  13  21   1   2   0   1   0   3   0  26  21   1   1   2   2   1   0   1   1   163    0    0   2.015     67  0.19
   70  320 A   1   3   1   1   0   0   1   2   1   3  26   3   0   1   7  38   5   2   3   4   188    0    0   1.977     65  0.29
   71  321 A   0   1   2   0   0   0   1   2   2   8   9   7   0   0  21  26   1   3  12   3   208    0    0   2.186     72  0.24
   72  322 A   2  16   2   2  10   0   2   4   1   6  22   2   0   1  10   9   1   4   4   2   249    0    0   2.466     82  0.07
   73  323 A   0   1   1   4   2   1   1  13   1   2   5   7   0   0   4  10   3   1  22  23   257    1    1   2.301     76  0.25
   74  324 A   1   1   2   1   2   7   3   3   2   5   4   4   0   9  37   6   2   4   5   2   259   53  128   2.365     78  0.23
   75  325 A   4   8   3   0  36   4  21   1   2   2   3   3   0   2   5   1   1   2   1   1   227    0    0   2.166     72  0.32
   76  326 A   2   1   1   0  18   3  11  11  10   1  15  22   0   2   1   0   0   0   3   0   262   77   55   2.164     72  0.13
   77  327 A   0   1   0   0  10  88   1   0   0   0   0   0   0   0   0   0   0   0   0   0   196    0    0   0.417     13  0.96
   78  328 A   4  16  52  26   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   271    0    0   1.205     40  0.67
   79  329 A   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   274    0    0   0.096      3  0.98
   80  330 A   0  96   1   0   1   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   280    0    0   0.238      7  0.94
   81  331 A   0   1   3   0   1   2   0   0   0   0  48  23   0   2  10   1   0   0   8   0   281    0    0   1.551     51  0.35
   82  332 A   0   0   0   0   0   0   2   1   4   0   1   0   0   1   1   0   0   0   2  87   281    1    0   0.679     22  0.77
   83  333 A   8  24   8   3   0   0   0   1   3   9   5   4   0   1   4   5  13   8   1   1   280    0    0   2.431     81  0.13
   84  334 A  11   1   1   0   0   0   1   5   4   0   4   3   0  12   6   7   4  14  25   4   280    0    0   2.336     77  0.22
   85  335 A  10   2   2   1   0   0   0   9   3   1   2  11   0  10   3  19  16   6   3   1   280    0    0   2.405     80  0.18
   86  336 A   0   2   0   0   0   1   0   1   2   2   0   1   0   1   5   5   5  69   2   3   281   21   17   1.334     44  0.57
   87  337 A   0   0   0   0   0   0   0  74   2   0   4   0   0   0   8   1   3   0   3   3   260    0    0   1.096     36  0.60
   88  338 A   3   1   2   1   0   0   0   5   2   0   7  29   2   4   8   3  26   3   3   3   274    0    0   2.205     73  0.20
   89  339 A   0   0   0   0   0  93   5   0   0   0   0   0   0   1   0   0   0   0   0   0   280    0    0   0.311     10  0.95
   90  340 A   1   4   3   9   1   0   3   0   0   0   3   3   0   8   8  17  40   0   0   0   280    0    0   1.936     64  0.27
   91  341 A   0   1   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   280    0    0   0.066      2  0.98
   92  342 A  71   6   5   1   0   0   0   0   1   0  11   4   0   0   0   0   0   1   0   0   281    0    0   1.093     36  0.60
   93  343 A   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   2  96   281    0    0   0.233      7  0.94
   94  344 A   0   0   0   0   0   0   0  68   0   0   1   0   0   0   5   4  12   1   3   5   281    0    1   1.182     39  0.54
   95  345 A   4   0   1   1   0   0   0   0   1   0  43  41   5   0   1   1   0   0   2   0   281    0    0   1.345     44  0.44
   96  346 A   2   1   1   0   0   0   0   0   8  66   4   2   0   1   6   5   1   0   0   2   281  198    7   1.391     46  0.51
   97  347 A   1  87   1   1   0   0   0   0   1   0   0   1   0   1   2   0   1   1   0   1    83    1    0   0.692     23  0.68
   98  348 A   2  19   0   0  21   0  22   0   1   2  23   6   0   1   1   1   3   0   0   0   188    0    0   1.844     61  0.21
   99  349 A   1   8   2   1   5   0   1   2   1  15  10  15   0   0   1   3   1   6  26   5   194    0    0   2.250     75  0.15
  100  350 A  10  16   0   2   3   0   1   1   2   7  21   5   0   0   1   9   2  14   4   0   280    0    0   2.351     78  0.11
  101  351 A   0   5   0   0  22   0   1   4   1   1  29  16   0   3   5   0   2   1   7   3   281    0    0   2.112     70  0.12
  102  352 A   5  17   5   6  17   1   5   0   7   1   4   8   1   0   5   6   6   5   1   0   281    0    0   2.573     85  0.13
  103  353 A  11   5   1   1   0   0   0   5   3   0  21  15   0   0  16  10   7   2   3   0   281    0    0   2.309     77  0.15
  104  354 A   0   4   0   0  40   0  43   0   0   0   1   2   0   4   0   0   1   0   6   0   281    0    0   1.323     44  0.64
  105  355 A   0   0   0   0   0  99   0   0   0   0   0   0   0   0   1   0   0   0   0   0   281    0    0   0.066      2  0.99
  106  356 A   0   2   0   2   2   0   2   2   3   0   6   0   0  22   3   4   5   2  30  13   281    0    0   2.189     73  0.27
