Complet list of 1p9a hssp fileClick here to see the 3D structure Complete list of 1p9a.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1P9A
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-05-06
HEADER     BLOOD CLOTTING                          09-MAY-03   1P9A
COMPND     MOL_ID: 1; MOLECULE: PLATELET GLYCOPROTEIN IB ALPHA CHAIN PRECURSOR; C
SOURCE     MOL_ID: 1; ORGANISM_SCIENTIFIC: HOMO SAPIENS; ORGANISM_COMMON: HUMAN; 
AUTHOR     K.I.VARUGHESE,R.CELIKEL,Z.M.RUGGERI
DBREF      1P9A G    1   290  UNP    P07359   GPBA_HUMAN      17    306
SEQLENGTH   266
NCHAIN        1 chain(s) in 1P9A data set
NALIGN      227
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : A5CKE2_HUMAN        1.00  1.00    1  266   17  282  266    0    0  639  A5CKE2     Platelet glycoprotein Ib alpha (Fragment) OS=Homo sapiens GN=GP1BA PE=2 SV=1
    2 : E0D852_HUMAN        1.00  1.00    1  266   17  282  266    0    0  346  E0D852     Platelet glycoprotein Ib alpha polypeptide type 2 OS=Homo sapiens GN=GP1BA PE=2 SV=1
    3 : E0D853_HUMAN        1.00  1.00    1  266   17  282  266    0    0  538  E0D853     Platelet glycoprotein Ib alpha polypeptide type 3 OS=Homo sapiens GN=GP1BA PE=4 SV=1
    4 : E0D854_HUMAN        1.00  1.00    1  266   17  282  266    0    0  573  E0D854     Platelet glycoprotein Ib alpha polypeptide type 4 OS=Homo sapiens GN=GP1BA PE=2 SV=1
    5 : GP1BA_HUMAN 1U0N    1.00  1.00    1  266   17  282  266    0    0  652  P07359     Platelet glycoprotein Ib alpha chain OS=Homo sapiens GN=GP1BA PE=1 SV=2
    6 : L7UV37_HUMAN        1.00  1.00    1  266   17  282  266    0    0  614  L7UV37     Glycoprotein Ib alpha polypeptide A1562T1563 deletion mutant OS=Homo sapiens GN=GP1BA PE=2 SV=1
    7 : L7UYB8_HUMAN        1.00  1.00    1  266   17  282  266    0    0  333  L7UYB8     Glycoprotein Ib alpha polypeptide G942 deletion mutant OS=Homo sapiens GN=GP1BA PE=2 SV=1
    8 : E0D851_HUMAN        0.99  0.99    1  266   17  282  266    0    0  665  E0D851     Platelet glycoprotein Ib alpha OS=Homo sapiens GN=GP1BA PE=4 SV=1
    9 : G3S9M4_GORGO        0.99  0.99   52  266    1  215  215    0    0  279  G3S9M4     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101149379 PE=4 SV=1
   10 : H2R9U1_PANTR        0.99  0.99    1  266   17  282  266    0    0  652  H2R9U1     Uncharacterized protein OS=Pan troglodytes GN=GP1BA PE=4 SV=1
   11 : G3QDA3_GORGO        0.98  0.99    1  266   11  276  266    0    0  635  G3QDA3     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101149379 PE=4 SV=1
   12 : G3SBC9_GORGO        0.98  0.99    1  266   11  276  266    0    0  635  G3SBC9     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101149379 PE=4 SV=1
   13 : H2NSC8_PONAB        0.97  0.98    1  266   17  282  266    0    0  628  H2NSC8     Uncharacterized protein OS=Pongo abelii GN=GP1BA PE=4 SV=1
   14 : G1S6K6_NOMLE        0.95  0.97    1  266   17  282  266    0    0  653  G1S6K6     Uncharacterized protein OS=Nomascus leucogenys GN=GP1BA PE=4 SV=1
   15 : L7URT5_HUMAN        0.94  0.96    1  206   17  222  206    0    0  254  L7URT5     Glycoprotein Ib alpha polypeptide T624 deletion mutant OS=Homo sapiens GN=GP1BA PE=2 SV=1
   16 : B8XNP4_MACMU        0.91  0.97    1  266   17  282  266    0    0  755  B8XNP4     Platelet glycoprotein Ib alpha polypeptide OS=Macaca mulatta GN=GPIbA PE=4 SV=1
   17 : F7H2B5_MACMU        0.91  0.97    1  266   17  282  266    0    0  434  F7H2B5     Uncharacterized protein OS=Macaca mulatta GN=GP1BA PE=4 SV=1
   18 : G7NI37_MACMU        0.91  0.97    1  266   17  282  266    0    0  644  G7NI37     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_08059 PE=4 SV=1
   19 : G7PT96_MACFA        0.91  0.97    1  266   17  282  266    0    0  641  G7PT96     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_07292 PE=4 SV=1
   20 : F6R971_CALJA        0.85  0.95    1  266   17  282  266    0    0  580  F6R971     Uncharacterized protein OS=Callithrix jacchus GN=GP1BA PE=4 SV=1
   21 : F6RK32_CALJA        0.85  0.95    1  266   17  282  266    0    0  643  F6RK32     Uncharacterized protein OS=Callithrix jacchus GN=GP1BA PE=4 SV=1
   22 : M3W8V2_FELCA        0.69  0.85    1  266   17  282  266    0    0  562  M3W8V2     Uncharacterized protein OS=Felis catus GN=GP1BA PE=4 SV=1
   23 : A2CFB8_MOUSE        0.68  0.83    1  266   17  282  266    0    0  734  A2CFB8     Glycoprotein 1b, alpha polypeptide OS=Mus musculus GN=Gp1ba PE=2 SV=1
   24 : D3ZQU7_RAT          0.68  0.82    1  266   17  282  266    0    0  717  D3ZQU7     Protein Gp1ba OS=Rattus norvegicus GN=Gp1ba PE=4 SV=1
   25 : GP1BA_MOUSE         0.68  0.83    1  266   17  282  266    0    0  734  O35930     Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=2 SV=2
   26 : I3NB49_SPETR        0.67  0.83    1  266   17  282  266    0    0  656  I3NB49     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=GP1BA PE=4 SV=1
   27 : B6ECP2_PIG          0.66  0.82    1  266   17  281  267    2    3  627  B6ECP2     Platelet glycoprotein Ib alpha polypeptide OS=Sus scrofa GN=GPIbA PE=4 SV=1
   28 : D2I1K9_AILME        0.66  0.84    3  266   19  282  264    0    0  610  D2I1K9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_019187 PE=4 SV=1
   29 : G1LIM3_AILME        0.66  0.84    3  266   19  282  264    0    0  610  G1LIM3     Uncharacterized protein OS=Ailuropoda melanoleuca GN=GP1BA PE=4 SV=1
   30 : L9KR50_TUPCH        0.65  0.85    1  266   17  282  266    0    0  647  L9KR50     Platelet glycoprotein Ib alpha chain OS=Tupaia chinensis GN=TREES_T100004137 PE=4 SV=1
   31 : GP1BA_CANFA         0.64  0.84    3  266   19  282  264    0    0  677  Q28256     Platelet glycoprotein Ib alpha chain OS=Canis familiaris GN=GP1BA PE=2 SV=2
   32 : M3Z7P0_MUSPF        0.64  0.83    1  266   17  282  266    0    0  682  M3Z7P0     Uncharacterized protein OS=Mustela putorius furo GN=GP1BA PE=4 SV=1
   33 : G5BWA0_HETGA        0.63  0.82    3  266   19  284  266    1    2  681  G5BWA0     Platelet glycoprotein Ib alpha chain OS=Heterocephalus glaber GN=GW7_04614 PE=4 SV=1
   34 : L5JZT0_PTEAL        0.63  0.81    1  266   17  282  266    0    0 1233  L5JZT0     Platelet glycoprotein Ib alpha chain OS=Pteropus alecto GN=PAL_GLEAN10010131 PE=4 SV=1
   35 : S7Q3F2_MYOBR        0.63  0.82    2  266   18  281  265    1    1  689  S7Q3F2     Platelet glycoprotein Ib alpha chain OS=Myotis brandtii GN=D623_10007473 PE=4 SV=1
   36 : G3GYC3_CRIGR        0.62  0.80    2  265   18  281  264    0    0  446  G3GYC3     Platelet glycoprotein Ib alpha chain OS=Cricetulus griseus GN=I79_002798 PE=4 SV=1
   37 : L5LEM4_MYODS        0.62  0.81    2  266   18  281  265    1    1  617  L5LEM4     Platelet glycoprotein Ib alpha chain OS=Myotis davidii GN=MDA_GLEAN10004534 PE=4 SV=1
   38 : G3ULJ5_LOXAF        0.61  0.79    1  266   17  281  266    1    1  546  G3ULJ5     Uncharacterized protein OS=Loxodonta africana GN=GP1BA PE=4 SV=1
   39 : H0V4G2_CAVPO        0.61  0.84    1  266   17  286  270    1    4  340  H0V4G2     Uncharacterized protein OS=Cavia porcellus GN=GP1BA PE=4 SV=1
   40 : L8HYC5_9CETA        0.60  0.81    2  265   18  281  264    0    0  637  L8HYC5     Platelet glycoprotein Ib alpha chain OS=Bos mutus GN=M91_06882 PE=4 SV=1
   41 : E1BB32_BOVIN        0.59  0.81    2  265   18  281  264    0    0  650  E1BB32     Uncharacterized protein OS=Bos taurus GN=GP1BA PE=4 SV=2
   42 : T0MF51_9CETA        0.58  0.82    2  266   18  282  265    0    0  505  T0MF51     Platelet glycoprotein Ib alpha chain OS=Camelus ferus GN=CB1_000489006 PE=4 SV=1
   43 : G1SER2_RABIT        0.56  0.79    1  266   17  281  266    1    1  664  G1SER2     Uncharacterized protein OS=Oryctolagus cuniculus GN=GP1BA PE=4 SV=1
   44 : G3VTH2_SARHA        0.50  0.73    1  262   29  290  262    0    0  706  G3VTH2     Uncharacterized protein OS=Sarcophilus harrisii GN=GP1BA PE=4 SV=1
   45 : G3VTH3_SARHA        0.50  0.73    1  262   17  278  262    0    0  672  G3VTH3     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=GP1BA PE=4 SV=1
   46 : F7BRW6_ORNAN        0.48  0.67   14  233    1  220  221    2    2  249  F7BRW6     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=GP1BA PE=4 SV=1
   47 : K7F173_PELSI        0.43  0.64   15  227    1  212  214    3    3  212  K7F173     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis GN=GP1BA PE=4 SV=1
   48 : R7VVP1_COLLI        0.43  0.65    6  223    1  218  219    2    2  218  R7VVP1     Platelet glycoprotein Ib alpha chain (Fragment) OS=Columba livia GN=A306_00780 PE=4 SV=1
   49 : R0LF08_ANAPL        0.41  0.64   15  227    1  213  214    2    2  213  R0LF08     Platelet glycoprotein Ib alpha chain (Fragment) OS=Anas platyrhynchos GN=Anapl_10866 PE=4 SV=1
   50 : F1NVW6_CHICK        0.40  0.62    4  227    2  232  231    4    7  232  F1NVW6     Uncharacterized protein (Fragment) OS=Gallus gallus PE=4 SV=2
   51 : U3KBZ2_FICAL        0.39  0.61    4  262   28  283  262    4    9  720  U3KBZ2     Uncharacterized protein OS=Ficedula albicollis GN=GP1BA PE=4 SV=1
   52 : R4GHX9_CHICK        0.38  0.62    2  256   20  275  258    4    5  549  R4GHX9     Uncharacterized protein (Fragment) OS=Gallus gallus PE=4 SV=1
   53 : R4GLY4_CHICK        0.38  0.62    2  256   19  274  258    4    5  603  R4GLY4     Uncharacterized protein (Fragment) OS=Gallus gallus PE=4 SV=1
   54 : U3IQT6_ANAPL        0.38  0.61    1  253   17  271  256    3    4  613  U3IQT6     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=GP1BA PE=4 SV=1
   55 : A5H6J8_PETMA        0.37  0.60    3  227    1  209  232    5   30  244  A5H6J8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   56 : D2KXT4_EPTBU        0.37  0.60    2  226   13  240  231    6    9  283  D2KXT4     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   57 : D2KXV3_EPTBU        0.37  0.58    3  227   14  241  231    6    9  286  D2KXV3     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   58 : A5H6I3_PETMA        0.36  0.58    3  227    1  210  233    6   31  246  A5H6I3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   59 : A5H6U7_PETMA        0.36  0.56    3  227    1  210  233    6   31  246  A5H6U7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   60 : C7B6Y4_PETMA        0.36  0.58    3  227    2  211  233    6   31  250  C7B6Y4     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   61 : C7B6Y5_PETMA        0.36  0.57    3  227    2  211  233    6   31  250  C7B6Y5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   62 : C7B6Y7_PETMA        0.36  0.57    3  227    2  211  233    6   31  250  C7B6Y7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   63 : D2KXI6_EPTBU        0.36  0.59    2  227   13  241  232    6    9  286  D2KXI6     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   64 : Q6E4J6_PETMA        0.36  0.59    4  227   10  236  230    6    9  257  Q6E4J6     Variable lymphocyte receptor (Fragment) OS=Petromyzon marinus PE=4 SV=1
   65 : A5H6T5_PETMA        0.35  0.55    3  227    1  210  233    6   31  246  A5H6T5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   66 : C7B6Y3_PETMA3M18    0.35  0.57    3  227    2  211  233    6   31  250  C7B6Y3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=1 SV=1
   67 : C7B6Y6_PETMA        0.35  0.58    3  227    2  211  233    6   31  250  C7B6Y6     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   68 : C7B6Y8_PETMA        0.35  0.58    3  227    2  211  233    6   31  250  C7B6Y8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   69 : C7B6Y9_PETMA        0.35  0.58    3  227    2  211  233    6   31  250  C7B6Y9     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   70 : C7B6Z0_PETMA        0.35  0.58    3  227    2  211  233    6   31  250  C7B6Z0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   71 : C7B6Z1_PETMA        0.35  0.57    3  227    2  211  233    6   31  250  C7B6Z1     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   72 : C7B6Z2_PETMA        0.35  0.58    3  227    2  211  233    6   31  250  C7B6Z2     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   73 : C7B6Z3_PETMA3M19    0.35  0.58    3  227    2  211  233    6   31  250  C7B6Z3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=1 SV=1
   74 : C7B6Z4_PETMA        0.35  0.58    3  227    2  211  233    6   31  250  C7B6Z4     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   75 : C7B6Z5_PETMA        0.35  0.57    3  227    2  211  233    6   31  250  C7B6Z5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus PE=2 SV=1
   76 : D2KXJ7_EPTBU        0.35  0.58    2  227   13  241  232    6    9  285  D2KXJ7     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   77 : D2KXT2_EPTBU        0.35  0.53    2  226   13  264  255    7   33  311  D2KXT2     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   78 : D2KXV1_EPTBU        0.35  0.59    2  227   13  241  232    6    9  285  D2KXV1     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   79 : D2KY13_EPTBU        0.35  0.59    4  226   24  251  229    5    7  293  D2KY13     Variable lymphocyte receptor B (Fragment) OS=Eptatretus burgeri GN=VLRB PE=4 SV=1
   80 : Q2VGT2_PETMA        0.35  0.58    3  233    1  236  237    5    7  264  Q2VGT2     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
   81 : A1IKC8_LAMJA        0.34  0.58    4  228   12  241  231    5    7  264  A1IKC8     Variable lymphocyte receptor (Fragment) OS=Lampetra japonica GN=VLR PE=4 SV=1
   82 : A5H6T0_PETMA        0.34  0.57    3  227    1  210  233    6   31  246  A5H6T0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   83 : A5H6T7_PETMA        0.34  0.55    3  227    1  210  233    6   31  246  A5H6T7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   84 : A5H6Y5_PETMA        0.34  0.51    3  227    1  185  230    4   50  220  A5H6Y5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   85 : A5H6Z1_PETMA        0.34  0.56    3  227    1  210  233    6   31  247  A5H6Z1     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
   86 : D2KXH6_EPTBU        0.34  0.56    3  226   14  216  228    6   29  259  D2KXH6     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   87 : D2KXK1_EPTBU        0.34  0.55    3  227   14  217  229    6   29  261  D2KXK1     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   88 : D2KXK2_EPTBU        0.34  0.54    3  227   14  217  229    6   29  262  D2KXK2     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   89 : D2KXL3_EPTBU        0.34  0.55    3  227   14  217  229    6   29  262  D2KXL3     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   90 : D2KXM6_EPTBU        0.34  0.55    3  227   14  217  229    6   29  262  D2KXM6     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   91 : D2KXN6_EPTBU        0.34  0.55    2  227   13  217  230    6   29  274  D2KXN6     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
   92 : D2KXP3_EPTBU        0.34  0.57    2  227   13  217  230    6   29  275  D2KXP3     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
   93 : D2KXR6_EPTBU        0.34  0.53    2  226   13  216  229    6   29  271  D2KXR6     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
   94 : D2KXR9_EPTBU        0.34  0.54    3  227   14  217  229    6   29  274  D2KXR9     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
   95 : D2KXT0_EPTBU        0.34  0.57    3  227   14  217  229    6   29  274  D2KXT0     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
   96 : D2KXT1_EPTBU        0.34  0.55    2  227   13  265  256    7   33  322  D2KXT1     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
   97 : D2KXU2_EPTBU        0.34  0.53    2  226   13  216  229    6   29  263  D2KXU2     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
   98 : D2KXW8_EPTBU        0.34  0.58    3  227   14  217  229    6   29  270  D2KXW8     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
   99 : D2KXX2_EPTBU        0.34  0.52    2  227   13  265  256    7   33  318  D2KXX2     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  100 : D2KXX4_EPTBU        0.34  0.54    3  226   14  216  228    6   29  267  D2KXX4     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  101 : Q2VGF4_PETMA        0.34  0.59    3  231    1  233  235    6    8  266  Q2VGF4     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  102 : Q2VGP9_PETMA        0.34  0.62    3  226    1  229  230    5    7  257  Q2VGP9     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  103 : Q2VGX4_PETMA        0.34  0.52    3  231    1  209  233    6   28  242  Q2VGX4     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  104 : A1IKC7_LAMJA        0.33  0.55    4  231   12  220  232    5   27  243  A1IKC7     Variable lymphocyte receptor (Fragment) OS=Lampetra japonica GN=VLR PE=4 SV=1
  105 : A5H6I6_PETMA        0.33  0.52    3  227    1  186  231    5   51  222  A5H6I6     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  106 : A5H6J0_PETMA        0.33  0.51    3  227    1  186  231    5   51  222  A5H6J0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  107 : A5H6L1_PETMA        0.33  0.57    3  227    1  210  233    6   31  244  A5H6L1     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  108 : A5H6M7_PETMA        0.33  0.54    3  227    1  210  233    6   31  244  A5H6M7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  109 : A5H6Q9_PETMA        0.33  0.52    3  227    1  186  231    6   51  222  A5H6Q9     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  110 : A5H6S7_PETMA        0.33  0.58    3  232    1  215  238    6   31  245  A5H6S7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  111 : A5H6U6_PETMA        0.33  0.51    3  227    1  186  231    5   51  226  A5H6U6     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  112 : A5H6X1_PETMA        0.33  0.51    3  227    1  186  231    6   51  222  A5H6X1     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  113 : A5H6X2_PETMA        0.33  0.58    3  227    1  210  233    6   31  246  A5H6X2     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  114 : A5H714_PETMA        0.33  0.56    3  227    1  210  233    6   31  246  A5H714     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=4 SV=1
  115 : D2KXI0_EPTBU        0.33  0.54    3  227   14  217  229    6   29  262  D2KXI0     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  116 : D2KXI8_EPTBU        0.33  0.55    3  227   14  217  229    6   29  262  D2KXI8     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  117 : D2KXM3_EPTBU        0.33  0.54    2  227   13  217  230    6   29  262  D2KXM3     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  118 : D2KXM4_EPTBU        0.33  0.54    3  226   14  216  228    6   29  263  D2KXM4     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  119 : D2KXM7_EPTBU        0.33  0.54    2  226   13  216  229    6   29  275  D2KXM7     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  120 : D2KXM8_EPTBU        0.33  0.56    2  227   13  217  230    6   29  274  D2KXM8     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  121 : D2KXN9_EPTBU        0.33  0.55    2  227   13  217  230    6   29  273  D2KXN9     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  122 : D2KXP1_EPTBU        0.33  0.55    2  227   13  217  230    6   29  274  D2KXP1     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  123 : D2KXP7_EPTBU        0.33  0.54    2  227   13  217  230    6   29  273  D2KXP7     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  124 : D2KXQ4_EPTBU        0.33  0.54    2  227   13  217  230    6   29  275  D2KXQ4     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  125 : D2KXT5_EPTBU        0.33  0.56    2  227   13  217  230    6   29  263  D2KXT5     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  126 : D2KXX0_EPTBU        0.33  0.54    2  227   13  217  230    6   29  270  D2KXX0     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  127 : D2KXX5_EPTBU        0.33  0.54    2  227   13  217  230    6   29  271  D2KXX5     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  128 : E0D2Y1_LAMJA        0.33  0.55    3  226   12  216  228    5   27  244  E0D2Y1     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  129 : E0D339_LAMJA        0.33  0.53    3  227   10  217  231    6   29  246  E0D339     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  130 : E0D355_LAMJA        0.33  0.53    1  227    8  217  233    6   29  246  E0D355     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  131 : Q2VGI2_PETMA        0.33  0.60    3  229    1  232  233    5    7  264  Q2VGI2     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  132 : Q2VGV6_PETMA        0.33  0.58    3  227    1  230  231    5    7  264  Q2VGV6     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  133 : Q2YE01_EPTST        0.33  0.57    4  266   24  283  269    7   15  358  Q2YE01     Variable lymphocyte receptor B OS=Eptatretus stoutii GN=VLRB PE=2 SV=1
  134 : Q32QQ2_EPTST        0.33  0.55    2  266   32  299  271    6    9  372  Q32QQ2     Variable lymphocyte receptor A OS=Eptatretus stoutii GN=VLRA PE=2 SV=1
  135 : Q32QQ5_EPTST        0.33  0.55    2  266   32  299  271    6    9  372  Q32QQ5     Variable lymphocyte receptor A OS=Eptatretus stoutii GN=VLRA PE=2 SV=1
  136 : Q4G1K9_EPTBU        0.33  0.54    4  256   24  250  257    7   34  330  Q4G1K9     Variable lymphocyte receptor B OS=Eptatretus burgeri GN=VLRB PE=2 SV=1
  137 : A1IKC4_LAMJA        0.32  0.55    4  231   12  220  232    5   27  243  A1IKC4     Variable lymphocyte receptor (Fragment) OS=Lampetra japonica GN=VLR PE=4 SV=1
  138 : A1IKC6_LAMJA        0.32  0.55    4  231   12  219  232    6   28  242  A1IKC6     Variable lymphocyte receptor (Fragment) OS=Lampetra japonica GN=VLR PE=4 SV=1
  139 : A5H6L8_PETMA        0.32  0.52    3  227    1  186  231    5   51  222  A5H6L8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  140 : A5H6M3_PETMA        0.32  0.54    3  253    1  236  259    6   31  251  A5H6M3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  141 : A5H6P0_PETMA        0.32  0.56    3  227    1  210  233    6   31  246  A5H6P0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  142 : A5H6R2_PETMA        0.32  0.50    3  227    1  186  231    6   51  222  A5H6R2     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  143 : A5H6T3_PETMA        0.32  0.50    3  227    1  186  231    5   51  224  A5H6T3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  144 : A5H6T8_PETMA        0.32  0.51    3  227    1  186  231    5   51  226  A5H6T8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  145 : A5H6V2_PETMA        0.32  0.52    3  227    1  186  231    5   51  220  A5H6V2     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  146 : A5H6V6_PETMA        0.32  0.50    3  227    1  186  231    6   51  222  A5H6V6     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  147 : A5H6V8_PETMA        0.32  0.52    3  227    1  186  231    5   51  222  A5H6V8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  148 : A5H6Y0_PETMA        0.32  0.50    3  227    1  186  231    5   51  222  A5H6Y0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  149 : A5H6Y2_PETMA        0.32  0.49    3  227    1  186  231    5   51  222  A5H6Y2     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  150 : A5H706_PETMA        0.32  0.53    3  247    1  230  253    6   31  247  A5H706     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  151 : A5H711_PETMA        0.32  0.52    3  227    1  186  231    5   51  220  A5H711     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=4 SV=1
  152 : D2KXI3_EPTBU        0.32  0.50    2  227   13  193  228    5   49  238  D2KXI3     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  153 : D2KXJ2_EPTBU        0.32  0.53    2  227   13  217  230    6   29  262  D2KXJ2     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  154 : D2KXJ8_EPTBU        0.32  0.53    2  226   13  216  229    6   29  263  D2KXJ8     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  155 : D2KXK0_EPTBU        0.32  0.53    2  227   13  217  230    6   29  261  D2KXK0     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  156 : D2KXL9_EPTBU        0.32  0.51    2  227   13  217  230    6   29  263  D2KXL9     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  157 : D2KXM9_EPTBU        0.32  0.53    2  227   13  265  256    7   33  321  D2KXM9     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  158 : D2KXP2_EPTBU        0.32  0.52    2  227   13  193  228    5   49  251  D2KXP2     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  159 : D2KXP6_EPTBU        0.32  0.55    2  227   13  265  256    7   33  322  D2KXP6     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  160 : D2KXS4_EPTBU        0.32  0.53    2  227   13  217  230    6   29  273  D2KXS4     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  161 : D2KXV8_EPTBU        0.32  0.52    2  227   13  193  228    5   49  238  D2KXV8     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  162 : D2KXX8_EPTBU        0.32  0.57    2  227   13  217  230    6   29  270  D2KXX8     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  163 : E0D2W1_LAMJA        0.32  0.55    1  226    8  216  232    6   29  244  E0D2W1     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  164 : E0D312_LAMJA        0.32  0.54    1  227    8  217  233    6   29  246  E0D312     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  165 : E0D340_LAMJA        0.32  0.49    1  226    8  192  230    5   49  220  E0D340     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  166 : Q2VGX3_PETMA        0.32  0.52    4  231    2  257  257    6   30  290  Q2VGX3     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  167 : Q32R29_EPTBU        0.32  0.53    2  227   32  284  256    7   33  393  Q32R29     Variable lymphocyte receptor A OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  168 : T1YUY9_EPTST        0.32  0.55    4  266   27  295  270    6    8  371  T1YUY9     Third variable lymphocyte receptor OS=Eptatretus stoutii PE=2 SV=1
  169 : A1IKC1_LAMJA        0.31  0.49    4  231   12  196  230    4   47  219  A1IKC1     Variable lymphocyte receptor (Fragment) OS=Lampetra japonica GN=VLR PE=4 SV=1
  170 : A1IKC3_LAMJA        0.31  0.54    4  232   12  220  233    6   28  242  A1IKC3     Variable lymphocyte receptor (Fragment) OS=Lampetra japonica GN=VLR PE=4 SV=1
  171 : A5H6I4_PETMA        0.31  0.49    3  227    1  186  231    5   51  224  A5H6I4     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  172 : A5H6J3_PETMA        0.31  0.51    3  227    1  186  231    5   51  222  A5H6J3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  173 : A5H6M5_PETMA        0.31  0.51    3  227    1  186  231    5   51  222  A5H6M5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  174 : A5H6P5_PETMA        0.31  0.49    3  227    1  186  231    5   51  222  A5H6P5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  175 : A5H6Q3_PETMA        0.31  0.55    3  227    1  210  233    6   31  246  A5H6Q3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  176 : A5H6Q4_PETMA        0.31  0.51    3  227    1  186  231    5   51  222  A5H6Q4     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  177 : A5H6R4_PETMA        0.31  0.54    3  232    1  215  238    6   31  245  A5H6R4     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  178 : A5H6R7_PETMA        0.31  0.49    3  233    1  192  237    6   51  222  A5H6R7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  179 : A5H6U5_PETMA        0.31  0.49    3  227    1  186  231    5   51  220  A5H6U5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  180 : A5H6W8_PETMA        0.31  0.49    3  227    1  186  231    5   51  222  A5H6W8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  181 : A5H6Y6_PETMA        0.31  0.47    3  227    1  186  231    5   51  220  A5H6Y6     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  182 : A5H6Y9_PETMA        0.31  0.55    3  227    1  210  233    6   31  244  A5H6Y9     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  183 : A5H6Z7_PETMA        0.31  0.50    3  227    1  186  231    5   51  224  A5H6Z7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  184 : A5H6Z9_PETMA        0.31  0.52    3  227    1  186  231    5   51  220  A5H6Z9     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  185 : A5H700_PETMA        0.31  0.51    3  233    1  192  237    5   51  222  A5H700     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  186 : A5H702_PETMA        0.31  0.49    3  247    1  206  251    5   51  223  A5H702     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  187 : D2KXJ3_EPTBU        0.31  0.52    2  226   13  216  229    6   29  259  D2KXJ3     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  188 : D2KXW2_EPTBU        0.31  0.54    2  227   13  217  230    6   29  262  D2KXW2     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=4 SV=1
  189 : E0D2X7_LAMJA        0.31  0.56    1  226    8  216  232    6   29  244  E0D2X7     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  190 : E0D336_LAMJA        0.31  0.50    1  226    8  192  230    5   49  220  E0D336     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  191 : E0D354_LAMJA        0.31  0.50    1  226    8  192  230    5   49  220  E0D354     Variable lymphocyte receptor C (Fragment) OS=Lampetra japonica GN=VLRC PE=2 SV=1
  192 : F7DC30_XENTR        0.31  0.56    2  266   17  279  269    6   10  613  F7DC30     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
  193 : Q2VGK2_PETMA        0.31  0.52    4  231    8  216  233    7   29  249  Q2VGK2     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  194 : T1YTK0_EPTST        0.31  0.54    4  266   27  295  270    6    8  371  T1YTK0     Third variable lymphocyte receptor OS=Eptatretus stoutii PE=2 SV=1