  107  357 A   7   1   1   0   1   0   0   2   9  16  13   4   0   0   9  14   5   9   2   6   281    0    0   2.456     81  0.19
  108  358 A   0   1   0   0   0   0   0  77   1   0   1   2   0   2   2   1   1   4   6   2   281    0    0   1.048     34  0.65
  109  359 A   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0  18  79   1   0   281    0    0   0.664     22  0.79
  110  360 A   0   0   0   0   0   0   0   0   0  97   1   0   0   0   0   0   0   0   1   0   281    0  100   0.172      5  0.95
  111  361 A   0   0   0   0   0   0   0   3   0   0   4   0   0   4   0   2   1   2  67  16   281   41   27   1.155     38  0.65
  112  362 A   1   0   0   2   1   0   2   5   4   1   9   0   0   3   0   4   2   2  58   6   240    0    0   1.707     56  0.44
  113  363 A   5  14  16   0   2   6   5   7   4   4  12   0   0   4   9   2   4   2   2   2   252    0    0   2.621     87  0.08
  114  364 A   5   1   0   0   1   1   0  57   5   2   4   2   0   1   4   1   4   1   7   3   281   26   88   1.768     59  0.43
  115  365 A   7   4   1   0   0   0   0   8   2   0   1   2   0   0   4   7   4  24  28   8   255    0    0   2.140     71  0.29
  116  366 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2   7  90   0   1   277    0    0   0.405     13  0.89
  117  367 A   0   0   0   0   0   0   0   0   0   0   0   0   0  10   4   5   2   1  15  61   280    1    0   1.336     44  0.55
  118  368 A   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   280    3  180   0.047      1  0.99
  119  369 A  15   1   5   1   2   2   4   2  24   3   4   5   0   3   5   2   1   0  10   9   278    0    0   2.471     82  0.13
  120  370 A   2   1   1   6   0   1   0   1   3   2  13   4   0   6   6   2   1  27  16   6   281    0    0   2.361     78  0.21
  121  371 A   3   6   1   6  27   2   7   2   2   3  15   5   0   0   2   5   5   0   6   2   281    0    0   2.473     82  0.09
  122  372 A   0   7   0   1   1   1   2   6   1   4  15  10   0   1  11   3   1   2  20  13   281    0    0   2.412     80  0.17
  123  373 A   0   3   2   1   3   2   4  28   1  11   6   6   0   3   3  11   1   4   2   9   281    0    0   2.479     82  0.13
  124  374 A   1   4   1   1   1  19   2   4   2   1   9   5   0   1  10   8   2   5  16  10   281    0    0   2.537     84  0.10
  125  375 A   1   0   0   1   1   1   0  49   9   0   5   2   0   0   2  16   6   0   5   0   281    1  121   1.764     58  0.34
  126  376 A   0   1   0   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   280    0    0   0.137      4  0.97
  127  377 A   0   0   0   0   2   0   1   0   1   0   3   0   0   0   0   1   0   0  89   0   281    0    0   0.540     18  0.79
  128  378 A   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   2  95   281    0    0   0.248      8  0.93
  129  379 A  19   6  10   1   4   0   2   1  17   0   4   1   1   3   5   1   1   5   8  10   281    0    0   2.488     83  0.13
  130  380 A   4   1   0   0   3   0   2   1   2  31  15   6   0   3  10  14   2   1   4   1   281    0    0   2.224     74  0.20
  131  381 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   281    0    0   0.024      0  1.00
  132  382 A   0   1   1   0  10   0   0   2   3   1  26   8   0   4   1   2   2   4  17  18   281    0    0   2.196     73  0.20
  133  383 A  13  10   4   1  11   1   6   2   7   0   9   5   0   4   5   5   1   2   8   5   281    0   15   2.702     90  0.08
  134  384 A   0   4   1   0   1   0   0   1  11   7  12   5   0   2   7  13   2  12  10   8   281    0    0   2.498     83  0.20
  135  385 A   1  14   3   5   5   0   9   0   4   0   1   5   1   5   5  16  10   1   9   5   281    0    0   2.591     86  0.08
  136  386 A   0   3   0   0  24   0  11   4   5   7   7   3   0   2  11  12   5   0   5   0   281    0    0   2.367     79  0.03
  137  387 A   0   1   0   0   8  53   2   1   0   0  20   0   0   0  15   0   0   0   0   0   280    0    0   1.355     45  0.58
  138  388 A  30   2  65   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   280    0    0   0.831     27  0.83
  139  389 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   280    0    0   0.000      0  1.00
  140  390 A   2   0   0   1   0   0   0   0   7   0   0   0   0   0   0  36   6  47   0   0   279    0    0   1.265     42  0.45
  141  391 A   2   2   5  22   0   0   0   0   1   0   2  11   0   0   7  47   0   0   1   0   260    0    0   1.610     53  0.35
  142  392 A   2   0   1   4   1   0   0   0   3  32  16   5   0   1  19  11   1   0   2   0   209    0    0   2.019     67  0.26
  143  393 A   4   1   6   1   0   0   0  13  33   4   6   6   3   1   2  11   2   5   1   1   178    0    0   2.262     75  0.22
  144  394 A   6   0  16   1   0   0   1   3  29   0  10  22   0   0   1   2   2   1   5   0   154    0    0   1.984     66  0.25
  145  395 A   1   0   3   0   1   0  20   0   7   1   1   8  58   0   0   0   0   0   1   0   102    0    0   1.350     45  0.54