  195 : A5H6K2_PETMA        0.30  0.51    3  247    1  206  251    5   51  223  A5H6K2     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  196 : A5H6L0_PETMA        0.30  0.51    3  227    1  186  231    6   51  222  A5H6L0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  197 : A5H6M2_PETMA        0.30  0.50    3  247    1  206  251    5   51  223  A5H6M2     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  198 : A5H6N3_PETMA        0.30  0.51    3  227    1  186  231    6   51  222  A5H6N3     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  199 : A5H6P8_PETMA        0.30  0.50    3  247    1  230  253    6   31  247  A5H6P8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  200 : A5H6R9_PETMA        0.30  0.54    3  247    1  230  253    6   31  247  A5H6R9     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  201 : A5H6S8_PETMA        0.30  0.51    3  227    1  186  231    5   51  220  A5H6S8     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  202 : A5H6T1_PETMA        0.30  0.49    3  253    1  212  257    5   51  227  A5H6T1     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  203 : A5H6T6_PETMA        0.30  0.51    3  232    1  191  236    6   51  221  A5H6T6     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  204 : A5H6U0_PETMA        0.30  0.52    3  233    1  192  237    5   51  222  A5H6U0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  205 : A5H6V1_PETMA        0.30  0.51    3  247    1  230  253    6   31  247  A5H6V1     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  206 : A5H6X0_PETMA        0.30  0.52    3  227    1  186  231    6   51  222  A5H6X0     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  207 : A5H6X7_PETMA        0.30  0.51    3  227    1  186  231    5   51  220  A5H6X7     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  208 : A5H6Z5_PETMA        0.30  0.52    3  227    1  186  231    6   51  222  A5H6Z5     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  209 : A5H704_PETMA        0.30  0.51    3  247    1  206  251    5   51  223  A5H704     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=2 SV=1
  210 : A5H709_PETMA        0.30  0.51    3  241    1  200  245    5   51  220  A5H709     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=4 SV=1
  211 : A5H712_PETMA        0.30  0.50    3  227    1  186  231    5   51  220  A5H712     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=4 SV=1
  212 : A5H715_PETMA        0.30  0.49    3  247    1  206  251    5   51  223  A5H715     Variable lymphocyte receptor A diversity region (Fragment) OS=Petromyzon marinus GN=VLRA PE=4 SV=1
  213 : D2KXN7_EPTBU        0.30  0.52    2  226   13  216  229    6   29  275  D2KXN7     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  214 : D2KXW6_EPTBU        0.30  0.49    2  227   13  241  254    7   53  294  D2KXW6     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  215 : D2KXY0_EPTBU        0.30  0.52    2  227   13  289  280    8   57  342  D2KXY0     Variable lymphocyte receptor A (Fragment) OS=Eptatretus burgeri GN=VLRA PE=2 SV=1
  216 : K9IK00_DESRO        0.30  0.45   32  233   70  330  263    8   63  373  K9IK00     Putative phospholipase a2 inhibitor subunit b OS=Desmodus rotundus PE=2 SV=1
  217 : M3Y167_MUSPF        0.30  0.43   25  228   69  329  263    8   61  354  M3Y167     Uncharacterized protein OS=Mustela putorius furo GN=LRG1 PE=4 SV=1
  218 : Q2VGT0_PETMA        0.30  0.48    3  232    1  186  232    5   48  218  Q2VGT0     Variable lymphocyte receptor diversity region (Fragment) OS=Petromyzon marinus GN=VLR PE=2 SV=1
  219 : Q2YE56_EPTST        0.30  0.52    2  266   32  274  269    7   30  347  Q2YE56     Variable lymphocyte receptor A OS=Eptatretus stoutii GN=VLRA PE=2 SV=1
  220 : Q32QN4_EPTST        0.30  0.53    2  266   32  275  269    6   29  348  Q32QN4     Variable lymphocyte receptor A OS=Eptatretus stoutii GN=VLRA PE=2 SV=1
  221 : Q32QR8_EPTST        0.30  0.51    2  266   32  274  269    7   30  347  Q32QR8     Variable lymphocyte receptor A OS=Eptatretus stoutii GN=VLRA PE=2 SV=1
  222 : Q32QU7_EPTST        0.30  0.52    2  266   32  275  269    6   29  348  Q32QU7     Variable lymphocyte receptor A OS=Eptatretus stoutii GN=VLRA PE=2 SV=1
  223 : Q32R26_EPTBU2O6Q    0.30  0.51    2  226   32  259  253    7   53  371  Q32R26     Variable lymphocyte receptor A OS=Eptatretus burgeri GN=VLRA PE=1 SV=1
  224 : Q6E4H0_PETMA        0.30  0.48    4  232   10  195  231    4   47  214  Q6E4H0     Variable lymphocyte receptor (Fragment) OS=Petromyzon marinus PE=2 SV=1
  225 : T1YSE0_EPTST        0.30  0.55    4  266   27  292  269    6    9  368  T1YSE0     Third variable lymphocyte receptor OS=Eptatretus stoutii PE=2 SV=1
  226 : T1YSF3_EPTST        0.30  0.52    4  266   27  268  269    8   33  344  T1YSF3     Third variable lymphocyte receptor OS=Eptatretus stoutii PE=2 SV=1
  227 : U6CVW9_NEOVI        0.30  0.43   26  228   63  322  262    8   61  347  U6CVW9     Leucine-rich alpha-2-glycoprotein OS=Neovison vison GN=A2GL PE=2 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 G H              0   0  111   43   47  HHHHHHHH HHHHHHHHHHHHQQQQHH  H Q Q   HH   QQQ        Q                
     2    2 G P        +     0   0  121   97   60  PPPPPPPP PPPPPPPPPPPPSHPHSS  P E SPPPSPPPNNSS      PPQ G      G       
     3    3 G I  S    S+     0   0   77  201   59  IIIIIIII IIIIIIIIIITTVTTTIIVVNIVITATTIVIIINPP      PPPTVVTTTTTV TTTTTT
     4    4 G a  S    S-     0   0    6  220    0  CCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC    CCCCCCCCCCCCCCCCCCCCC
     5    5 G E  E     -A   16   0A 118  220   58  EEEEEEEE EEEEEEEEEEEEESDSDEEEEEEeEEEENnEEEEEE    pppppeSSeeeeeSPeeeeee
     6    6 G V  E     -A   15   0A  44  163   74  VVVVVVVV VVVVVVVVVVVVVIVIIVVVIVViVVIVVvVVVVTT  M mmmmmc..ccccc.Scccccc
     7    7 G S  E     +A   14   0A  56  163   71  SSSSSSSS SSSSSSSSSSSSSSSSSTSSFSSETSSSSSGGSSQQ  N NNNNNT..TTTTT.QTTTTTT
     8    8 G K        +     0   0  155  221   68  KKKKKKKK KKKKKKKKKKKKQKKKKKQQKKQVKRQRERNNIEKK  K KKKKKCCCCCCCCCCCCCCCC
     9    9 G V  S >  S-     0   0  103  221   67  VVVVVVVV VVVVVVVVVVVVVVVVPVVVGVVVVVVVVAKKVVGG  V VVVVVNNNNNNNNNSNNNNNN
    10   10 G A  T 3  S+     0   0  100  221   74  AAAAAAAA AAAAAAAAAAAATTTTAATTATTGAATADGDDAAAA  K KKKKKENNEEEEENCEEEEEE
    11   11 G S  T 3  S-     0   0   95  221   57  SSSSSSSS SSSSSSSSSSSSSSSSSSSSNSTNSSSSSKSSKSSS  D DDDDDGNNGGGGGNSGGGGGG
    12   12 G H    <   -     0   0   68  221   64  HHHHHHHH HHHHHHHHHHHHQLLLQQQQKQLLQQFQKRQQRQKK  L ILIIIKKKKKKKKKGKKKKKK
    13   13 G L        -     0   0   28  221   82  LLLLLLLL LLLLLLLLLLLLVLLLLVVVVVMVVVRVAVVVMVMM  L VLVVLKNNKKKKKNTKKKKKK
    14   14 G E  E     -Ab   7  35A  65  222   52  EEEEEEEE EEEEEEEEEEEEEEEEEEEEEEESEEEELIEEEEEEE E EEEEEESSEEEEESHEEEEEE
    15   15 G V  E     -Ab   6  36A   0  224    8  VVVVVVVV VVVVVVVVVVVVVVVVVMVVVVVVVVVVVVVVLVTTTVVVVVVVVVVVVVVVVVVVVVVVV
    16   16 G N  E     +Ab   5  37A  59  224   36  NNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNNNNNNNNNDDNNNNNDNNDDDDN
    17   17 G a    >   +     0   0    0  224    2  CCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    18   18 G D  T 3   +     0   0   34  223   71  DDDDDDDD DDDDDDDDDDDDDEEEEEDDEDDEDDEDQEEEDDEERSTTTTTTTQSSQQQQQSEQQQQQQ
    19   19 G K  T 3  S+     0   0  148  223   75  KKKKKKKK KKKKKKKKKKKKNNDNKNNNKNNSNNNNKNNNNQSSGGGGGGGGGSIYYSGYYSRSGGGGG
    20   20 G R  S <  S-     0   0   81  224   36  RRRRRRRR RRRRRRSSSSRRRKKKQKRRQKRMLQQQRMKKLRLLLQQQRQRRQKQKKKKKKKKKKKKKK
    21   21 G N        +     0   0  130  224   72  NNNNNNNN NNNNNNNNNNNNGKKKNTGGKGGNGGKGGNGGGKGGGGAADADDADRKSGSGGRRGSSSSS
    22   22 G L        -     0   0   25  224    3  LLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHLLLLLLLLLLLLLLLLLLLLLLL
    23   23 G T  S    S+     0   0   98  224   64  TTTTTTTT TTTTTTRRRRRRKTKTTKRRTKKKKKTKKNKKKKKKRRSSGSSSSTTTKQDKKTTQDDDDD
    24   24 G A  S    S-     0   0   55  224   41  AAAAAAAA AVVAAAAAAAVVAAKAMAAAKAVGAAAAVMAAAASSAETAATAAASAASASAAASASSSSS
    25   25 G L        -     0   0   28  225   30  LLLLLLLL LLLLLLLLLLLLPLLLLPVVLLLLLMLMLLPPPLVVVVVVVVVVVVIIVVVVVIVIVVVVV
    26   26 G P        -     0   0    5  226    0  PPPPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
    27   27 G P  S    S+     0   0  124  226   64  PPPPPPPP PPPPPPPPPPPPPATAAPPPLPTTPSASPAPPPPLLTLTSASAASPSSSPSSSSASSSSSS
    28   28 G D        +     0   0   47  226   48  DDDDDDDD DDDDDDDDDDDDDDDDDDGGGGDDDDDDDDDDDGKKNPDGSDGGGGNNGGGGGNGGGGGGG
    29   29 G L        -     0   0    9  226   22  LLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLIIILIIIIIIIIIIII
    30   30 G P    >   -     0   0   15  226    9  PPPPPPPP PPPPPPPPPPPPPPPPPEPPPPPRPPPPPPPPPPSSPPPPPPPPPPPPPPPPPPPPPPPPP
    31   31 G K  T 3  S+     0   0  118  226   64  KKKKKKKK KKKKKKKKKKKKAAAAAAEESGGAAAAATAAAAAPPAKEEEAEEEATLAAAAATTAAAAAA
    32   32 G D  T 3  S+     0   0   74  227   26  DDDDDDDD DDDDDDDDDDDDDDDDDEDDDDDDDDDDDDDDENDDANDDNDNNDDDEDEDDDDTDDDDDD
    33   33 G T    <   +     0   0    2  227   12  TTTTTTTT TTTTTTTMTMAATTTTTTTTATTTTTTTTTTTTMTTTTTTTTTTTTTTTTTTTTTTTTTTT
    34   34 G T        +     0   0   19  227   69  TTTTTTTT TTTTTTTTTTTTAGGGATAANAAANTGTAAAAATAAGSGGGGGGGTETNREEEEKEEEEEE
    35   35 G I  E     -bc  14  59A   8  227   85  IIIIIIII IIIIIIIIIIIIIIIIINIITIIIIIISITIIIIIIIIIIIIIIINNQSTKKKNIKKKKKK
    36   36 G L  E     -bc  15  60A   3  227    0  LLLLLLLL LLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    37   37 G H  E     +bc  16  61A  30  227   82  HHHHHHHH HHHHHHHHHHHHRHHHHHHHYHHHRRHRYHHHHRFFDLLLLLLLLNKYDVDDDKRDDDDDD
    38   38 G L    >   +     0   0    0  227    3  LLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLLLLLLLLLLLLLL
    39   39 G S  T 3   +     0   0    2  227   75  SSSSSSSS SSSGGSGGGGSSGGSGSGGGRASGSGTGDGGGGGQQASNNNSNNNQGNNEQQQDYRQQQQQ
    40   40 G E  T 3  S+     0   0   73  227   92  EEEEEEEE EEEEEEEEEEEEEEKEEEKKEEVKKEKEEREEEENNETADADAADYRLSGSSSYISSSSSS
    41   41 G N  S <  S-     0   0    4  227   23  NNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTNNTTTTTT
    42   42 G L        +     0   0   61  227   83  LLLLLLLL LLLLLLLVLVLLPQQQLPPPPPPVSPKPPPPPSPGGQHNHRRRRHSKSSAGGGKQGGGGGG
    43   43 G L        +     0   0    1  227   10  LLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLL
    44   44 G Y  S    S+     0   0  123  227   82  YYYYYYYY YYYYYYYYYYYYGGGGVGGGGGGVGRGRAVGGGVKKSAVTLELLTVSSAKAATSTAAAAAA
    45   45 G T  E    S+k   69   0B  58  227   71  TTTTTTTT TTTTTTTTTTSSTTTTTTTTTAATTSNTTTTTTTSSHSSSSSSSSQSKTTTTTSKTTTTTT
    46   46 G F  E     -k   70   0B   8  227   19  FFFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFVVLVILVVVLLLLILLLLLLLLLLL
    47   47 G S  E >   -k   71   0B  19  227   49  SSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSLESSSSSS
    48   48 G L  G >  S+     0   0    1  227   88  LLLLLLLL LLLLLLLLLLMMTTTTTTTTLTTMTMTMTLMMTMTTTTTTTTTTTSAPSSDDDSPDDDDDD
    49   49 G A  G >  S+     0   0   30  227   71  AAAAAAAA AAAAAAAAAAAAAASAASAAGAAKAAAVAEAAADSSAAAAAAAAANKTNTAAAKGTAAAAT
    50   50 G T  G <  S+     0   0   63  227   52  TTTTTTTT TTTTTTSSSSSSSSYSSSSSSLSPPSSSSSSSSASSSSAAAAAAAAAVAATTTAVATTTTA
    51   51 G L  G X  S+     0   0    0  227   12  LLLLLLLL LLLLLLLLLLLLLLLLLLVVLLVLLLVLVLVVLLLLLFFFFFFFFFFFFFFFFFFFFFFFF
    52   52 G M  T <  S+     0   0   88  228   78  MMMMMMMMMMMMMMMVVVVVVLVVVVVGGVGQVVEVAVVLLVVSSAQLLQLQQLQHHQARRRQDRRRRRR
    53   53 G P  T 3  S+     0   0   64  228   67  PPPPPPPPPPPPPPPPPPPPPPHHHPYSSSPSPRPHPNPNNSSFFHHPPTPKKPGRRGHGGGSSGGGGGG
    54   54 G Y    X   +     0   0   18  228   17  YYYYYYYYYYYYYFYFFFFFFLFFFLLLLFLLFLLFLLLLLLFLLLLLLLLLLLLLLLLLLLFLLLLLLL
    55   55 G T  T 3  S+     0   0   99  228   52  TTTTTTTTTTTTTTTTTTTTTTTTTTPAATTTTTTTTTTSSTSTTQPTTPTAATTSTTKTTTTTTTTTTT
    56   56 G R  T 3  S+     0   0  142  228   62  RRRRRRRRRRRRRRRRRRRHHRHHHGRQQHRRHHRSKHQQQSRQQQEQVEQAAVKKKKQKKKKAKKKKKK
    57   57 G L    <   +     0   0    6  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLDLLLLLLLLLLLLLLLLLLLL
    58   58 G T        +     0   0   61  228   34  TTTTTTTTTTTTTTTTTTTTTATTTTTAATAATITTTITTTTVTTTIQQTQQQQTTRTQTTTTTTTTTTT
    59   59 G Q  E     -cd  35  81A  56  228   86  QQQQQQQQQQQQQQQQQQQQQQYHYQQQQKQRQQQRQQQEEQQEEQDDDgDDDDFYLWRWWWFFWWWWWW
    60   60 G L  E     -cd  36  82A   0   86    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLlILLL.LL.....LL......
    61   61 G N  E     +cd  37  83A  17   86   77  NNNNNNNNNNNNYYNYYYYYYHYYYYHHHYHYYHHYHHYFFHYYYDDDDNDDDD.SY.....SN......
    62   62 G L    >   +     0   0    1   86    6  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLIILLLLALLLL.LL.....LL......
    63   63 G D  T 3   +     0   0   11   86   68  DDDDDDDDDDDDDDDDDDDDDSDSDDGRRDRRDGGDGEDGGSHAASSSSNASSS.DN.....NG......
    64   64 G R  T 3  S+     0   0   97   86   80  RRRRRRRRRRRRKNRKKKKQQQRRRTKQQQQQHDDYDHHKKRQKKGYDERNDDE.ND.....NN......
    65   65 G A  S <  S-     0   0    0   86   70  CCCCCCCCCCCCCCCCCCCCCSCCCNCSSSSSTSSCSCTSSSSNNNNNNLNNNN.NN.....NN......
    66   66 G E        -     0   0   77   86   55  EEEEEEEEEEEEEEEEEEEEEQEEEQQQQEQQEKQEQQEQQQQNNGGGGLGGGG.QQ.....QQ......
    67   67 G L        +     0   0    1   86    7  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLMMLLLMFLLLM.LL.....LL......
    68   68 G T        +     0   0   62   86   69  TTTTTTTTTTTTTTTTTTTTTTTTTSTIITTTTTTTSATTTTTSSHSAVVVQQV.KQ.....QT......
    69   69 G K  E     -k   45   0B 119   86   78  KKKKKKKKKKKKKKKKKKKKKHSSSSRSSTQHSNETENSSSSSVVTAAASAAAA.SA.....TA......
    70   70 G L  E     -k   46   0B  22   86    7  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTLVVL.LL.....LL......
    71   71 G Q  E     -k   47   0B  85   86   67  QQQQQQQQHQHHQQQQQQQQQQQQQQQKKQQQQQQQQQEQQEQIIDQYNAHLLN.PP.....PP......
    72   72 G V        +     0   0   44   86   72  VVVVVVVVVVVVVKVVVVVVVMTATTVLLTVLTAATATVAAVVAATTTTTTTTT.EI.....AE......
    73   73 G D        +     0   0   76   86   50  DDDDDDDDDDDDDDDDDDDDDDNHNVDAADDEDDDPDDDDDDKDDKGGEFGEEE.gg.....sg......
    74   74 G G  S    S-     0   0   26   85   59  GGGGGGGGGGGGGGGGGGGGGGGEGGGGGGGGAGVEVGAAAGGGGYTPSQAAAS.dd.....dd......
    75   75 G T        -     0   0   56   86   83  TTTTTTTTTTTTMTTTTTTMMTKKKMKSSVMTIKKKKIHKKKTKKRPLPTQAAP.KQ.....QH......
    76   76 G L    >   -     0   0   11   86   14  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLLL.LL.....LL......
    77   77 G P  T 3  S+     0   0   83   86   63  PPPPPPPPPPPPPPPPPPPPPPILIPPPPPPPPPPLPSPPPPPPPPPPPPPPPP.TV.....VV......
    78   78 G V  T 3  S+     0   0   68   86   91  VVVVVVVVVVVVVAVVVVVLLAKKKLRRRLRRSLLKLQSRRQLLLTLSSASSSS.NN.....TN......
    79   79 G L    <   +     0   0    0   86    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL.LL.....LL......
    80   80 G G        +     0   0   14   86   70  GGGGGGGGGGGGGGGGGGGGGEEEEEEEEGEEKEEDEKKEEEDSSLQRRQKKKR.KT.....EQ......
    81   81 G T  E     +de  59 104A  35   86   77  TTTTTTTTTTTTTTTTTTTTTTNTNITTTTTKTTTTTMTVVTQIIQEEEVEEEE.ED.....MK......
    82   82 G L  E     -de  60 105A   1  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    83   83 G D  E     +de  61 106A  27  228   76  DDDDDDDDDDDDDDDDDDDDDDDDDVRDDDDVDEEDEDDNNTIDDNIILDTLLLAHRAENNNRWNNNNNN
    84   84 G L        +     0   0    0  228    8  LLLLLLLLLLLLLLLLLLLLLVLLLILLLLVVIMILILILLILLLLLLLLLLLLLLLLLLLLVLLLLLLL
    85   85 G S        +     0   0    8  228   72  SSSSSSSSSSSSSSSSSSSSSSSSSSASSSSSSPPSPSSAASSSSASSSSSSSSDQNDDDDDNNQDDDDD
    86   86 G H  S    S+     0   0   91  228   82  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHKHHHHHHDDNHHRDHHHRQNRQKHYYDSYYYYYY
    87   87 G N  S    S-     0   0    2  228    1  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    88   88 G Q        +     0   0   71  228   46  QQQQQQQQQQQQKKQKKKKKKNNHNEKKKNRKKNQNQQKKKKKCCSAAAGAAAAQQQQQQQQQQQQQQQQ
    89   89 G L        -     0   0    5  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    90   90 G Q  S    S+     0   0  111  228   46  QQQQQQQQQQQQQQQQQQQQQRKQKKKRRKKKKKKRKKQRRRKKKEEGVQVEEVQQQQEQQQQTQQQQQQ
    91   91 G S  S    S-     0   0   90  228   61  SSSSSSSSSSSSSRSSSSSRRSSSSSSSSRSSTSSSSSSSSSTTTALAAAAAAASRSSSTTTSSTTTTTT
    92   92 G L        -     0   0   14  228    5  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLFLLLLLLLLLLLL
    93   93 G P        -     0   0   14  228   24  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPsppspssspppsssss
    94   94 G L        +     0   0  102  174   55  LLLLLLLLLLLLLLLLLLLFFPSSSFSAAASLSLSSSPFKKSPSSAS.NTVAANlvvvavvvvvlvvvvv
    95   95 G L    >>  +     0   0    1  175   14  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLALELLLLFFFFFFFFFFFFFFFF
    96   96 G G  T 34 S+     0   0    8  179   44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSQLQAEQQQDDDDDDDDDDDDDDDD
    97   97 G Q  T 34 S+     0   0  168  185   66  QQQQQQQQQQQQQQQQQQQQQRWRWQQQQQRQLQQRQRRRRQPHHGGQGpGGGGHKQHQDDDKKQDDDDD
    98   98 G T  T <4 S+     0   0    6   48   63  TTTTTTTTTTTTTTTSSSSAAAAAATAAAAAAAATAT.AAAAAFFL.G.g....................
    99   99 G L    ><  +     0   0    0  175    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLALLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   100  100 G P  T 3  S+     0   0   58  174   71  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP.PPPPPPPPPTVPVTTTTTATTTTT
   101  101 G A  T 3  S+     0   0   37  175   66  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAPAVVAASSNAASAAAASELEEAEEEQQEEEEEE
   102  102 G L    <   +     0   0    0  175    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   103  103 G T        +     0   0   38  175   67  TTTTTTTTTTTTTTTTTTTTTNTTTTVTTTTTNVTTTLSSSATTTTTTITTTTIGEGGKGGGQKKGGGGG
   104  104 G V  E     +ef  81 128A  22  175   83  VVVVVVVVVVVVVIVIIIIIITTTTITTTITITTTITITIITTSSDHRRRHRRRTKETETTTKEQTTTTT
   105  105 G L  E     -ef  82 129A   1  175    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLSLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   106  106 G D  E     +ef  83 130A  30  175   88  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDYDDDDDDDLDDDDDDDDAAAAAAAAGYHGYGGGWGYGGGGG
   107  107 G V        +     0   0    0  175   26  VVVVVVVVVVVVVVVVVVVVVAVVVVVVVVAVVVVVVDVVVVVLLLLVLLVLLLLLLLLLLLLLLLLLLL
   108  108 G S        +     0   0    9  175   74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVSSSSSSSSAASAAAASAYNAGAAAYDQAAAAA
   109  109 G F  S    S+     0   0   84  175   97  FFFFFFFFFFFFFFFFFFFFFFFFFFFYYFFFFFFFFSFFFFYRRFHHYHHHHYYNYNENNNNQTNNNNN
   110  110 G N  S    S-     0   0   14  175    2  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   111  111 G R        +     0   0  117  175   49  RRRRRRRRRRRRRRRQQQQQQEKKKQEEEKEEQKQHQNQEEEQAASNSIKSKKIRQKQRQQQDQQQQQQQ
   112  112 G L        +     0   0    0  175    4  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLQLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLL
   113  113 G T        +     0   0   56  175   72  TTTTTTTTTTTTTTTTTTTTTTGGGAATTTVTTDASTLTTTIAEERTAQQEQQQEKKAQAAAKKKAAAAA
   114  114 G S        -     0   0   69  175   39  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSASLSSSSAASSSSSSTQMNATAANSRSSTSSSSSSSSSSS
   115  115 G L        -     0   0   15  175    4  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLILLLLLL
   116  116 G P        -     0   0   55  175   28  PPPPPPPPPPPPPPPPPPPSSSSSSSSSSSSSSSSSSFPPPSSSSPAAAAAAAAPPPPPPPPPSPPPPPP
   117  117 G L  S    S+     0   0  160  218   79  LLLLLLLLLLLLLLLLLLLPPHPPPPPPPPPPPPPPPSPSSPAPPEPPPPPPPPLEPLALLLSAALLLLL
   118  118 G G  S >  S+     0   0   34  224   21  GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSDNGGGGDDDGGGGGGGEAGAAEGGGGGGGGGGTGGGGG
   119  119 G A  T 3  S+     0   0    4  228   48  AAAAAAAAAAAAAAAAAAAAAAVAVAVAAVTVAAAVAAATTAALLAHAAAAAAAVAIVVVVVIMLVVVVV
   120  120 G L  T >  S+     0   0    6  228    8  LLLLLLLLLLLLLLLLLLLFFLLLLLLLLLLLLLLLLLFLLLLLLFFFFFFFFFFFFFFFFFFFFFFFFF
   121  121 G R  T <  S+     0   0  174  228   41  RRRRRRRRRRRRRRRHHHHHHDDEDNDDDDDSADDDDDDHHEDAAARRRRRRRRDDDDDDDDDDDDDDDD
   122  122 G G  T 3  S+     0   0   42  228   79  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGDIAATAAARKKHSHHHKRRHHHHH
   123  123 G L    X   +     0   0    1  228    5  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVVVVVVVVLLLLLLLLLVLLLLLL
   124  124 G G  T 3   +     0   0   27  227   64  GGGGGGGGGGGGGGGGGGGGGSSGSSSSSSSGSSSSSSSSSTSNNGKPPLPPPPTTTTATTTT.TTTTTT
   125  125 G E  T 3  S+     0   0   81  227   62  EEEEEEEEEEEEEEEKKKKHHRQQQKHGGQHEQQHQHQQRRHQSSNLQLQQQQLQEKQEQQQN.SQQQQQ
   126  126 G L    <   +     0   0    0  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   127  127 G Q        +     0   0   62  228   70  QQQQQQQQQQQQQQQQQQQQQHQEQEQQQQHRHHHQHQHQQHREEEKQQQQQQQDRTDKDDDKQEDDDDD
   128  128 G E  E     +fg 104 152A  46  228   79  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEENNREDDDNDDDKTRKTKKKEEKKKKKK
   129  129 G L  E     -fg 105 153A   2  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   130  130 G Y  E     +fg 106 154A  51  228   82  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYSYSRSYYYYSCYYNNDDDDDDDYDDYGYYYWHYYYYYY
   131  131 G L    >   +     0   0    3  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   132  132 G K  T 3   +     0   0   27  228   82  KKKKKKKKKKKKKKKKKKKKKHQQQQRRRRRRQCRNRRQRRRQGGARRRRRRRRGQDGQGGGRSNGGGGG
   133  133 G G  T 3  S+     0   0   19  228   74  GGGGGGGGGGGGGGGGGGGGGGNNNHGGGGGGGGSNGGDGGGGGGVGGGGGGGGTYRQNGGGNSYGGGGG
   134  134 G N  S <  S-     0   0    6  228    1  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNNNN
   135  135 G E        +     0   0  111  228   45  EEEEEEEEEEEEEEEEEEEEEKDDDKRKKLKKKKRDRHKQQNKKKRRQRAKAARQQQQQQQQKQQQQQQQ
   136  136 G L        +     0   0    0  228    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLLLILLLLLLLLLLL
   137  137 G K        +     0   0  102  228   54  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRRRTKRRQRRERQRRETEKKGKKKQTKKKKKK
   138  138 G T        -     0   0   75  228   54  TTTTTTTTTTTTTTTTTTTTTTSSSTTTTTTTTTSNNATTTTASSGTTTTQTTTSRSSASSSSDSSSSSS
   139  139 G L        -     0   0    5  228    9  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   140  140 G P    >   -     0   0   19  228    8  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   141  141 G P  T 3  S+     0   0  102  228   62  PPPPPPPPPPPPPPPPPPPAAPPPPPPPPPPPPRPPPPPPPPPPPEEQGEQEEGPNPEPSSSNEPSSSSS
   142  142 G G  T >  S+     0   0   38  228   46  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGQRGRGREEEGDDGEEDDEDDDRGKRGGGGGGRGGGGG
   143  143 G L  T <  S+     0   0    8  228   33  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFFLIATVAAATVVIVVVVVVGVVVVVV
   144  144 G L  T >  S+     0   0    6  228    9  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFFFFFFFFFFFFFFFFFFFFFFFF
   145  145 G T  T <  S+     0   0  110  228   51  TTTTTTTMTTTTTTTTTTTMMALMLEAAAAAQAAAVAAAVVAAKKREAAMAMMADDDDDDDDDEDDDDDD
   146  146 G P  T 3  S+     0   0   36  228   70  PPPPPPPPPPPPPPPPPPPPPPPPPTPPPPPPSPPSSSSPPTPAAPGGGGGGGGSHKKRRRRKRSRRRRR
   147  147 G T    X   +     0   0    0  228   46  TTTTTTTTTTTTTTTTTTTTTTTTTTTVVTTVTTTVTTTTTTMAATLLLLLLLLLLLLLLLLLLLLLLLL
   148  148 G P  T 3  S+     0   0   65  228   57  PPPPPPPPPPPPPPPPPPPPPPTTTTPPPTAPSTPTPPSPPSRFFPARRRRRRRSTTTSTTTTVSTTTTT
   149  149 G K  T 3  S+     0   0   93  228   51  KKKKKKKKKKKKKKKKKKKKKRKKKQKQQRQQQRQDQRQHHQQKKKKMAAAVVAKKKKKKKKQNKKKKKK
   150  150 G L    <   +     0   0    0  228    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   151  151 G E        +     0   0   56  228   64  EEEEEEEEEEEEEEEEEEEEERKLKQKRRKREKRKKKKKKKQRQQKQKKKRKKKTTTTTKKKTKTKKKKK
   152  152 G K  E     +gh 128 176A  58  228   88  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKTDDDDEDDDYILLTEEEKEWEEEEE
   153  153 G L  E     -gh 129 177A   0  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   154  154 G S  E     +gh 130 178A   5  228   83  SSSSSSSSSSSSSSSSSSSSSNNSNNNNNSNSNNNNNNNSSNNDDDDDDDDDDDSGYDSWWWYHSRWWWW
   155  155 G L    >   +     0   0    1  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLL
   156  156 G A  T 3   +     0   0    0  228   75  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAASSSSSSSSGGNQSNNNSYDNNNNN
   157  157 G N  T 3  S+     0   0   62  228   75  NNNNNNNNNNNNNNNNNNNNNDNNNNEDDDDDNDEYQNNEEDEKKHDDDDDDDDQEVYTTTTYRATTITT
   158  158 G N  S <  S-     0   0    9  228    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   159  159 G N        +     0   0   75  228   51  NNNNNNNNNNNNDNNHHHHNNKKKKKQKKKRKQKRKQEGDDRQRRQTLLAFAALQQKQQQQQQQQQQQQQ
   160  160 G L        +     0   0    0  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLL
   161  161 G T  S    S+     0   0   57  228   62  TTTTTTTTTTTTTTTTTTTTTNRRRSKSSTTNNETRMDAQQSHEEEEEEEKEEEQHQQQQQQQKQQQQQQ
   162  162 G E        -     0   0  116  228   58  EEEEEEEEEEEEEEEQQQQEEEEEEEEEEEEEEDEEEEEEEEEHHAEKEEEEEESSSSSSSSSASSSSSS
   163  163 G L        -     0   0    8  228   25  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLILLIIIIILLIIIIII
   164  164 G P    >   -     0   0   19  228   10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSSPPPPPPPPPPPPEPPPPPPPPPPPP
   165  165 G A  T 3  S+     0   0   83  228   77  AAAAAAAAAAAAAAAAAAAPPPSPSPPPPPPLPLLPLPPPPPPVVGQRKRKRRKHENAAAAANAAAAAAA
   166  166 G G  T >  S+     0   0   35  228   16  GGGGGGGGGGGGGGGGGGGRRGGGGGGGGGGGGGEGEGGEEGQDDLGEEGEGGEGGGGGGGGGGGGGGGG
   167  167 G L  T <  S+     0   0   11  228   55  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLFLLLLLLLFLLLLLLLLLLLLAVVLAAAAVLAAAAAA
   168  168 G L  T >  S+     0   0   17  228   18  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLFFFFFFFFFFFFFFFF
   169  169 G N  T <  S+     0   0  112  228   35  NNNNNNNNNNNNNNNDDDDNNEDDDNDDDDEDNDDVENNKKHAAAEAQQQQQQQDDHDDDDDDDDDDDDD
   170  170 G G  T 3  S+     0   0   42  228   67  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGEGGGGDDSGDDDDDDDHKNKKKKKNEKKKKKK
   171  171 G L    X   +     0   0    6  222    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   172  172 G E  T 3  S+     0   0  115  227   59  EEEEEEEEEEEEGGEGGGGEEEEEEEEGGDGEEEETEDEEEDGGGR.QEVQVVETAPTATTTATTTTTTT
   173  173 G N  T 3  S+     0   0   91  228   60  NNNNNNNNNNNNNNNNNNNNNEDDDEEEEKEKEEENEDDEEEYNNDERATKTTAKELNNNNNKQRNNNNN
   174  174 G L    <   +     0   0    4  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLPLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   175  175 G D        +     0   0   36  228   61  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNDDDDDHNNNEEEEEEEEEEKKQQQQQTTEQQQQQ
   176  176 G T  E     +hi 152 199A  17  228   48  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTDTTTTTTTTDTETTTTTRLKTTTTT
   177  177 G L  E     -hi 153 200A   2  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   178  178 G L  E     +hi 154 201A  11  228   91  LLLLLLLLLLLLLLLLLLLLLYYYYYYYYYYYFYYHYYFYYYYFFMRWWWWWWWRTYYSSSSDEYSSSSS
   179  179 G L        +     0   0    1  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   180  180 G Q        +     0   0    2  228   75  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQSSSSSSSSNYSQSSSSQQSSSSSS
   181  181 G E  S    S+     0   0   86  228   72  EEEEEEEEEEEEEEEEEEEEEGRGRAGGGGGGSGGGGENKKGRDDEGGGGGGGGENNQTTTTNNETTTTT
   182  182 G N  S    S-     0   0   14  228    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   183  183 G S        +     0   0   33  228   65  SSSSSSSSSSSSSSSSSSSLLWWWWWWWWMWWWWWWWCSRRLWQQRQHLRQRRLKQQEQQQQQQKQQQQQ
   184  184 G L        -     0   0    0  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   185  185 G Y        -     0   0  108  228   70  YYYYYYYYYYYYYYYYYYYRRRRSRYRRRHRRCKRHRRQRRRRSSRRQRRQRRRQKRQQQQQPKQQQQQQ
   186  186 G T        -     0   0   49  228   56  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTNTSTTTTTTTTTTNVVYTTTATAATSSRSSSSSRSSSSSSS
   187  187 G I        -     0   0    3  228   17  IIIIIIIIIIIIIIIIIIIIIIIIIIIVVIVVIIIIIIIIIIILLLLLLLLLLLVVVVVVVVVIVVVVVV
   188  188 G P    >   -     0   0   31  228    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPPPPPPPPPPPPPPPPPPPPPPPP
   189  189 G K  T 3  S+     0   0  182  228   67  KKKKKKKKKKKKKKKKKKKKKKKKKKEKKKKKKKEKEKKTTKNFFNSTNSTSSNHKEHHHHHERHHHHHH
   190  190 G G  T >  S+     0   0   34  228   18  GGGGGGGGGGGGGGGGGGGGGNGGGGGGGGGGGGGGGDGDDGGGGGGDNGDGGNGGGGGGGGGGGGGGGG
   191  191 G F  T <  S+     0   0    2  228   68  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFAAAAAAAAVAAAAAAA
   192  192 G F  T >  S-     0   0    9  228    0  FFFFFFFFFFFFFFLFFFFFFFFFFFFFFFFFFFFFFFFFFLFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   193  193 G G  T <   -     0   0   53  228   39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGKKSPPVPPPPVDDNDDDDDDDDDDDDD
   194  194 G S  T 3  S+     0   0  128  228   74  SSSSSSSSSSSSSSPFFFFDDDTSTKSDDDDNNDETEDDMMANDDSEEDEKEEDRSSRRRRRSNRRRRRR
   195  195 G H    <   -     0   0   48  228   44  HHHHHHHHHHHHHHTHHHHHHLLLLLHHHRLILLRLRSLLLPLHHnegggggggLlllllllllllllll
   196  196 G L        -     0   0  117  228   81  LLLLLLLLLLLLLLSLLLLLLLLLLGLLLLLFLLLLLIFLLMLLLimlilllliKskkkkkknskkkkkk
   197  197 G L        -     0   0    3  228   13  LLLLLLLLLLLLLLCLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLFFFFFFFFLLLLLLLLLLLLLLLL
   198  198 G P  S    S+     0   0   37  228   74  PPPPPPPPPPPPPPLPPPPPPPPPPSPPPPPPPPPPPPPPPSPPPPAAAAMAAAQSTQQQQQNTQQQQQQ
   199  199 G F  E     +i  176   0A  57  228   87  FFFFFFFFFFFFFFLFFFFFFFFFFFFFFYFFFFFFFFFYYFYYYYYYYYYYYYSLWTTTTTTHTTTTTT
   200  200 G A  E     -ij 177 227A   0  228   53  AAAAAAAAAAAAAALAAAAAAAVVVVAAAATTVVAVVAAAATVVVVVVVVVVVVIVIIIIIILIIIIIII
   201  201 G F  E     +i  178   0A   4  228   88  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFTQTLTTTDYRTTTTT
   202  202 G L        +     0   0    0  228    4  LLLLLLLLLLLLLLSLLLLLLLLLLLLLLLLLLLLLLLLFFFLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   203  203 G H        +     0   0   19  228   86  HHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHATTTTTTTYQELLFFFSFTFFFFF
   204  204 G G  S    S+     0   0   11  228   64  GGGGGGGGGGGGGGGGGGGGGGAAASDNNGGNSNDADSSNNDDSSDGEEEEEEEGSKSNGGGINSGGGGG