  146  396 A   0  46   7   0  44   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0    59    0    0   1.016     33  0.80
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
    36   111   202     1 nDa
    36   125   217     1 gLw
    36   133   226     1 sEk
    42    14   101     1 dGl
    43    14   101     1 dGl
    44    14   101     1 dGl
    65    20    77     5 wLLFQGd
    65    74   136     1 nFw
    66    10    57     2 gLKt
    66    20    69     5 wLLFQGd
    66    95   149     3 pLQGr
    67    20    77     5 wLLFQGd
    67    74   136     1 nFw
    67    94   157     3 pLQGr
    68    89   105     1 dNh
    68    96   113     2 cVHi
    69    12    61     1 rSi
    69    72   122     1 kEf
    69   106   157     1 pNn
    69   114   166     4 cVTIRd
    69   121   177     1 rNw
    70    10    50     2 lLDc
    70   119   161     1 gTw
    71    96   110     1 vLv
    71   100   115     5 cATIRDs
    72   102   111     1 nNd
    72   116   126     1 gEw
    73    85   104     1 nDa
    73    92   112     7 cAMLDYQKa
    73    99   126     1 aTw
    74    77    77     3 pYNLl
    74    92    95     1 nDa
    74    99   103     7 cAMLDYQKa
    74   106   117     1 aTw
    75   107   126     1 dNa
    75   114   134     2 cAHi
    75   121   143     1 tSw
    76    10   177     2 lLDc
    76    93   262     2 pVTl
    76   107   278     8 cSFWDPQEPn
    76   111   290     1 yNn
    76   122   302     1 gTw
    77    73   327     1 gYw
    77    83   338     3 lGKIq
    77   104   362     1 pNd
    77   119   378     1 gLw
    77   127   387     1 nEr
    78    65   127     4 sLDTQf
    78    67   133     1 sYf
    78   108   175     4 cVVIVq
    79     8    22     2 eLIl
    79    11    27     1 rQr
    79   104   121     5 pDNGGGd
    79   105   127     1 dPk
    79   112   135     4 cAHIRt
    79   119   146     1 eNw
    80    11    70     2 yKDv
    80    14    75     1 gSv
    80    73   135     2 rREf
    80   111   175     1 vTv
    80   115   180     4 cATIRd
    80   122   191     1 kNw
    81    13    57     4 kFAQAq
    81    96   144     1 pNh
    81   100   149     1 gRn
    81   104   154     3 cVEIq
    81   111   164     1 rNw
    82    11    73     2 gSGs
    82    72   136     1 rEf
    82   110   175     1 aTl
    82   114   180     4 cATMRd
    82   121   191     1 qNw
    83    10    73     2 aSGs
    83    70   135     2 rKEf
    83   108   175     1 vLv
    83   112   180     4 cATIRd
    83   119   191     1 kNw
    84    11   134     1 gHt
    84    68   192     3 nTNNf
    84    70   197     1 gYw
    84   104   232     1 pNd
    84   119   248     1 gHw
    84   127   257     1 sEl
    85    11    73     2 gSGs
    85    72   136     1 rEf
    85   110   175     1 aTl
    85   114   180     4 cVTIRd
    85   121   191     1 qNw
    86    10    99     2 lLDc
    86    67   158     4 hGSPRv
    86   115   210     1 gTw
    87    72   136     1 kEf
    87   110   175     1 vTl
    87   114   180     4 cATIRd
    87   121   191     1 kNw
    88    11    73     2 gSGs
    88    72   136     1 rEf
    88   110   175     1 aTl
    88   114   180     4 cATMRd
    88   121   191     1 qNw
    89    69   139     2 rREf
    89   107   179     1 aTv
    89   111   184     4 cATIRd
    89   118   195     1 kNw
    90    11    75     2 gKDm
    90    73   139     1 sAy
    90   109   176     1 sPd
    90   113   181     4 cAIINf
    91    11    75     2 gKDm
    91    73   139     1 sAy
    91   109   176     1 sPd
    91   113   181     4 cAIINf
    92    11    73     2 gSGl
    92    71   135     2 kQEy
    92   109   175     1 vTv
    92   113   180     4 cATMRd
    92   120   191     1 kNw
    93    11    73     2 gSGs
    93    72   136     1 rEf
    93   110   175     1 aTl
    93   114   180     4 cATMRd
    93   121   191     1 qNw
    94     8     8     1 pPa
    94   102   103     1 nSy
    94   105   107     1 gRn
    94   109   112     5 cVEFWHl
    95    24    33     5 sSQNKSd
    95    67    81     1 gFw
    95   106   121     5 cAAVYPr
    96   107   114     1 dNk
    96   114   122     2 cVMi
    97   104   120     1 dNk
    97   111   128     2 cAMi
    98    66   141     1 lYq
    98   103   179     1 pNg
    98   107   184     1 gTd
    98   111   189     4 cGEFVy
    98   118   200     1 gWw
    99     8     8     2 sSSk
    99    11    13     1 tGl
    99    18    21     1 pLn
    99   110   114     1 vTv
    99   114   119     4 cVSIRd
    99   121   130     1 qNw
   100    73   135     2 rREf
   100   111   175     1 vTv
   100   115   180     4 cATIRd
   100   122   191     1 kNw
   101    10    73     2 aSGs
   101    70   135     2 rKEf
   101   108   175     1 vLv
   101   112   180     4 cATIRd
   101   119   191     1 kNw
   102    10   125     2 lVDc
   102    67   184     4 hGSPRv
   102   115   236     1 gTw
   103   113   139     1 vTv
   103   117   144     4 cATIRd
   103   124   155     1 kNw
   104    11    62     2 gSGs
   104    71   124     2 rREf
   104   109   164     1 vTv
   104   113   169     4 cATIRd
   104   120   180     1 kNw
   105    73   135     2 rKEf
   105   111   175     1 vTv
   105   115   180     4 cATIRd
   105   122   191     1 kNw
   106    11    73     2 gSGs
   106    72   136     1 kEf
   106   110   175     1 aTv
   106   114   180     4 cVTIRd
   106   121   191     1 qNw
   107    10    77     2 aEGs
   107    69   138     1 rRf
   107    71   141     1 sYf
   107   104   175     1 pNn
   107   111   183     4 cVVLVy
   108    11    73     2 gSGs
   108    71   135     2 rREf
   108   109   175     1 vTv
   108   113   180     4 cATIRd
   108   120   191     1 kNw
   109    69   135     1 rRf
   109    71   138     1 sYf
   109   112   180     4 cVVLVn
   110    11    73     2 gSGs
   110    72   136     1 rEf
   110   110   175     1 aTl
   110   114   180     4 cATMRd
   110   121   191     1 qNw
   111    20    25     4 pFSDAi
   111    48    57     4 kLMAIh
   111    61    74     3 dVSMt
   111    63    79     1 gFw
   111   102   119     5 cAATYPr
   112    10    69     2 dNDg
   112    13    74     1 gSv
   112    73   135     1 rEf
   112   111   174     1 aTv
   112   115   179     4 cATIRd
   112   122   190     1 kNw
   113    16    63     1 kQs
   113    67   115     1 kLw
   113    98   147     1 pNn
   113   102   152     1 gTe
   113   106   157     3 cAETk
   113   113   167     1 nSw
   114    11    73     2 gSGs
   114    72   136     1 rEf
   114   110   175     1 aTl
   114   114   180     4 cATMRd
   114   121   191     1 qNw
   115    88    99     5 pDNGNNn
   115    89   105     1 nPa
   115    96   113     5 cAQLYIa
   115   103   125     1 aNw
   116    91   156     2 vVTt
   116   105   172     3 pNSYg
   116   111   181     4 cGEILq
   116   118   192     1 gQw
   117     8    21     2 vASs
   117    71    86     4 tDHEDk
   117   114   133     6 cVMMGDKs
   118    58    58     4 nSYDDi
   118    93    97     5 pDDWTGe
   118   107   116     1 vYw
   119    12    71     1 rGt
   119    70   130     1 rRf
   119    72   133     1 sYf
   119   113   175     4 cVVLVn
   120    72   102     3 eSLSy
   120   113   146     5 cASIVFw
   121    10    78     1 sSr
   121    71   140     1 rRf
   121    73   143     1 sYf
   121   110   181     1 kQn
   121   114   186     3 cVILv
   121   121   196     1 wAw
   122    20    64     3 iLNRg
   122    74   121     1 nKw
   122   105   153     1 pNn
   122   113   162     4 cVVADp
   122   120   173     1 qNw
   124    66   175     3 hMGPl
   124    68   180     1 nTw
   124    99   212     5 pDNWYGh
   124   103   221     1 gGg
   124   114   233     1 gRw
   125    65   141     1 fNy
   125    67   144     1 rAw
   125   102   180     1 gGe
   125   106   185     5 sVLVRRi
   126    73   221     1 gYw
   126    83   232     3 lNKIq
   126   104   256     1 pNd
   126   119   272     1 gLw
   126   127   281     1 nEr
   127     9    72     2 gSGs
   127    70   135     1 kEf
   127   108   174     1 vIv
   127   112   179     4 cATIRd
   127   119   190     1 qNw
   128    68   136     1 rRf
   128    70   139     1 sYf
   128   111   181     4 cVVLVn
   129    11    97     2 nLKm
   129    14   102     1 eTv
   129   116   205     4 cVILNy
   130    71   136     1 kEf
   130   109   175     1 fTv
   130   113   180     4 cVTIRd
   130   120   191     1 qNw
   131    11    73     2 gSGs
   131    71   135     2 mKEf
   131   109   175     1 aTl
   131   113   180     4 cATMRd
   131   120   191     1 qNw
   132    11    73     2 gSGs
   132    71   135     2 mKEf
   132   109   175     1 aTl
   132   113   180     4 cATMRd
   132   120   191     1 qNw
   133     5    14     2 gFVl
   133    99   110     5 pDNGNNd
   133   100   116     1 dPt
   133   107   124     5 cAHLYIa
   133   114   136     1 aNw
   134     5    14     2 gFVi
   134    99   110     5 pDNGNNd
   134   100   116     1 dPk
   134   107   124     5 cAHLYIa
   134   114   136     1 aNw
   135   108   114     3 pNSYg
   135   114   123     4 cGELLh
   135   121   134     1 gQw
   136    20    24     1 fEg
   136   107   112     1 nGk
   136   113   119     4 cADIKn
   137     5     9     1 sLl
   137    99   104     3 pNSYd
   137   101   109     1 gRn
   137   105   114     4 cVEFWh
   137   112   125     1 gDw
   138    46    46     3 dQIFt
   138    59    62     3 iATTe
   138    92    98     6 pDNGGGSs
   138   100   112     2 cVHv
   138   107   121     1 kSw
   139    55    73     4 kQVVKq
   139   106   128     2 cVYv
   139   113   137     1 rFw
   140    11    19     1 vKl
   140    73    82     3 hEQRp
   140   106   118     1 pNn
   140   114   127     2 cVVn
   140   121   136     1 kKw
   141    70   218     1 rGl
   141    72   221     1 gYw
   141    82   232     3 sGEVq
   141   103   256     1 pNd