   205  205 G N        -     0   0    0  228    0  NNNNNNNNNNNNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   206  206 G P        -     0   0   34  228   38  PPPPPPPPPPPPPPPPPPPPPPSTSIPPPPPPLPPTPPLSSPPPPPPPPPPPPPAPPPPQQQPPQQQQQQ
   207  207 G W  B     -l  248   0C   0  227    2  WWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWFFFWWWFFFFF
   208  208 G L        -     0   0   82  227   64  LLLLLLLLLLLLLL LLLLLLSYYYYLSSFSSHFFYFVHSSFINNYRHHRHHHHDDDNDDDDDDDDDDDD
   209  209 G b        +     0   0   25  227    0  CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   210  210 G N  S >  S-     0   0   48  227   58  NNNNNNNNNNNNNN NNNNNNDDDDDDDDDDDDDDDDNDDDDDNNDDDDDDDDDsSSsssssSEssssss
   211  211 G c  G >  S+     0   0   45  224    1  CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCcccccCCcccccc
   212  212 G E  G 3  S+     0   0  125  227   67  EEEEEEEEEEEEEE EEEEEEEEEEEAEEEEEENSESEEGGGDEENDDDDDDDDEnnSTEEEnsEEEEEE
   213  213 G I  G <> S+     0   0    0  226    8  IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIILIIIIIIII.LLILLLLLLLLIiiIIIIIiiITIIII
   214  214 G L  H <> S+     0   0   36  227   29  LLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLRLRLLLLLIQQSARSVHVVSLLLLLLLLLLLLLLLL
   215  215 G Y  H  > S+     0   0   45  227   10  YYYYYYYYYYYYYY YYYYYYYYYYYYYYHYYYYYHYYYYYHLYYYYYYYYYYYYYYYYYYYYYYYYYYY
   216  216 G F  H  > S+     0   0    1  227   10  FFFFFFFFFFFFFF FFFFFFFFFFFFFFFLFFFFLFFFFFFYLLLLLLLLLLLLLLLLLLLLLLLLLLL
   217  217 G R  H  X S+     0   0   61  227   67  RRRRRRRRRRRRRR RRRRRRTRRRRTAAQAARSSLSRRSSSLRRAQRRRQRRRSARSSSSSSKSSSSSS
   218  218 G R  H  X S+     0   0  141  227   67  RRRRRRRRRRRRRR RRRRRRRHNHHRRRRRRRHRHRNHRRHRHHRGDNSTSSNQKNDDQQQKNQQQQQQ
   219  219 G W  H  X S+     0   0   17  227    2  WWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWNWWWWWWWWWWWWWWWWWWWWWWWWWWW
   220  220 G L  H  < S+     0   0    0  226   26  LLLLLLLLLLLLLL LLLLLLLLLLL.LLLLLLLLLLLLLLLWLLLIIIIIIIIILIIIIIIIIIIIIII
   221  221 G Q  H >< S+     0   0   71  226   69  QQQQQQQQQQQQQQ QQQQQQQQQQE.QQKRDQQRQRRNQQRLLLRSRRLQLLRRARRGRRRRVRRRRRR
   222  222 G D  H 3< S+     0   0   92  227   55  DDDDDDDDDDDDDD DDDDDDDEEEKLDDDDRDDDQDDDDDMEEEDDELRKGGLETEEQEEEEQEEEEEE
   223  223 G N  T >< S+     0   0   21  227   37  NNNNNNNNNNNNNN NNNNNNNNNNNQNNNNNNNNNNNNNNNKNNNNNNNNNNNNNKNNNNNKHNNNNNN
   224  224 G A  G X  S+     0   0   28  226   70  AAAAAAAAAAAAAA AAAAAAPAPAPTEEASSKAAPAEPPPSNQQEE EEAEEEQLQAASSSQASSSSSS
   225  225 G E  G 3  S+     0   0  135  226   60  EEEEEEEEEEEEEE EEEEEENNNNSNNNQNDNNDNDQNSSQPGGGF GGDGGGGEGNNNNNGSANNNNN
   226  226 G N  G <  S+     0   0   31  226   67  NNNNNNNNNNNNNN NNNNNNNNRNNNNNNNKNNSNSNNNNSNNNNS SSISSSKRNKKKKKNIKKKKKK
   227  227 G V  B <   +j  200   0A   0  206    8  VVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVAVVVV VVVVVVV VVVVVVVVVVVVVV
   228  228 G Y        -     0   0   27   98   83  YYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY    YYYY                
   229  229 G V        -     0   0   50   94   85  VVVVVVVVVVVVVV VVVVVVLLLLVELLLLLLILLLLLVVLLLLR    WEEQ                
   230  230 G W        -     0   0   90   93   63  WWWWWWWWWWWWWW WWWWWWWWWWWWWWWWFWWWWWWWWWWWWWK    PPPP                
   231  231 G K    >   -     0   0  112   93   77  KKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKKKKKKKEEKEKKD    EEEE                
   232  232 G Q  T 3  S+     0   0  142   85   68  QQQQQQQQQQQQQQ EQEQQQEQEQEEEEEEEEKEQEEEEEEAEEK    RRRR                
   233  233 G G  T 3  S+     0   0   71   79   28  GGGGGGGGGGGGGG GGGGGGGGGGDGGGGGGGGGGGGGDDGGGGG    GGGG                
   234  234 G V    <   -     0   0   66   73   76  VVVVVVVVVVVVVV VVVVVVVVVVMVVVMVVEVAVEMEVVVVVV     LLLL                
   235  235 G D        -     0   0  115   74   48  DDDDDDDDDDDDDD DDDDDDDDDDDDDDDEDDDEDEENDDDDDD     EGGE                
   236  236 G V        +     0   0   33   74   84  VVVVVVVVVVVVVV VVVVVVVVVVVVVVVAAVVNVNVDIIAVVV     EKKK                
   237  237 G K  S    S-     0   0  176   74   65  KKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKKKRKKKKKQKKK     TTTT                
   238  238 G A  S    S+     0   0   83   74   68  AAAAAAAAAAAAAA AAAAAAADADDVAASAAAAAAAAAAAASVV     KKKK                
   239  239 G M        -     0   0   47   74   81  MMMMMMMMMMMMMM MMMMMMMTMTMMTTTTMMMMMMMMMMMMMM     VVVV                
   240  240 G T        -     0   0  124   74   63  TTTTTTTTTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTT     EEEE                
   241  241 G S        -     0   0   21   74   75  SSSSSSSSSSSSSS SSSSSSPPAPSPPPSPPPPPPPPPPPPRPP     VVVV                
   242  242 G N    >   +     0   0   72   72   65  NNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNKNNNNSDDNDDD     AAAA                
   243  243 G V  G >  S+     0   0   15   72   26  VVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVLVV     PPPP                
   244  244 G A  G 3  S+     0   0   33   72   75  AAAAAAAAAAAAAA AAAATTQAAATRDDTDEDEKAEASKKEDKK     EEEE                
   245  245 G S  G <  S+     0   0    9   72   56  SSSSSSSSSSSSSS SSSSSSSSSSSSSSTSSSSSSSSSSSSSSS     KKKK                
   246  246 G V  S <  S-     0   0    0   73   57  VVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVV     VVVV                
   247  247 G Q  B >   -M  255   0D  21   73   73  QQQQQQQQQQQQQQ QQQQQQRRRRQRRRRRRLQRRRQQRRQRQQ     LLLL                
   248  248 G b  B >  S-l  207   0C  11   64   50  CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC     CCCC                
   249  249 G D  T 3  S-     0   0  108   64   79  DDDDDDDDDDDDDD DDDDDDVAAASSVVSVVVVVGVAAVVDGEE     HQQH                
   250  250 G N  T <  S+     0   0   76   64   50  NNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNHNVV     SSSS                
   251  251 G S    X   -     0   0   50   64   81  SSSSSSSSSSSSSS SSSSSSLLLLLSVVIWLLIMLTLLMMPLPP     PPPP                
   252  252 G D  T 3  S+     0   0  122   64   78  DDDDDDDDDDDDDD DDDDEEADGDNDAAHKAGPAGGSANNHHKK     SSSP                
   253  253 G K  T 3  S+     0   0  168   64   67  KKKKKKKKKKKKKK KKKKKKNNNNKpNNDNNNDTSTDNGGNNGG     EEEE                
   254  254 G F    <   -     0   0  128   49   88  FFFFFFFFFFFFIV TTTTIITAAATeTTMVTIT.A.VVMMMTTT     ...                 
   255  255 G P  B >   -M  247   0D  20   56   61  PPPPPPPPPPPPPP PPPPSSPPPPPFPPPPPPSPPTPPYYAPPP     .HH                 
   256  256 G V  G >  S+     0   0    0   58   28  VVVVVVVVVVVVVV VVVVIIVVVVVVVVVVVIVVVVVVVVVVVV     .LL                 
   257  257 G Y  G 3  S+     0   0   61   55   48  YYYYYYYYYYYYYY YYYYYYYYYYYYHHYHYYFSYSYYYYSHYY     .                   
   258  258 G K  G <  S+     0   0  135   57   77  KKKKKKKKEEEEKK RKRKKKTSSSNTTTTTTTADTDTTNNAASS     .                   
   259  259 G Y    <   -     0   0   43   58   59  YYYYYYYYYYYYYY YYYYYYYYYYYYYYFYYYYYYYYYFFYYFF     H                   
   260  260 G P        -     0   0   85   58   81  PPPPPPPPPPPPPP PPPPPPPPPPTKQQSQPPSVPVEPLLMPSS     R                   
   261  261 G G    >   -     0   0    9   58   50  GGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGAA     Q                   
   262  262 G K  T 3  S+     0   0  186   58   61  KKKKKKKKKKKKKK KKKKKKKKKKEEKKKKKKEKKKKKDDKKNN     K                   
   263  263 G G  T 3  S+     0   0   78   55   44  GGGGGGGGGGGGGG GGGGEEGGGGNGGGDDGDGDDDGEGSGG                           
   264  264 G c    <   -     0   0   31   55   26  CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCC                           
   265  265 G P              0   0  109   55   26  PPPPPPPPPPPPPP PPPPPPPPPPPPPPPPPPSGPGASNNTP                           
   266  266 G T              0   0  193   52   34  TTTTTTTTTTTTTT TTTTTTTTTTPTSSTSSTPP PTA  AP                           
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 G H              0   0  111   43   47                                                             D          
     2    2 G P        +     0   0  121   97   60       GGG            GGG  GG G                 G GGGGGGGGG  D   GG     
     3    3 G I  S    S+     0   0   77  201   59  TTTTTVVV A TTTTVVVVVVVVVVVVVVVAAA TTTTTTTTTTVVVVVVVVVVVVVTIIAA VV   TT
     4    4 G a  S    S-     0   0    6  220    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
     5    5 G E  E     -A   16   0A 118  220   58  eeeeeSSSPPPeeeeSSSSSSSSSSSSSSSPPPPeeeeeeeeeeSSSSSSSSSSSSSSttPPPTTPPPee
     6    6 G V  E     -A   15   0A  44  163   74  ccccc...SSAcccc...............SSSAcccccccccc.............SnnSSS..SAAcc
     7    7 G S  E     +A   14   0A  56  163   71  TTTTT...RQQTTTT...............QQQQTTTTTTTTTT.............AKKQQR..RQQTT
     8    8 G K        +     0   0  155  221   68  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCTTTCCCCCCCCCC
     9    9 G V  S >  S-     0   0  103  221   67  NNNNNNNNSSSNNNNNNNNNNNNNNNNNNNSSSSNNNNNNNNNNNNNNNNNNNNNNNTDDSSSNNSSSNN
    10   10 G A  T 3  S+     0   0  100  221   74  EEEEENNNCCCEEEENNNNNNNNNNNNNNNCCCCEEEEEEEEEENNNNNNNNNNNNNSSSCCCDDCCCEE
    11   11 G S  T 3  S-     0   0   95  221   57  GGGGGNNNRDSGGGENNNNNNNNNNNNNNNPTDDGGGGGGGGGGNNNNNNNNNNNNNSSSDSSQQSSSGG
    12   12 G H    <   -     0   0   68  221   64  KKKKKKKKGQGKKKKKKKKKKKKKKKKKKKGGQQKKKKKKKKKKKKKKKKKKKKKKKPPPQGGTTGGGKK
    13   13 G L        -     0   0   28  221   82  KKKKKNNNTTTKKKKNNNNNNNNNNNNNNNTATTKKKKKKKKKKNNNNNNNNNNNNNEEETATKKTATKK
    14   14 G E  E     -Ab   7  35A  65  222   52  EEEEESSSGTQEEEESSSSSSSSSSSSSSSDSTIEEEEEEEEEESSSSSSSSSSSSSTTTTETNNESEEE
    15   15 G V  E     -Ab   6  36A   0  224    8  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVIVVVV
    16   16 G N  E     +Ab   5  37A  59  224   36  NDDDDDDDYDDNNNNDDDDDDDDDDDDDDDNEYYDDNNNNNNNDDDDDDDDDDDDDDDDDDRSDDRENNN
    17   17 G a    >   +     0   0    0  224    2  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    18   18 G D  T 3   +     0   0   34  223   71  QQQQQSSSNNDQQQQSSSSSSSSSASSSSSHQHQQQQQQQQQQQSSSSSSSSSSSSSSSSWVGSSIQWQQ
    19   19 G K  T 3  S+     0   0  148  223   75  YGGGGSSGQSRYYYSSSSSYYYNNDSYGSYESSSSSSYYSYSYGSSSSSYYSSSNSSHSSNSSSSSSNSY
    20   20 G R  S <  S-     0   0   81  224   36  KKKKKKKKERRKKKKKKKKKKKKKKKKKKKRRRKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRKKKRKKK
    21   21 G N        +     0   0  130  224   72  GSSSGRRMSSSGGGGRRRRKKKKKKRKMRKRRRRSDDGGDGGGSRRRRRKKRRRKRRKKKRSSEEGSGGG
    22   22 G L        -     0   0   25  224    3  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLLLLFILL
    23   23 G T  S    S+     0   0   98  224   64  KDDDDTTTTAAKKKQTTTTTTTTTTTTTTTATTTDTTKKTKQKDTTTTTTTTTTTTTTTTSATTTTAAQQ
    24   24 G A  S    S-     0   0   55  224   41  ASSSSAAASSSAAAAAAAAAAAAAAAAAAASSSSSSSAASAAASAAAAAAAAAAAAAAAASSSAASSSAA
    25   25 G L        -     0   0   28  225   30  VVVVVIIIVVVVVVVIIIIMIIIIIIMIIIVVVVVVVVVVVIVVIIIIIIIIIMIIIVVVVVVIIVVVIV
    26   26 G P        -     0   0    5  226    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
    27   27 G P  S    S+     0   0  124  226   64  SSSSSSSISAASSSPSSSSISSSISSSSISAAAASPSSSPSPSSSISSSSSSSISSSTTTAASIITAAPP
    28   28 G D        +     0   0   47  226   48  GGGGGNNNGGGEEEGNNNNNNNNNNNNNNNEGGGGGGEEGGGEGNNNNNNNNNNNNNGGGGGGNNGGGGG
    29   29 G L        -     0   0    9  226   22  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
    30   30 G P    >   -     0   0   15  226    9  PPPPPPPPSLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
    31   31 G K  T 3  S+     0   0  118  226   64  AAAAAAVVSFTAAAAVVAVVAVATPPALTATTTSAAAAAPATAAATVVAAAVVVAVTAAATISAASTTVA
    32   32 G D  T 3  S+     0   0   74  227   26  DDDDDDDDRTNDDDDDEDDDDEDDDDDEDDTNTNDDDDDDDDDDDDEEDDDEEDDDDNSSTTSDDSTTDD
    33   33 G T    <   +     0   0    2  227   12  TTTTTTTTTTATTTTTTTTTTTTTTTTTTTTVTKTTTTTTTTTTTTTTTTTTTTTTTTTTTTATTTTTTT
    34   34 G T        +     0   0   19  227   69  EEEEEKEDTQQTTEKDTKDDKTKETTKTEKKQRQETETKTTTEEKETTKKKTTDKDEEEEQQTDDTRQSK
    35   35 G I  E     -bc  14  59A   8  227   85  KKKKKKNRVVINNKSREKRRKEKNQQKQNKIIWYKNKKSSKNKKKNEEKKKEERKRNRKKVSVRRIETMS
    36   36 G L  E     -bc  15  60A   3  227    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    37   37 G H  E     +bc  16  61A  30  227   82  DDDDDLKLYGQNDDDDREVVERVKRREYKEREHADNDDDDVDDDVKRRVVERRVEDKEEEGSHLLQRHRD
    38   38 G L    >   +     0   0    0  227    3  LLLLLLLLLLLFLLLLLLLLLLLLLLLLLLLLLLLFLLLFLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    39   39 G S  T 3   +     0   0    2  227   75  QQQQQGDGDSQQKNKQEDNQDGNDHHDNNDYYHQQQQKKRMKQQNDQENNDENQDKNQDDSHHGGQYYDK
    40   40 G E  T 3  S+     0   0   73  227   92  SSSSSSYRNSVYLSYSFYYGYLYYQQYLYYRDRDSYSLYFSLSSYYFFYYYFFGYYYYYYSYASSGTRYY
    41   41 G N  S <  S-     0   0    4  227   23  TTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNTNNNTNTTNNNNNNNNNNNNNNNNNTNNNNNNNN
    42   42 G L        +     0   0   61  227   83  GGGGGKKKKQQSSSAKSKKKKSKKSSKSKKQQQQGSGSASGSGGKKSSKKKSSKKKKQQQQQKKKKQQQA
    43   43 G L        +     0   0    1  227   10  LLLLLLLLLIILFLFLLLLLLLLLLLLLLLIILILLLFFFLFLLLLLLLLLLLLLLLLLLIILLLLIIFF
    44   44 G Y  S    S+     0   0  123  227   82  AAAAASSSQTTVTATSSSSSSSRSSSSSRSTTTTAVATTAKTTARSSSSRSSSSSSRAEETTQSSQTTTT
    45   45 G T  E    S+k   69   0B  58  227   71  TTTTTSSSSKKQQTQSKSSSSKESKKSKESKKKKTQTQQQHQTTESKKKESKKSSSENRRKKSSSSKKTQ
    46   46 G F  E     -k   70   0B   8  227   19  LLLLLLLLILPLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLIIILLLLLLLLLL
    47   47 G S  E >   -k   71   0B  19  227   49  SSSSSPPPPEESPSSPSPPPPSEPSSSSEPEEEESSSPSPSPSSEPSSSEPSSPPPETDDEEPSSPEEDP
    48   48 G L  G >  S+     0   0    1  227   88  DDDDDRRRSPPSSDSHPPRNNPPGPPAPPRLPPPDSDSSFSFDDPGPPPPNPPRNDPAAAPPHAASPLAS
    49   49 G A  G >  S+     0   0   30  227   71  TAAAAMMMGGGNDTNTTKMTTTTMTKKTTMGGGAANTDNNTNTTKMTTTTMTKMTTTKKKGGGKKGGGSD
    50   50 G T  G <  S+     0   0   63  227   52  ATTTTAAAVVVAAAAAAAAAAVAAAAAVAAVVVVTAAAAAAAAAAAAVVAAAAAAAAAAAVVVAAVVVAA
    51   51 G L  G X  S+     0   0    0  227   12  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
    52   52 G M  T <  S+     0   0   88  228   78  RRRRRHHHDDDQKHQHHHHHHHHHHHHHHHDNDDRQRKQQAQHRHHHHHHHHHHHHHHRRDDDHHDDDRK
    53   53 G P  T 3  S+     0   0   64  228   67  GGGGGGGGKSSGGGGNSHGNNNGGNHSRGGSSSSGGGGGGHGGGHGHRRSGGRGSGGGGGRSKSSKSSDG
    54   54 G Y    X   +     0   0   18  228   17  LLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLMMLLLLLLLLLLLLL
    55   55 G T  T 3  S+     0   0   99  228   52  TTTTTNKNTTVTTRTKSSNNNNKKKSSTKKAATTTTTTTTKTRTSQSTTSSKTQSKKTPPTVTSSTTART
    56   56 G R  T 3  S+     0   0  142  228   62  KKKKKKEKQQNKAEKEKKKKKKEEEKKKEENAQQKKKAKKQKEKKSKKKKKEKSSEERHHQNQSSQKQQA
    57   57 G L    <   +     0   0    6  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    58   58 G T        +     0   0   61  228   34  TTTTTTTTTTQTTTTTTTTTTTTTTTTRTTETTTTTTTTTQTTTTTTRRTTTRTTTTTTTTQKTTKTTTT
    59   59 G Q  E     -cd  35  81A  56  228   86  WWWWWNyIHTQFWWWYYYNFFFYYYYLLYYEEYNWFWWWFRFWWYFYLLYLYLYYYYYFFRRQFFEYQWW
    60   60 G L  E     -cd  36  82A   0   86    1  .....LlLLLL..............L..L.LL............................LLLLL.....