   141   118   272     1 gLw
   141   126   281     1 sKm
   142    12   124     1 nTs
   142    72   185     1 tYw
   142    82   196     4 gSGKVk
   142   107   225     1 gDq
   142   118   237     1 gRw
   142   126   246     1 tDl
   143    10    96     2 nLTm
   143    13   101     1 dKd
   143    71   160     3 eNNAy
   143   112   204     6 cVILHFRa
   144    73   165     1 gYw
   144    83   176     3 aRKIq
   144   104   200     1 pNd
   144   119   216     1 gLw
   144   127   225     1 nEr
   145    67    87     3 hAEGt
   145   104   127     1 gGs
   145   108   132     2 cVHt
   145   115   141     1 kGw
   146    68   124     1 rRf
   146    70   127     1 sYf
   146   111   169     4 cVVLVn
   147    68   138     3 hTQGc
   147    70   143     1 eYw
   147   101   175     3 pYSCe
   147   106   183     5 cLATTLg
   148    10    77     2 aEGs
   148    69   138     3 rRLSy
   148   103   175     1 pDn
   148   110   183     4 cVVLVy
   149    70   161     1 sAy
   149    81   173     3 tTGKr
   149   106   201     1 nPk
   149   110   206     4 cVMLNa
   150    11    97     2 dSLs
   150    14   102     1 dKv
   150    34   123     1 sTd
   150    72   162     3 tHAAy
   150   105   198     2 pSSd
   150   110   205     5 cVIINHh
   151     9    78     2 hIPm
   151    12    83     1 kEg
   151    32   104     4 aFLDNm
   151    60   136     4 tHLAIs
   151    72   152     4 rEISIs
   151    74   158     1 gFw
   151   113   198     5 cAAAYPr
   152    15    62     4 lSKMDg
   152    63   114     4 yFAVTd
   152    99   154     1 nSn
   153    11    69     2 gTRv
   153    14    74     1 eKv
   153    69   130     4 qLNESl
   153    71   136     1 sYf
   153   111   177     5 cASIVFw
   154    66   133     4 qLNESf
   154    68   139     1 sYf
   154   108   180     5 cASIVFw
   155    10    77     2 aEGs
   155    69   138     3 rRLSy
   155   103   175     1 pDn
   155   110   183     4 cVVLVy
   156    68   216     4 nLQYKy
   156    70   222     1 gYw
   156    80   233     3 rGRIe
   156   101   257     1 pNd
   156   116   273     1 gLw
   156   124   282     1 nTr
   157    10    77     2 aEGs
   157    59   128     1 eQq
   157    69   139     3 rRLSy
   157   103   176     1 pDn
   157   110   184     4 cVVLVy
   158    64   134     4 kLDGNf
   158    66   140     1 aYy
   158   101   176     1 tHd
   158   105   181     4 cVIINf
   159    11    73     2 gSGs
   159    72   136     1 kEy
   159   108   173     1 aTl
   159   112   178     4 cTTIRd
   159   119   189     1 rNw
   160    10    77     2 aEGs
   160    69   138     1 rCf
   160    71   141     1 sYf
   160   104   175     1 pNn
   160   111   183     4 cVVLVy
   161    70   159     1 gYw
   161    80   170     3 lGKVq
   161   101   194     1 pNd
   161   116   210     1 gLw
   161   124   219     1 sEk
   162    68   142     1 rRf
   162    70   145     1 sYf
   162   111   187     4 cAVLVy
   163    11    70     2 gTKv
   163    68   129     4 qLNESf
   163    70   135     1 sYf
   163   110   176     5 cASIVFw
   164    10    77     2 aEGs
   164    69   138     3 rRLSy
   164   103   175     1 pDn
   164   110   183     4 cVVLVy
   165   108   111     5 pDNGNNn
   165   109   117     1 nPa
   165   116   125     5 cAQLYIa
   165   123   137     1 aNw
   166     9    16     2 hVPm
   166    12    21     1 eEg
   166    32    42     4 pFSEVi
   166    60    74     4 kHMAIt
   166    72    90     4 rKIADs
   166    74    96     1 gFw
   166   116   139     5 cAAVYPr
   167    65   118     3 iLEPy
   167    67   123     1 hYw
   167   100   157     5 pDNWNWg
   167   101   163     1 gAd
   167   107   170     3 cGSFh
   168     8    30     1 nGs
   168    67    90     1 pVn
   168   100   124     5 pDDWYGh
   168   104   133     1 gGg
   168   115   145     1 gRw
   169    67    91     3 hAEGy
   169   100   127     1 pNn
   169   108   136     2 cGHn
   169   115   145     1 kKw
   170    58   125     4 eQNFTt
   170    67   138     1 sYf
   170   100   172     2 pNTh
   170   106   180     4 cVVLVn
   171    82   173     3 tTGKr
   171   107   201     1 nPk
   171   111   206     4 cVMLNa
   172    11    97     2 dSLl
   172    14   102     1 dKv
   172    34   123     1 sTd
   172    72   162     3 tHAAy
   172   105   198     2 pSSd
   172   110   205     5 cVIINHh
   173     8   104     2 hSSv
   173    11   109     1 dKv
   173    70   169     2 rAAy
   173   106   207     1 gNt
   173   110   212     6 cVVLSYHp
   174    18    30     1 pEg
   174    72    85     3 rRDDy
   174   108   124     1 gLd
   174   112   129     5 cTVILKs
   175    13    13     1 aQl
   175    33    34     2 sTAe
   175   105   108     5 pDDWKVq
   175   113   121     4 cAHLKp
   175   120   132     1 nNw
   176    31    83     2 pTVs
   176    69   123     3 tHAAy
   176   109   166     5 cATIIYr
   177    10    97     2 vSPm
   177    13   102     1 dKv
   177    33   123     2 pTVs
   177    71   163     3 tHAAy
   177   111   206     5 cATIIYr
   178    11    16     1 aIr
   178    14    20     1 sGa
   178    48    55     2 rQQe
   178    75    84     2 fLIh
   178   112   123     1 lWn
   178   116   128     3 cVELw
   178   123   138     1 lSw
   179    68   136     1 rQf
   179    70   139     1 sYf
   179   105   175     1 nQk
   179   109   180     4 cVVLVn
   180    10    77     2 aEGs
   180    69   138     1 rCf
   180    71   141     1 sYf
   180   104   175     1 pNn
   180   111   183     4 cVVLVy
   181    67   160     3 eESAy
   181   101   197     1 pSd
   181   107   204     6 cVVLNFRk
   182    79    97     1 dIn
   182   102   121     1 pNn
   182   117   137     1 kKw
   183    69   138     1 rRf
   183    71   141     1 sYf
   183   106   177     1 nQe
   183   110   182     3 cVVLv
   183   117   192     1 wAr
   184    72    72     1 gYw
   184    82    83     3 lGKVq
   184   103   107     1 pNd
   184   118   123     1 gLw
   184   126   132     1 sEk
   185    69    90     3 pAYGr
   185   102   126     1 pNn
   185   110   135     2 cVEi
   185   117   144     1 vKw
   186   105   122     1 pSd
   186   111   129     4 cVFINs
   187    70   208     1 rGl
   187    72   211     1 gYw
   187    82   222     3 rGRVn
   187   103   246     1 pNd
   187   118   262     1 gRw
   187   126   271     1 nLn
   188    70   184     1 rGl
   188    72   187     1 gYw
   188    82   198     3 rGRVn
   188   103   222     1 pNd
   188   118   238     1 gRw
   188   126   247     1 nLn
   189    68   217     1 hTr
   189    74   224     2 wLGp
   189    86   238     3 aGRIq
   189   107   262     1 pNd
   189   122   278     1 gLw
   189   130   287     1 sEl
   190    10    77     2 aEGs
   190    69   138     1 rRf
   190    71   141     1 sYf
   190   104   175     1 pNn
   190   111   183     4 cVVLVy
   191   107   110     5 pDNGNNd
   191   108   116     1 dPk
   191   115   124     5 cAHLHIa
   191   122   136     1 aNw
   192    61    61     4 rGNNDl
   192    83    87     1 pLe
   192    97   102     6 pNNWDDEd
   192    98   109     1 dPv
   192   104   116     5 cVRLGDi
   193     8    96     1 nGs
   193    64   153     3 hIGPv
   193    66   158     1 nTw
   193    97   190     5 pDDWYGh
   193   101   199     1 gGg
   193   112   211     1 gRw
   194    67    98     3 pTQAp
   194   104   138     1 eKn
   194   108   143     2 cVLn
   194   115   152     1 kKw
   195    62    93     3 hAERl
   195    99   133     1 gTf
   195   103   138     2 cVHt
   195   110   147     1 kKw
   196    67    98     3 hAERh
   196   104   138     1 gTn
   196   108   143     2 cVHt
   196   115   152     1 kKw
   197    67    90     3 hAERh
   197   104   130     1 gTn
   197   108   135     2 cVHt
   197   115   144     1 kKw
   198    65    89     3 hDEGr
   198   102   129     1 gTn
   198   106   134     2 cVHt
   198   113   143     1 kKw
   199    67   106     3 hESGl
   199   100   142     1 pNn
   199   108   151     2 cLLv
   199   115   160     1 kCw
   200    67    90     3 hAEGy
   200   100   126     1 pNn
   200   108   135     2 cGHn
   200   115   144     1 kKw
   201    10    72     1 mSk
   201    66   129     3 lTQNp
   201   102   168     5 pDNGAGd
   201   103   174     1 dPr
   201   110   182     2 cAHi
   201   117   191     1 nFw
   202    10    66     1 nLl
   202    65   122     3 iATTe
   202    98   158     6 pDNGGGSs
   202   106   172     2 cVHv
   202   113   181     1 kSw
   203    28   141     4 aLSEEl
   203    56   173     4 eHMALa
   203    68   189     4 rSMSQs
   203    70   195     1 gFw
   203   109   235     5 cAAMYPr
   204     8    47     1 nGs
   204    64   104     3 hIGPv
   204    66   109     1 nTw
   204    97   141     5 pDDWYGh
   204   101   150     1 gGg
   204   112   162     1 gRw
   205    68   227     3 nTKGl
   205    70   232     1 gYw
   205    80   243     3 rGRVn
   205   101   267     1 pNd
   205   116   283     1 gRw
   205   124   292     1 nLn
   206    28    72     5 sYTESTt
   206    63   112     2 tINd
   206    69   120     4 rDVWAs
   206    71   126     1 gFw
   206   103   159     7 pNDWNTEYp
   206   104   167     1 pDd
   206   111   175     5 cAAVYPn
   207    10   122     1 iVs
   207    74   187     3 kNNEt
   207   109   225     3 pDALg
   207   111   230     1 gAe
   207   115   235     5 cVWMMKt
   207   122   247     1 vWw
   208    67    88     3 pTQGv
   208   104   128     1 gGs
   208   108   133     2 cVHt
   208   115   142     1 rKw
   209    67    87     3 pTQAf
   209   104   127     1 gGn
   209   108   132     3 cGHTn
   210    66    87     3 qTEGr
   210    99   123     1 pNn
   210   107   132     2 cVHn
   210   114   141     1 kKw
   211    66    87     3 qTEGr
   211    99   123     1 pNn
   211   107   132     2 cVHn
   211   114   141     1 kKw