    61   61 G N  E     +cd  37  83A  17   86   77  .....DRSEYH..............S..D.HK............................DHYDD.....
    62   62 G L    >   +     0   0    1   86    6  .....LLLLLL..............L..L.LL............................LLLLL.....
    63   63 G D  T 3   +     0   0   11   86   68  .....QDDDSE..............G..D.YH............................YDYSS.....
    64   64 G R  T 3  S+     0   0   97   86   80  .....WRNRNS..............E..G.DS............................NQQYY.....
    65   65 G A  S <  S-     0   0    0   86   70  .....NNNNNN..............N..N.NN............................NNNNN.....
    66   66 G E        -     0   0   77   86   55  .....KQQQQR..............Q..K.QK............................QQQQQ.....
    67   67 G L        +     0   0    1   86    7  .....LLLXLI..............L..L.LL............................LLPLL.....
    68   68 G T        +     0   0   62   86   69  .....QTQKTG..............Q..Q.TK............................TVQQQ.....
    69   69 G K  E     -k   45   0B 119   86   78  .....TSTSAL..............T..T.SD............................VSSTT.....
    70   70 G L  E     -k   46   0B  22   86    7  .....LLLLLL..............L..L.LI............................LLLLL.....
    71   71 G Q  E     -k   47   0B  85   86   67  .....PPPPPP..............P..P.PP............................PPPPP.....
    72   72 G V        +     0   0   44   86   72  .....APAMAG..............P..A.AS............................AANVV.....
    73   73 G D        +     0   0   76   86   50  .....sgsggg..............g..g.gg............................ggggg.....
    74   74 G G  S    S-     0   0   26   85   59  .....dddddd..............d..n.nh............................ddddd.....
    75   75 G T        -     0   0   56   86   83  .....QKQKKK..............H..H.RK............................RRKHH.....
    76   76 G L    >   -     0   0   11   86   14  .....LLLLLL..............L..L.LL............................LLLLL.....
    77   77 G P  T 3  S+     0   0   83   86   63  .....VTVTTT..............V..V.VT............................GTTVV.....
    78   78 G V  T 3  S+     0   0   68   86   91  .....TKTKEQ..............E..E.NQ............................NQQNN.....
    79   79 G L    <   +     0   0    0   86    0  .....LLLLLL..............L..L.LL............................LLLLL.....
    80   80 G G        +     0   0   14   86   70  .....ETETTT..............D..D.QT............................QTKDD.....
    81   81 G T  E     +de  59 104A  35   86   77  .....MRMYIY..............E..R.KY............................RYDKK.....
    82   82 G L  E     -de  60 105A   1  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    83   83 G D  E     +de  61 106A  27  228   76  NNNNNRDREDSASNNNSSDDDSDNNYNYDDHSTNAANSANENNNSDSYYSSGYSSGGTSSHNRYYHHDGS
    84   84 G L        +     0   0    0  228    8  LLLLLVLVLLLLVLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLV
    85   85 G S        +     0   0    8  228   72  DDDDDNDNYRRDSEEDTSQGEGDDDNQNNGYSRHNDQSEEDPEQSSGNNTQENSFEEENNHGHGRYGSDS
    86   86 G H  S    S+     0   0   91  228   82  YYYYYDRDSTDYNYDTGTWYSNGTTQGDSGQDNTNQYNYYKGNYTYEDDGGGDYNGGQNNQGQQQTAHSN
    87   87 G N  S    S-     0   0    2  228    1  NNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    88   88 G Q        +     0   0   71  228   46  QQQQQQQQQQQQEQQQQQKEQQQKQQKQKQQQQQQQQEQQQQQQQQKQKKKRQDKKRKQQQQQQQQQQRE
    89   89 G L        -     0   0    5  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLFLL
    90   90 G Q  S    S+     0   0  111  228   46  QQQQQQQKQQTQKQQQQQQPQQQQQQQQHQSSTTQQQKQQEQQQQQQQQQQQQKQQQQQQATQRRKTTQK
    91   91 G S  S    S-     0   0   90  228   61  TTTTTSSSSAATFTATTTTTTTATTSTTSTASAASSTFTTSTTTSTTTAAATTTTTTSTTFASSSSAASF
    92   92 G L        -     0   0   14  228    5  LLLLLLLLLLLLVLLLLLLLLLLLLLLLLLLILLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLV
    93   93 G P        -     0   0   14  228   24  sssssppppppspPtpppppppppppptppppppSSppPsPPspppppppppppppppppppppppppPp
    94   94 G L        +     0   0  102  174   55  vvvvvvvvivvvl.ivivvvvvvivvvvvvvvlv..vl.v..vvvvvvvvvvvvvvvvllvvvvvvvv.l
    95   95 G L    >>  +     0   0    1  175   14  FFFFFFFFFFFFF.FFFFFFFFFFFFFFFFFFFF..FF.F..FFFFFFFFFFFFFFFFFFFFFFFFFF.F
    96   96 G G  T 34 S+     0   0    8  179   44  DDDDDDDDDDDDD.HDKDDDDDDKDDDDDDDDDD..ND.D.ADNDDDDDDDDDDDDDDDDDDDDDDAD.D
    97   97 G Q  T 34 S+     0   0  168  185   66  DDDDDKKHKSRDQ.PHEQQQQHQEHKQHKHRSSR..PQED.DDLHHHQQQQQQEQQHQQQRKKSSKKR.Q
    98   98 G T  T <4 S+     0   0    6   48   63  ......................................................................
    99   99 G L    ><  +     0   0    0  175    2  LLLLLLLLLLLLL.LLLLLLLLLLLLLLLLLLLL..LL.L..LLLLLLLLLLLLLLLLLLLLLLLLLL.L
   100  100 G P  T 3  S+     0   0   58  174   71  TTTTTTTTTVVTA.TVKVVVKVVKVTVVTVVMTV..TV.T..TTVVVKKVKVVKVVVTAAVTTTTTTV.A
   101  101 G A  T 3  S+     0   0   37  175   66  EEEEESEKKNNEE.EANNEENSENAKNAKNNQQN..EE.E..EEAAANNNNNENENNEEENQEKKQRN.E
   102  102 G L    <   +     0   0    0  175    1  LLLLLLLLLLLLL.LLLLLLLLLLLLLLLLLLLL..LL.L..LLLLLLLLLLLLLLLLLLLLILLLLL.L
   103  103 G T        +     0   0   38  175   67  GGGGGTRTTMKGK.RGETDDEDDEGTTDTDETTQ..KK.G..GKGGGEETENDEDNNGKKQTTTTTKQ.K
   104  104 G V  E     +ef  81 128A  22  175   83  TTTTTETIYEETQ.TTTDERTKETTRDIIKHYYK..TQ.T..TTTTTTTDTKETRKETQQSIYYYKHQ.Q
   105  105 G L  E     -ef  82 129A   1  175    1  LLLLLLLLLLLLL.LLLLLLLLLLLLLLLLLLLL..LL.L..LLLLLLLLLLLLLLLLLLLLLLLLLL.L
   106  106 G D  E     +ef  83 130A  30  175   88  GGGGGYEGESRGY.SHWRYEWVYWHNRGWYGDDD..GY.G..GGNNNWWRWYYWEYRWYYVSNTTYGW.Y
   107  107 G V        +     0   0    0  175   26  LLLLLLMLLFLLL.FLVLLLLLLVLLLLLLLLLL..LL.L..LLLLLLLLLLLILLLLLLLLLLLLLL.L
   108  108 G S        +     0   0    9  175   74  AAAAAYSGYQYAQ.ANTYNGSSNTNYHNNNCAAN..QQ.A..ANNNNSSNSHYQGNGSQQNYRSSHDN.Q
   109  109 G F  S    S+     0   0   84  175   97  NNNNNTNYSISNT.RNDQKREDRDNNQNSKCVPN..NT.N..NSNNREEREEQQRKTNSSIDSEEYGN.T
   110  110 G N  S    S-     0   0   14  175    2  NNNNNNNNNNNNN.NNNNNNNNNNNNNNNNNNNN..NN.N..NNNNNNNNNNNNNNNNNNNNNNNNNN.N
   111  111 G R        +     0   0  117  175   49  QQQQQKQEQQQQQ.QQQQQQQQDKQQQQKQKQQQ..QQ.Q..QAQQQQQQQKQQQQQQQQQQQQQQQQ.Q
   112  112 G L        +     0   0    0  175    4  LLLLLLLLLLLLL.VLLLLLLLLLLLLLLLLLLL..IL.L..LLLLLLLLLLLLLLLLLLLLLLLLLL.L
   113  113 G T        +     0   0   56  175   72  AAAAAQQQQQTAK.SQQTKKQQKQQQTQHQTTTT..GK.A..STQQEQQTQQTQEETKKKTSQQQQKT.K
   114  114 G S        -     0   0   69  175   39  SSSSSSSSSAASS.ASTSSSSSSSSSSSSSEAAA..AS.S..AVSSSSSSSSSSSSSSSSTASSSSSS.S
   115  115 G L        -     0   0   15  175    4  LLLLLLLLLLLLL.LLLLLLLLLLLLLLLLLLLL..LL.L..LLLLLLLLLLLLLLLLLLVLLLLLIL.L
   116  116 G P        -     0   0   55  175   28  PPPPPPPPPPPPP.PPPPPPPPPPSPPPPPPPPP..PP.P..PPPPPPPPPPPPPPPPPPPPPPPPPP.P
   117  117 G L  S    S+     0   0  160  218   79  LLLLLHDKSAALAPTDVPPSGKSIDNPVNNSVVAPPLS.LS.LPNNQINPIDPNRPPSSSTASHHSAAAS
   118  118 G G  S >  S+     0   0   34  224   21  GGGGGGGGGGGGTGGGGGKGGGGGGGGGGGGGGGGGGTGGG.GGGGGGGGGGGGGGGGGGGGGGGGGGGT
   119  119 G A  T 3  S+     0   0    4  228   48  VVVVVVVVVVLVLVVVVIIIIVIVVVIVVVVVVLLLVLVVAVVVVVIVVIVVIVIVIVVVVVVVVVVVLL
   120  120 G L  T >  S+     0   0    6  228    8  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   121  121 G R  T <  S+     0   0  174  228   41  DDDDDDDDDDDDDDDDDDDDDDDDEDDDDDDDDDDDDDDDDNDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   122  122 G G  T 3  S+     0   0   42  228   79  HHHHHKKKKRRRRHRKHKKKKKKQKKKHKKKSQCDQRRHRQLHRKKKQKKQKHEKHKRSSRRKQQKCKQH
   123  123 G L    X   +     0   0    1  228    5  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   124  124 G G  T 3   +     0   0   27  227   64  TTTTTTSTTVVTTTITVTTTTTTVTTTVTTTTTTTRTTTTVTTITTTVTTVTVTTTTTTTVVTNNSTTAT
   125  125 G E  T 3  S+     0   0   81  227   62  QQQQQEQSKNNQSENQNKKKKQKNQLKNKKQQQQEESSEQAEQNQQKNQKNSNQKKKKKKNNQDDQQQEQ
   126  126 G L    <   +     0   0    0  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   127  127 G Q        +     0   0   62  228   70  DDDDDKQKTQKDEKDKDTTTTQTATETDTTKTTTGKEDKDKKDDTKSTKTATDKSTTTTTEQRKKTTTKD
   128  128 G E  E     +fg 104 152A  46  228   79  KKKKKTKEVKIKKNKDKRLDIKDEHKRKKVEYRFTDKKNKETKKTDIDERELKEIIRLIIVKETTKFVQK
   129  129 G L  E     -fg 105 153A   2  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLL
   130  130 G Y  E     +fg 106 154A  51  228   82  YYYYYSYRGYRYYYYRYDYRYWRRAYDYSGGTSSGYYYYYYGYYYRQRWDRSYYQGDQHHGYWDDDSNYY
   131  131 G L    >   +     0   0    3  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   132  132 G K  T 3   +     0   0   27  228   82  GGGGGYHFQWDGNAAYHDYTHHNDNEDRSGDRHHAGTTAGGKGNHYSNDDYHNWSGDSNNCGSQQSHRQG
   133  133 G G  T 3  S+     0   0   19  228   74  GGGGGNENTGYTLGQQQRESNNSRENRQQPQNTTNSYYGTEGGMQQYRNRRTKGEERNYYCETQQYTHYG
   134  134 G N  S <  S-     0   0    6  228    1  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   135  135 G E        +     0   0  111  228   45  QQQQQQQQQQKQQQQQQQKKKKKQQQQQQQQQKRQQQQQQQMQQKQKQKQQQQKKEQQQQKQQQQQRQQQ
   136  136 G L        +     0   0    0  228    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLILLLLLLLLLLLLLLLLLLLLLLLLLLI
   137  137 G K        +     0   0  102  228   54  KKKKKKQKKTQKKKKTTQQKQQQKQEEKQQKTTQKKKKKTKLTKQQQETETKEQQQEQQQTSLKKQQQKT
   138  138 G T        -     0   0   75  228   54  SSSSSRRRSAESSSSSSSSSSSSSSRRSSSSAATSSSSSSSVSSSSSSSSSSSSSSSSSSKASSSSTFSS
   139  139 G L        -     0   0    5  228    9  LLLLLVLVLLILLLLLLLLLLLLLLLLLLLILLLLLLLLILLLLLLLLLLLLLLLLLIIILLLLLLLVLL
   140  140 G P    >   -     0   0   19  228    8  PPPPPPPPPPPPPLPPPPPPPPPPPPPPPPSPPPPPPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPPTPR
   141  141 G P  T 3  S+     0   0  102  228   62  SSSSSENEKEPPPPPPPNHPDSHSNNNPPNAEEAPPPPPPPPPPDIHKPQPPQDHHQAEESVSPPHAVSP
   142  142 G G  T >  S+     0   0   38  228   46  GGGGGGGGGGTARGRRGGGRGGGGGGGKGGGGGGGRRRGRGGGRGGGGRGGGGGGGGGGGGGGKKGGGGR
   143  143 G L  T <  S+     0   0    8  228   33  VVVVVAVVVVLVVVVVIVVVVIVIVVVIIVVVVVVVVVVVVVVVVVVVVIIVIVVVIAIIVVIIIVVVVV
   144  144 G L  T >  S+     0   0    6  228    9  FFFVFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   145  145 G T  T <  S+     0   0  110  228   51  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNNDDNDDEDEDD
   146  146 G P  T 3  S+     0   0   36  228   70  RRRRRKKKKRRSRSSSKKKSKKKKKNKKKKRSRKSSSSSKQRSRKQKKKKKSKKKKKKKKKSNKKKKRRR
   147  147 G T    X   +     0   0    0  228   46  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLQLLLLLLL
   148  148 G P  T 3  S+     0   0   65  228   57  TTTTTTTTTVTTTTTTTTTTTTTTTATTTTSVVSTTTSTTTSTTTVTTTTTTTTTTTTAATTITTTSVTT
   149  149 G K  T 3  S+     0   0   93  228   51  KKKKKESNQNQQKKKKKSEKQKEKQKKKKQNNHQKKKKKKKKKKSNNKKKKKKSELKRSSRQHKKKQSKK
   150  150 G L    <   +     0   0    0  228    2  LLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLILLLILLLLLLLLLLLLL
   151  151 G E        +     0   0   56  228   64  KKKKKKNKTQTTKTTTTTKTTTKTTTTTTTQQKTTTTTTTTTTTTAKTTTTTTTKETEQQKTTTTTTRTT
   152  152 G K  E     +gh 128 176A  58  228   88  EEEEETDEKQILELLYDHEWIDTDTRNLDIEQELLYYWRVWWRYLEERIDIYYLTKNKTTQGRLLKLERY
   153  153 G L  E     -gh 129 177A   0  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLXLLLLLLLLLLLLLLLLLLLLLLLLL
   154  154 G S  E     +gh 130 178A   5  228   83  WWRRRRRWNYEQWTTSQASSHRSRYDDYQHYHFANSTSDWSNDSSRWDGRWTDAYYDYYYGDNYYDAYDS
   155  155 G L    >   +     0   0    1  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   156  156 G A  T 3   +     0   0    0  228   75  NNNNNDHREHDNNEEYFNQGYRNNRQNDFYCYCDGNSDDNSNDSRYRDDSDSDNYESDSSDNDYYYDGNS
   157  157 G N  T 3  S+     0   0   62  228   75  TTTTTNNNNLNITRNNQQYYNENSNNNDQNCQCETTQANNNTQETRNYNSNQNQNNGRNNRRVNNNEDTE