   212    66    87     3 qTEGr
   212    99   123     1 pNn
   212   107   132     2 cVHn
   212   114   141     1 kKw
   213    14    18     1 kKf
   213    21    26     5 nVLCENn
   213   111   121     1 gGn
   213   115   126     4 cGEILq
   213   122   137     1 gQw
   214    18   167     4 lLKQIe
   214    68   221     3 kQKNd
   214   101   257     1 pNd
   214   109   266     6 cAVFTNTa
   215    68   136     1 rRf
   215    70   139     1 sYf
   215   111   181     4 cVVLVn
   216    12    69     1 eSt
   216    27    85     1 nRc
   216    69   128     1 rRf
   216    71   131     1 pYf
   216   112   173     4 cVVLVs
   217     8    96     2 nMPm
   217    11   101     1 eTv
   217    69   160     3 eESAy
   217   103   197     1 pSd
   217   109   204     7 cVVLNFRKa
   217   116   218     1 wGw
   218     8    10     1 gTv
   218    30    33     2 sGSq
   218    58    63     4 eQLNLy
   218    65    74     2 rDPs
   218    71    82     3 wRHPg
   218    73    87     1 gIw
   218   109   124     1 gTe
   218   113   129     5 cLAIMNm
   219   102   110     7 nVVEPNNGg
   219   103   118     1 gGg
   219   106   122     1 tVe
   219   110   127     4 cAEMNp
   219   117   138     1 nSw
   220    73   165     1 gYw
   220    83   176     3 lGKVq
   220   104   200     1 pNd
   220   119   216     1 gLw
   220   127   225     1 sEk
   221    67   160     3 eESAy
   221   101   197     1 pSd
   221   107   204     6 cVVLNFRk
   222     9    97     2 nSTt
   222    12   102     1 eKv
   222   109   200     1 dEn
   222   113   205     5 cVELRHf
   223    10    99     2 nSTt
   223    13   104     1 gKi
   223   107   199     1 pKn
   223   113   206     4 cVILTl
   224    28   180     4 pFSDSy
   224    56   212     4 kHLAIm
   224    68   228     4 rPIQQs
   224    70   234     1 gFw
   224   109   274     5 cAAVYPr
   225    14    16     1 pKn
   225   104   107     1 dPd
   225   108   112     6 cVVLNFRk
   226    67    89     3 hAEGh
   226   100   125     1 pNn
   226   108   134     2 cVHt
   226   115   143     1 kKw
   227    58    58     4 tEVQDk
   227    93    97     5 pDNWKSe
   227   101   110     6 cVRMGEKg
   227   108   123     1 kCw
   228    10    73     1 lSk
   228    66   130     3 fTQKq
   228   100   167     5 pDNGGEd
   228   101   173     1 dPq
   228   108   181     2 cVHi
   228   115   190     1 tLw
   229    16    63     5 lQDYQQn
   229    57   109     2 eQKk
   229   102   156     1 gRt
   229   106   161     3 cGEIr
   229   113   171     1 kSw
   230     9   100     2 nSTm
   230    12   105     1 gKv
   230    70   164     3 kNAAy
   230   111   208     6 cVIVNHPs
   231    62    76     4 eQAHIv
   231   107   125     1 gSk
   231   111   130     1 cAl
   232    11    55     2 gNGt
   232   102   148     6 pNNMYSFh
   232   116   168     1 gKw
   233    55   167     3 qHSAy
   233    89   204    10 pNNPDERFWHPn
   233    90   215     1 nEp
   233    93   219     1 nPd
   233    97   224     6 cVTVNFRs
   234    31   108     1 aTn
   234    70   148     2 tFSf
   234   104   184     3 aQINg
   234   115   198     1 gNi
   235    30   106     4 pFSDTf
   235    58   138     4 kHLGIt
   235    70   154     4 rQASQs
   235    72   160     1 gFw
   235   111   200     4 cAAVYp
   235   118   211     1 mSw
   236    67    86     3 pTQSw
   236   100   122     1 pDn
   236   108   131     2 cGHt
   236   115   140     1 fYw
   237    33   134     2 sTNt
   237    75   178     1 sFw
   237   108   212     7 pDNWRGYRn
   237   112   223     1 tEg
   237   116   228     5 cARIAQn
   238    33   134     2 sSNt
   238    75   178     1 sFw
   238   108   212     7 pDNWKGYRn
   238   112   223     1 tEg
   238   116   228     5 cARIEQn
   239    33   134     2 sSNt
   239    75   178     1 sFw
   239   108   212     7 pDNWKGYRn
   239   112   223     1 tEg
   239   116   228     5 cARIEQn
   240    11    97     2 vSLt
   240    14   102     1 dKa
   240    34   123     1 sTd
   240    72   162     3 iGTDy
   240   107   200     1 nKe
   240   111   205     3 cVVIn
   241    31    37     2 pTVs
   241    81    89     1 gHr
   241   111   120     5 cATIIYr
   242    11    97     2 aSLl
   242    14   102     1 dKv
   242    34   123     1 sTd
   242    72   162     3 tGTAy
   242   105   198     2 pSSd
   242   110   205     5 cVIINHr
   243    31   147     2 pTVs
   243    69   187     3 tHAAy
   243   109   230     5 cATIIYr
   244    84    90     1 pFd
   244   102   109     1 gNn
   244   106   114     2 cANi
   244   113   123     1 qSw
   245    14    43     1 qTr
   245    70   100     3 fGSTe
   245   111   144     7 cAIISYQKa
   246     8     8     1 sFf
   246    69    70     1 dRn
   246   111   113     5 cVAYYPy
   247    10    97     2 vLLm
   247    13   102     1 eKs
   247    33   123     5 tKHTSTy
   247    71   166     3 rDAAy
   247   104   202     2 pSSd
   247   109   209     4 cVIINh
   248    10   162     2 lLDc
   248    59   213     3 eQVIg
   248    69   226     4 wDSQIf
   248   113   274     1 gTw
   249     8    16     2 aFSl
   249    11    21     1 eAn
   249    45    56     2 rKHk
   249    59    72     4 eSTDLa
   249   108   125     1 gNn
   249   112   130     4 cVELWs
   250     8    16     2 aFSl
   250    11    21     1 eAn
   250    45    56     2 rKHk
   250    59    72     4 eSTDLa
   250   108   125     1 gNn
   250   112   130     4 cVELWs
   251     8    16     2 aFSl
   251    11    21     1 eAn
   251    45    56     2 rKHk
   251    59    72     4 eSTDLa
   251   108   125     1 gNn
   251   112   130     4 cVELWs
   252     8    16     2 aFSl
   252    11    21     1 eAn
   252    45    56     2 rKYk
   252    59    72     4 eSTDLa
   252   108   125     1 gNn
   252   112   130     4 cVELWs
   253     8    16     2 aFSl
   253    11    21     1 eAn
   253    45    56     2 rKYk
   253    59    72     4 eSTDLa
   253   108   125     1 gNn
   253   112   130     4 cVELWs
   254    13    52     3 qNTAg
   254    63   105     2 rNKe
   254    96   140     2 sITe
   254    97   143     1 ePn
   254   100   147     1 gTr
   254   104   152     6 cVLTHLKr
   255    11    97     4 kDQLTg
   255    59   149     4 iTCNNe
   255    92   186     2 sINe
   255    93   189     1 ePn
   255    96   193     1 gKt
   255   100   198     6 cAVTHLKk
   256    10    40     1 qAn
   256    13    44     1 rSi
   256    61    93     4 eMECVk
   256   104   140     1 pNn
   257     8   186     1 nDs
   257    86   265    29 gTDYKTGFQVCALYSVPLVWILLSLLCFFEd
   257   102   310     4 pDNWYh
   257   115   327     1 gQw
   258    90   102     7 nVVEPNNGg
   258    91   110     1 gIg
   258    94   114     1 tVe
   258    98   119     4 cAVIKp
   258   105   130     1 nSw
   259   106   109     5 pNSYPVe
   259   114   122     2 cAMm
   259   121   131     1 mLw
   260    67    90     3 hAEGw
   260   104   130     1 gKn
   260   108   135     3 cVHTn
   261    67    95     3 hAEGw
   261   104   135     1 gKn
   261   108   140     3 cVHTn
   262    67    92     3 hAEGr
   262   100   128     1 pNn
   262   108   137     2 cGHn
   262   115   146     1 kKw
   263    72   187     4 tEDEDk
   263   107   226     9 pDNWKGTNGKh
   263   114   242     6 cVRMGEKg
   263   121   255     1 kWw
   264    67    96     3 hTEGt
   264   100   132     1 pDn
   264   108   141     3 cCEIn
   265    67    97     3 hAERw
   265   104   137     1 gTn
   265   108   142     2 cVHt
   265   115   151     1 kKw
   266    67    95     3 hAERw
   266   104   135     1 gTn
   266   108   140     2 cVHt
   266   115   149     1 kKw
   267    11    20     1 vKl
   267    73    83     3 hAQRa
   267   114   127     2 cVTn
   267   121   136     1 kKw
   268    67    84     3 hAEGr
   268   100   120     1 pNn
   268   108   129     2 cGHn
   268   115   138     1 kKw
   269    67    86     1 nLl
   269    73    93     1 dGv
   269    75    96     1 rFw
   269   108   130     2 pNNd
   269   112   136     1 gEe
   269   116   141     2 cLEf
   269   123   150     1 kTw
   270     9    51     1 nEs
   270    65   108     4 rTVPLy
   270    98   145     5 pDDYTEh
   270   102   154     1 gGg
   270   113   166     1 gRw
   271    68    90     3 iTEEr
   271   101   126     1 pDn
   271   109   135     2 cVHt
   271   116   144     1 kKw
   272    68    97     1 rRf
   272    70   100     1 sYf
   272   104   135     1 nQe
   272   108   140     5 cIVLVNv
   273    35    60     2 pFQk
   273    60    87     1 lIy
   273    66    94     2 kHTq
   273   103   133     1 gGn
   273   107   138     3 cMDIn
   273   114   148     1 dHv
   274    67    90     3 pTQSw
   274   100   126     1 pDn
   274   108   135     2 cVHt
   274   115   144     1 fYf
   275    11    97     2 vSLt
   275    14   102     1 dKa
   275    34   123     1 sTd
   275    72   162     3 iGTDy
   275   107   200     1 nKe
   275   111   205     3 cVVIn
   276    10    97     2 vLLm
   276    13   102     1 eKs
   276    33   123     5 tKHTSTy
   276    71   166     3 rDAAy
   276   104   202     2 pSSd
   276   109   209     4 cVIINh
   277    66    87     3 lEGGr
   277    99   123     1 pSn
   277   107   132     2 cVEk
   277   114   141     1 kNw
   278    10    97     2 vLLm
   278    13   102     1 eKs
   278    33   123     5 tKHTSTy
   278    71   166     3 rDAAy
   278   104   202     2 pSSd
   278   109   209     4 cVIINh
   279    11    97     2 gSLm
   279    14   102     1 dKv
   279    34   123     1 lNd
   279    72   162     3 tSAGy
   279   105   198     1 pNq
   279   111   205     4 cVIINh
   280    28   157     4 aVSDTl
   280    63   196     2 tLKa
   280    68   203     1 nLp
   280    69   205     4 pFSYRn
   280    71   211     1 gFw
   280   102   243     1 pNd
   280   110   252     4 cAAVYp
   280   117   263     1 qSw
//