   158  158 G N  S <  S-     0   0    9  228    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   159  159 G N        +     0   0   75  228   51  QQQQQQQKKRQQQEQKKKQKKQQKQQKKKKKQKKQQQQQQQQQQQQKQKKKKKQQQKQQQQQQQQQKKQQ
   160  160 G L        +     0   0    0  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLL
   161  161 G T  S    S+     0   0   57  228   62  QQQQQKHHQSKQQQQQHQKHQQQHQPHQQQTSTTQQQQQQQQQQKTQKQQQQQQKKQQQQTQNQQQTTQQ
   162  162 G E        -     0   0  116  228   58  SSSSSRSSSSSSSSSSSSRSARRSSRSSSSEAEASSSSSSSSSSRSSSSSSRSSRRSSSSSASSSSAESS
   163  163 G L        -     0   0    8  228   25  IIIIIVLLLILIIIILLLVLLLLLVVLLLLLLLLIIIIIIIIIIVLLLLLLLLLVVLVIIVLLLLLLLII
   164  164 G P    >   -     0   0   19  228   10  PPPPPPPPPPLPEPPPPPPPPPPPPPPPPPPPPPPEPPPPPEPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   165  165 G A  T 3  S+     0   0   83  228   77  AAAAAEEEHAPEAEIHEHEEDEHEHEEHHNRPRNAAEISAEAKEEPESENDDEPEEHDEEATFKKSNAKA
   166  166 G G  T >  S+     0   0   35  228   16  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGKGGGGGGGGGRGGGGGGGGGGGGGGGG
   167  167 G L  T <  S+     0   0   11  228   55  AAAAAAVVVVIILAAVVVAVLVVVVVVVVVIVIVVLAAAVILVVAIVVVVVVVVVAVVIIVVVVVVVVAA
   168  168 G L  T >  S+     0   0   17  228   18  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFEFEFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFGFF
   169  169 G N  T <  S+     0   0  112  228   35  DDDDDDDDDDDKDDDDDDDDDDDDDDDDDDRDRDDDDDDDNDDDDDDDDDDDDDDDDDKKDDDDDDDKDD
   170  170 G G  T 3  S+     0   0   42  228   67  KKKKKKKKKKKTKKKKKKKKKKKKNkKKkKLRLKKKKKKKKKRKKKKKKKKKNSKKKKTTRNNKKKKLMK
   171  171 G L    X   +     0   0    6  222    1  LLLLLLLLLLLLLLLLLLLLLLLLLlLLlL.L.LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL.LL
   172  172 G E  T 3  S+     0   0  115  227   59  TTTTTTTATTGTTVRTATTATTTAATATTTTVTTTTTRTTATTTTTTTTTTTATATTGTTGTLTTTTTRT
   173  173 G N  T 3  S+     0   0   91  228   60  NNNNNEEEQQKNNNNEEQEEEEEEKEEENEHNHQNNNNNNSNNQEQQLEQLLKKEEESNNNQKEEQQTNN
   174  174 G L    <   +     0   0    4  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   175  175 G D        +     0   0   36  228   61  QQQQQKKKTTTQQEQKKKKKKKKKTKKKKKTQTTNQQQQQQQQQKTKERGEETTKKKEQQQSDKKKTTQQ
   176  176 G T  E     +hi 152 199A  17  228   48  TTTTTTTTLNHTTTTETTTTTTETRTTTETHTHIRTTTTTTTEQTLTKTTKKRYTTTRTTKIKTTEIHTT
   177  177 G L  E     -hi 153 200A   2  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   178  178 G L  E     +hi 154 201A  11  228   91  SSSSSRTDWYDYAWNSDERHYNYYEYDYWSADAGDDENYNYDRYRWQYEYYYESDRSDYYWNVEESGGHS
   179  179 G L        +     0   0    1  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLMLLLLLLLLLLLLMLLLLLLLL
   180  180 G Q        +     0   0    2  228   75  SSSSSDNRHHHSDRYDQFDLREQSQSQQQLDHDRDQRRYQSQYDDHTNRNNESQRDQESSHHLGGRRDYS
   181  181 G E  S    S+     0   0   86  228   72  TTTTTNNYRNKTNEQRNNNNNIIYRNYNINQNQDTVNQNQNVNRNRSSNDNNNTININTTRTKSSTDLQT
   182  182 G N  S    S-     0   0   14  228    0  NNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   183  183 G S        +     0   0   33  228   65  QQQQQQQQQQQQQKEQQQQQQQQQQQQQQQQQQQQQEEQEQQQRQQQQQQQQQQQQQQQQQQQQQKQQGQ
   184  184 G L        -     0   0    0  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   185  185 G Y        -     0   0  108  228   70  QQQQQRKRKKTQQQQRKRRRRKRRRRKPRRKKKKQQQQQQQQQQRRRKKRKRPRRPRQQQKKKKKQKKQQ
   186  186 G T        -     0   0   49  228   56  SSSSSRRNSSTSSSSKRRSSSSRRSKRRRRSSSTSSSSSSSSSSSSSRSSSSRSSRSSSSSSNRRSTSSS
   187  187 G I        -     0   0    3  228   17  VVVVVVVVVIVVVVVVVVVVVVVVVVIVVVIIIIVVVVVVVVVVVVVVVVVVVVVVVVIIIIIVVVIIVV
   188  188 G P    >   -     0   0   31  228    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   189  189 G K  T 3  S+     0   0  182  228   67  HHHHHEEHDRKHHHHEEDKENEEDEEEKEDHRHDHNHHHHHHHHKEEEEKEEEEQENNDDRRDEEDDHHH
   190  190 G G  T >  S+     0   0   34  228   18  GGGGGGGGGGGGGGGGGGGGREGGGGGEGGGGGGGGGGGGGGGGEGGGEEEEEGGGRGGGGGGGGGGGGG
   191  191 G F  T <  S+     0   0    2  228   68  AAAAAAAAVAAAAAAIAAAAAAAAAIAAAAAAAAAAAAAAAAAAAAAAAAAAAAVAAAAAAALAAVAAAA
   192  192 G F  T >  S-     0   0    9  228    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   193  193 G G  T <   -     0   0   53  228   39  DDDDDNNDDDDDDDDDNDDNDDDDNDNDDDDDDDDNDDDDDDDDDDENDDDDDDDNDNDDDDNDDDDDDD
   194  194 G S  T 3  S+     0   0  128  228   74  RRRRRSSSRNSRSRRSSSSSSSSSSSSNSSRNRRRARRRRRRRRNSSSSNSSSSSSSAHHNNNFFRRRRP
   195  195 G H    <   -     0   0   48  228   44  lllllllllllllLllllllllllllllllllllllllllllllllllllllllllllllllllllllll
   196  196 G L        -     0   0  117  228   81  kkkkkkkssskkkKkskksknqsnksknsssssfkkkkkkkkkknsskknkkksnknkkkssrkksfskk
   197  197 G L        -     0   0    3  228   13  LLLLLLLLLLLLLLLLLLLLIILILLLILLLLLLLLLLLLLLLLILLLLILLLLXLILLLLLLIILLLLL
   198  198 G P  S    S+     0   0   37  228   74  QQQQQTTNQTQQEQQSTNSTKSSKASTKSSTTTTQEQQQQQQQQKSNTKKKKKNKAKEEETTKNNQTTQQ
   199  199 G F  E     +i  176   0A  57  228   87  TTTTTRRITHYTTSSTRRLRTEDTLTWDKDHHHQTTTTTTTTTTDKNRMDMMMITLTTTTHHSLLHQLTT
   200  200 G A  E     -ij 177 227A   0  228   53  IIIIILLLIIIIIIILLIVLLVILLLLLLIAIAAIIIIIIIIIILLILLLLLLLLLLILLIILLLIAAII
   201  201 G F  E     +i  178   0A   4  228   88  TTTTTQQHYYWLTFFRQTTQWQTRQRQRETYWYFFTTTITTVTTREMQQRQQQYWQWTQQYYYQQWFYTQ
   202  202 G L        +     0   0    0  228    4  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLL
   203  203 G H        +     0   0   19  228   86  FFFFFQTTYFHYDYYDEDHEDQNDEDTNDNFSFLLSYLTRIRYYYYDQQEQQTTQEQNHHFFHQQHLFYW
   204  204 G G  S    S+     0   0   11  228   64  GGGGGSNNSNTATGGNETTETSSTETNDTDGSGTSVSSAINNSSDNPEEEEENNSESINNNNDSSDTGSS
   205  205 G N        -     0   0    0  228    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   206  206 G P        -     0   0   34  228   38  QQQQQPPPPPPQNPAPPPPPPPPPPPPPPPPPPPPVQPTPPPAPPIPPPPPPPPPPPPPPPPPPPPPPPP
   207  207 G W  B     -l  248   0C   0  227    2  FFFFFWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWFWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   208  208 G L        -     0   0   82  227   64  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDN
   209  209 G b        +     0   0   25  227    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   210  210 G N  S >  S-     0   0   48  227   58  sssssSTSTEAssssSSSSSSSSSSSTSSSEAEEsssgssssssSsSTTSSSSSSSSEAAEAETTSEEss
   211  211 G c  G >  S+     0   0   45  224    1  cccccCCCCCCccccCCCCCCCCCCCCCCCCCCCccccccccccCrCCCCCCCCCCCCCCCCCCCCCCcc
   212  212 G E  G 3  S+     0   0  125  227   67  EEEEEnnnpstETTEnrrnrnknrrrnrrnrsrrSTEDETETEErDrnnrnnnkknkassstpnnprrTS
   213  213 G I  G <> S+     0   0    0  226    8  IIIIIiiiviiIIIIiiiiiiiiiiiiiiiiiiiIIIIIIIIIIiIiiiiiiiiiiiiiiiiiiiiiiII
   214  214 G L  H <> S+     0   0   36  227   29  LLLLLLILDLLLLLLLLLLLLLLLLLILLLMLMMLLLLLLLLLLLLLIILLLLLLLLIIILLRLLDMMLL
   215  215 G Y  H  > S+     0   0   45  227   10  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYDYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   216  216 G F  H  > S+     0   0    1  227   10  LLLLLLMLLLLLLLLLLLLLLLLLLLMLLLLLLLLFLLLLLLLLLLLMMLLLLLLLLFLLLLLMMLLLLL
   217  217 G R  H  X S+     0   0   61  227   67  SSSSSSASSKSSSSSASRSRSRARRRARRARSRRSSSSSSSSSSRRRAARSSSRRSRVRRKSAAASRRSS
   218  218 G R  H  X S+     0   0  141  227   67  QQQQQKKKRNTGDDQKKNKNKDKNNNKNNKNGNNDDQQQDQDQQNNNKKNKKKDDKDNTTNTEKKRNNDD
   219  219 G W  H  X S+     0   0   17  227    2  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWFFWWWWWWWWWW
   220  220 G L  H  < S+     0   0    0  226   26  IIIIIILISIIIIIILIIIIIILIIILIILVLVVIIIIIIIIIIIIILLIIIIIIIILIIIILLLIVVII
   221  221 G Q  H >< S+     0   0   71  226   69  RRRRRRKRQVGRGGRARRRRRDARRRKRRAAGAAQRRRRRRRQRRRRKKRRRRDDRDKAAVGNKKRAARR
   222  222 G D  H 3< S+     0   0   92  227   55  EEEEEEKEKQQEQQETEEEEEDTEEEKEETDQDDKGGVNVDEKDEEEKKEEEEDDEDEKKQQKKKTDBEE
   223  223 G N  T >< S+     0   0   21  227   37  NNNNNKKKKHNNNNNNKKKKKNNKKKKKKNHHNHNNNHNNKNHNKKKKKKKKKNNKNNNNHNNKKNHHNN
   224  224 G A  G X  S+     0   0   28  226   70  SSSSSEAETASSAASLEQQQQKLQQQAQQLTATTASSSADSARSQQQAAQEQEKKQKPTTASSQQSTTAA
   225  225 G E  G 3  S+     0   0  135  226   60  NNNNNGDGSSGANDDEGGGGGDEGGGDGGESGSSDAAQDNDNDDGGGDDGGGGDDGDKDDSGDDDVSSNN
   226  226 G N  G <  S+     0   0   31  226   67  KKKKKTETDIKKKKKRTNNNNKRNNNENNRIKIIKKKTKKKKKKNNNEENTNTKKNKHKKIKKEEKIIKK
   227  227 G V  B <   +j  200   0A   0  206    8  VVVVVV V VVVVVV VVVVVV VVV VV V VVVVVVVVVVVVVVV  VVVVVVVV IIVVIGGVVVVV
   228  228 G Y        -     0   0   27   98   83           NF                   M MM     K                    N ILLKMM K
   229  229 G V        -     0   0   50   94   85           P                    R RR     M                    L HGG.RR M
   230  230 G W        -     0   0   90   93   63           S                    W WW     R                      WGG.WW D
   231  231 G K    >   -     0   0  112   93   77           G                    D DD     S                      TVV.DD L
   232  232 G Q  T 3  S+     0   0  142   85   68           H                             D                      GDD.   G
   233  233 G G  T 3  S+     0   0   71   79   28           G                                                    STT.   S
   234  234 G V    <   -     0   0   66   73   76                                                                QAA.   G
   235  235 G D        -     0   0  115   74   48                                                                AGGA   N
   236  236 G V        +     0   0   33   74   84                                                                LCCS   F
   237  237 G K  S    S-     0   0  176   74   65                                                                LEEG   Q
   238  238 G A  S    S+     0   0   83   74   68                                                                REES   T
   239  239 G M        -     0   0   47   74   81                                                                PGGY   D
   240  240 G T        -     0   0  124   74   63                                                                DGGS   P
   241  241 G S        -     0   0   21   74   75                                                                SKKT   D
   242  242 G N    >   +     0   0   72   72   65                                                                .AAN   S
   243  243 G V  G >  S+     0   0   15   72   26                                                                .VVP   V
   244  244 G A  G 3  S+     0   0   33   72   75                                                                .LLD   T
   245  245 G S  G <  S+     0   0    9   72   56                                                                .EES   C
   246  246 G V  S <  S-     0   0    0   73   57                                                                AIIA   S
   247  247 G Q  B >   -M  255   0D  21   73   73                                                                KTTK   Q
   248  248 G b  B >  S-l  207   0C  11   64   50                                                                CEEC   S
   249  249 G D  T 3  S-     0   0  108   64   79                                                                SEES   S
   250  250 G N  T <  S+     0   0   76   64   50                                                                GEEG   N
   251  251 G S    X   -     0   0   50   64   81                                                                SAAS   A
   252  252 G D  T 3  S+     0   0  122   64   78                                                                GAAG   V
   253  253 G K  T 3  S+     0   0  168   64   67                                                                KEEK   K
   254  254 G F    <   -     0   0  128   49   88                                                                .DD.    
   255  255 G P  B >   -M  247   0D  20   56   61                                                                .CCP    
   256  256 G V  G >  S+     0   0    0   58   28                                                                .VVV    
   257  257 G Y  G 3  S+     0   0   61   55   48                                                                .YY     
   258  258 G K  G <  S+     0   0  135   57   77                                                                PPP     
   259  259 G Y    <   -     0   0   43   58   59                                                                VNN     
   260  260 G P        -     0   0   85   58   81                                                                RTT     
   261  261 G G    >   -     0   0    9   58   50                                                                STT     
   262  262 G K  T 3  S+     0   0  186   58   61                                                                ITT     
   263  263 G G  T 3  S+     0   0   78   55   44                                                                IAA     
   264  264 G c    <   -     0   0   31   55   26                                                                CII     
   265  265 G P              0   0  109   55   26                                                                PPP     
   266  266 G T              0   0  193   52   34                                                                TTT     
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 G H              0   0  111   43   47                        DDD                       DDD                   
     2    2 G P        +     0   0  121   97   60             GGGGGGGGGGGDDD G                   GGDDDP                  
     3    3 G I  S    S+     0   0   77  201   59  TTTTTTTTTTTVVVVVVVVVVVIII V   TTTTTTTTTTTTTTTTVVIIIS  TTTTTTTTTTTTTTTT
     4    4 G a  S    S-     0   0    6  220    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
     5    5 G E  E     -A   16   0A 118  220   58  eeeeeeeeeeeSSSSSSSSSSStttPSSPPeeeeeeeeeeeeeeeeSSttttgSeeeeeeeeeeeeeeee
     6    6 G V  E     -A   15   0A  44  163   74  ccccccccccc...........nnnS.TAAcccccccccccccccc..nnnkqTcccccccccccccccc
     7    7 G S  E     +A   14   0A  56  163   71  TTTTTTTTTTT...........KKKQ.GQRTTTTTTTTTTTTTTTT..KKKNSGTTTTTTTTTTTTTTTT
     8    8 G K        +     0   0  155  221   68  CCCCCCCCCCCCCCCCCCCCCCTTTCCCCCCCCCCCCCCCCCCCCCCCTTTVWCCCCCCCCCCCCCCCCC
     9    9 G V  S >  S-     0   0  103  221   67  NNNNNNNNNNNNNNNNNNNNNNDDDSNTSSNNNNNNNNNNNNNNNNNNDDDVATNNNNNNNNNNNNNNNN
    10   10 G A  T 3  S+     0   0  100  221   74  EEEEEEEEEEENNNNNNNNNNNSSSCNCCCEEEEEEEEEEEEEEEENNSSSKPCEEEEEEEEEEEEEEEE
    11   11 G S  T 3  S-     0   0   95  221   57  GGGGGGGGGGGNNNNNNNNNNNSSSSNDSSGGGGGGGGGGGGGGGGNNSSSDGDGGGGGGGGGGGGGGGG
    12   12 G H    <   -     0   0   68  221   64  KKKKKKKKKKKKKKKKKKKKKKPPPGKGGGKKKKKKKKKKKKKKKKKKPPPKLGKKKKKKKKKKKKKKKK
    13   13 G L        -     0   0   28  221   82  KKKKKKKKKKKNNNNNNNNNNNEEETNNTTKKKKKKKKKKKKKKKKNNEEEQQNKKKKKKKKKKKKKKKK
    14   14 G E  E     -Ab   7  35A  65  222   52  EEEEEEEEEEESSSSSSSSSSSTTTQSKTTEEEEEEEEEEEEEEEESSTTTEAKEEEEEEEEEEEEEEEE
    15   15 G V  E     -Ab   6  36A   0  224    8  VVVVVVVVVVVVVVVVVVVVVVVVVVVMVVVVVVVVVVVVVRVVVVVVVVVTTMVVVVVVVVVVVVVVVV
    16   16 G N  E     +Ab   5  37A  59  224   36  NDNDNDDNNNNDDDDDDDDDDDDDDNDSDDNNDNDDNDDNNDNNNDDDDDDQNSNDNNNNNNDNDDNDNN
    17   17 G a    >   +     0   0    0  224    2  CCCCCCCCCCCCCCCCCCCCCCCCCCCVCCCCCCCCCCCCCCCCCCCCCCCCCVCCCCCCCCCCCCCCCC
    18   18 G D  T 3   +     0   0   34  223   71  QQQQQQQQQQQSSSSSSSSSASSSSHSTNYQQQQQQQQQQQQQQQQSSSSSTYTQQQQQQQQQQQQQQQQ
    19   19 G K  T 3  S+     0   0  148  223   75  SSYGSSGSSSSSSSSSSNSSDSSSSEYCSSYYSSSSYSSYYGSSYSSSSSSHDCGYGYSSSSSSSSSSYY
    20   20 G R  S <  S-     0   0   81  224   36  KKKKKKKKKKKKKKKKKKKKKKKKKRKNRRKKKKKKKKKKKKKKKKKKKKKMKNKKKKKKKKKKKKKKKK
    21   21 G N        +     0   0  130  224   72  GDGSDGSGGGDRKRKKRKRMKRKKKRKGSSGGGGGGGGGGGSGDGGRRKKKAGGSGSGGGDDDDGGGDGG
    22   22 G L        -     0   0   25  224    3  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    23   23 G T  S    S+     0   0   98  224   64  QTKDTQDQQKTTTTTTTTTTTTTTTATKAAKKQQQQKQQKKDQTKQTTATTTSKKQDEQQTTTKDQKTKK
    24   24 G A  S    S-     0   0   55  224   41  ASASSASAAASAAAAAAAAAAAAAASANSSAAAAATAAAAASASATAATAASSNSASAAASSSASTASAA
    25   25 G L        -     0   0   28  225   30  VVVVVVVVVVVIIMIIIIMIIIVVVVMVVVVVIVVVVVVVVVVVVVIIVVVVVVVVVVVIVVVVVVVVVV
    26   26 G P        -     0   0    5  226    0  PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPpPPPPPPPPPPPPPPPPPP
    27   27 G P  S    S+     0   0  124  226   64  PPSSPPSPPSPSSIIISSISSSTTTAINAVSSPPPPSPPSSSPPSPISTTTtANSSPPPPPPPPSPSPSS
    28   28 G D        +     0   0   47  226   48  GGEGGGGGGEGNNNNNNNNNNNGGGGNDGGEEGGGGGRGEEGGGERNNGGGDGDGGGGGGGGGGGGEGGG
    29   29 G L        -     0   0    9  226   22  IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIILIIIIIIIIIIIIIII
    30   30 G P    >   -     0   0   15  226    9  PHPPPPPPPPPPPPPPPPPPPPPPPPPQPPPPPPPPPPPPPPPPPPPPPPPHPQPPPPPPPPPPPPPPPP
    31   31 G K  T 3  S+     0   0  118  226   64  AAAAAAAAAATVVVTVTAVVAATTATVKTNAAAAAAAAAAAAAAAATVAATKDKAAAAAAAAAAAAAAAA
    32   32 G D  T 3  S+     0   0   74  227   26  DDGDDDDDEDDEEDDDDDDEDDSSNTDDTNDDDDDDDDDDDDDDDDDDSNSDNDDDGDDDDDDDDDDDDD
    33   33 G T    <   +     0   0    2  227   12  TTTTTTTTTTTTTTTTTTTTTTTTTTTATATNTTTTTTTTTTTTTTTTTTTTTATTTTTTTTTTTTTTTT
    34   34 G T        +     0   0   19  227   69  KTRETEEKRTETTDEEDKDTKKEEEQDKQQKTKKKKEKKKEEKTEEEDEEEAQKNERKKKKTTTEKETET
    35   35 G I  E     -bc  14  59A   8  227   85  SNTKNKKSTNKEERNNRKREKKKKKVRETISNSSSSKSSSKKSNKKNRRRKIAKSKTSSSSNNKKSKNKK
    36   36 G L  E     -bc  15  60A   3  227    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    37   37 G H  E     +bc  16  61A  30  227   82  DNVDNDDDVNDRRVKKVDLRVLQQDYLNHYDNDDDDDDDDDDDNDEKEEEQITDDDVDDDDNNDEDDNDV
    38   38 G L    >   +     0   0    0  227    3  LFLLFLLLLFLLLLLLLLLLLLLLLLLLLLLFLLLLLLLLLLLFLLLLLLLLVLLLLLLLLFFLLLLFLL
    39   39 G S  T 3   +     0   0    2  227   75  KQEQQRQKEQRNNQDDNKGNNGNNQYGESHKQKKKKRKKKRQKQRSNHNNHKQKNNERKKKQQKSKRQNM
    40   40 G E  T 3  S+     0   0   73  227   92  YYGSYSSYGYYFFGYYYYSFYSYYSTRYSVYYYYYYSYYYSSYYSSYMYYLYKYSSGYYYYYYLSYYYSS
    41   41 G N  S <  S-     0   0    4  227   23  NNNTNTTNNNNNNNNNNNNNNNNNTNNNNNNNNNNNTNNNTTNNTTNNNNNNNNNNNNNNNNNNTNNNNT
    42   42 G L        +     0   0   61  227   83  ASAGSGGAASASSKKKKKKSKKQQGKKSQQASAAAAGAAAGGASGGKKQQQDRSSSAAAAASSSGAGSSG
    43   43 G L        +     0   0    1  227   10  FLLLLLLFLLFLLLLLLLLLLLLLLILLIIFLFFFFLFFFLLFLLLLLLLLLILLLLFFFFLLFLFFLLL
    44   44 G Y  S    S+     0   0  123  227   82  KVRAVAATKVTSSSSSRSSSRSTTATSSTTTVTTTTATTTAATVAARSTTTKESAAKTTTTVVTATTVAK
    45   45 G T  E    S+k   69   0B  58  227   71  QQSTQTTQTQQKKSSSESSKESGGKKSSKKQQQQQQTQQQTTQQTTESSSASSKTTTQQQQQQQTQRQTS
    46   46 G F  E     -k   70   0B   8  227   19  LLFLLLLLILLLLLLLLLLLLLIILLLLLLLLLLLLLLLLLPLLLLLLVIVVLLLLILLLLLLLLLLLLI
    47   47 G S  E >   -k   71   0B  19  227   49  PSSSSSSSSPSSSPLPEPPSEPPPSEPPEEPSSPPPSSSSSSPPSSEPPPPTPDSSSSSPPSSPSPPPSS
    48   48 G L  G >  S+     0   0    1  227   88  FSPDSDDSSFSPPRSGPNGPPGPPDPGRPPSSSFFFDSSSDDFSDDPSDGAAEPDDSSSFFSSSDFSFDP
    49   49 G A  G >  S+     0   0   30  227   71  NNTTNTANTNNTTMKMTTMTTMTKTGTTGGNNNNNNTNNNTTNNTTTKKKNSRTTTTNNNNNNDTNDNTT
    50   50 G T  G <  S+     0   0   63  227   52  AAAAAATAAAAAAAAAAAAVAAAAAVAAVVAAAAAAAAAAAAAAAAAAAAATVAAAAAAAAAAAAAAAAA
    51   51 G L  G X  S+     0   0    0  227   12  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
    52   52 G M  T <  S+     0   0   88  228   78  QQNRQRRQAQQHHHQHHQHHHHQHRDHHDDQQQQQQRQQQRRQRRRHHHHRKDHRRAQQQQQQKRQKQRN
    53   53 G P  T 3  S+     0   0   64  228   67  GGHGGGGGHGGHGGSNGSGRNGGGGSNNRSGGGGGGGGGGGGGGGGGSGSAGRGGGHGGGGGGGGGGGGH
    54   54 G Y    X   +     0   0   18  228   17  LLLLLLLLLLLLMLFLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLL
    55   55 G T  T 3  S+     0   0   99  228   52  TTRTTTTTKTTSKNTKKTNTNNTTTAKKGTTTTTTTTTTTTTTTTTKSATTSVNTTKTTTTTTTTTTTTR
    56   56 G R  T 3  S+     0   0  142  228   62  KKDKKKKKQKKKEKKEEKKKKKKRKNEENAKKKKKKKKKKKKKKKKEKRRQLNKKKQKKKKKKAKKAKKD
    57   57 G L    <   +     0   0    6  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    58   58 G T        +     0   0   61  228   34  TTQTTTTTQTTTTTTTTRTRTTTTTRTTKTTTTTTTTTTKTTTTTTTTTTTLQTTTQTTTTTTTTTTTTQ
    59   59 G Q  E     -cd  35  81A  56  228   86  FWRWWWWWRFWYYIFYYQYLFYYYWEYYQYFWFWFFWWWWWWFWWWYYYYYEKNWWRWWFFWWWWFWFWR
    60   60 G L  E     -cd  36  82A   0   86    1  ................L.L......LLL.......................L.L................
    61   61 G N  E     +cd  37  83A  17   86   77  ................D.N......HNN.......................D.D................
    62   62 G L    >   +     0   0    1   86    6  ................L.L......LLL.......................L.L................
    63   63 G D  T 3   +     0   0   11   86   68  ................D.N......WDD.......................S.Q................
    64   64 G R  T 3  S+     0   0   97   86   80  ................G.Y......GTL.......................N.W................
    65   65 G A  S <  S-     0   0    0   86   70  ................N.N......NNN.......................N.N................
    66   66 G E        -     0   0   77   86   55  ................K.E......QQQ.......................A.K................
    67   67 G L        +     0   0    1   86    7  ................L.L......LLL.......................M.L................
    68   68 G T        +     0   0   62   86   69  ................Q.P......VQQ.......................T.Q................
    69   69 G K  E     -k   45   0B 119   86   78  ................T.T......STA.......................N.A................
    70   70 G L  E     -k   46   0B  22   86    7  ................L.L......LLL.......................F.L................
    71   71 G Q  E     -k   47   0B  85   86   67  ................P.P......PPP.......................K.P................
    72   72 G V        +     0   0   44   86   72  ................P.A......PEI.......................V.V................
    73   73 G D        +     0   0   76   86   50  ................g.g......ggg.......................E.g................
    74   74 G G  S    S-     0   0   26   85   59  ................d.k......ddd.........................d................
    75   75 G T        -     0   0   56   86   83  ................H.E......KHQ.......................F.H................
    76   76 G L    >   -     0   0   11   86   14  ................L.L......LLL.......................A.L................
    77   77 G P  T 3  S+     0   0   83   86   63  ................V.K......TVV.......................L.V................
    78   78 G V  T 3  S+     0   0   68   86   91  ................A.N......QNN.......................G.S................
    79   79 G L    <   +     0   0    0   86    0  ................L.L......LLL.......................L.L................
    80   80 G G        +     0   0   14   86   70  ................D.E......VDA.......................E.D................
    81   81 G T  E     +de  59 104A  35   86   77  ................I.T......TKD.......................E.K................
    82   82 G L  E     -de  60 105A   1  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    83   83 G D  E     +de  61 106A  27  228   76  NAENANAAENASGNSNGYWYSNSANDYRHSAAAANNNNANANNNSNGSGSNNWVNNEAANNAASNNSNNE
    84   84 G L        +     0   0    0  228    8  LLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLVLLL
    85   85 G S        +     0   0    8  228   72  EEDQDENDDEDSEWNENSTNGNGEQNQTDHDEDDEDQQDQDRDQQQETNYDANNQQDEDEEDESQDSEQD
    86   86 G H  S    S+     0   0   91  228   82  DYSYGDNQKGNTGGNSNNDDNYEQYGYSYTYYQQGDYYSYGYDYYYGGDDYNSQYDKYGDGQYNYDNDYN
    87   87 G N  S    S-     0   0    2  228    1  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    88   88 G Q        +     0   0   71  228   46  QQQAQQQQQQQQKQKQQQKQQEQKQQDNQQQQQQRQQQQQQRQQSQRKKKQSQQAQQQQQQQQEQQEQAQ
    89   89 G L        -     0   0    5  228    1  LLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLI
    90   90 G Q  S    S+     0   0  111  228   46  QQEQQQQQEQEQQQQQQQQQQQQQQSKRKTQQQQEQQQQQQQQQQQQQPTQDTKQQEQQQQQQKQQKQQE
    91   91 G S  S    S-     0   0   90  228   61  ATSTTTTSSTSTATTASAAATTTSTSSSSASTSSTATTTTTEATTTTTFSSHSSTARTTATSTFTTFATS
    92   92 G L        -     0   0   14  228    5  LLLLLLLFLLLLLLLLLLLLLLLLLVLLLLLLFLILLLLLLILLLLLLLLLILLLLLLLLLFLVLLVLLL
    93   93 G P        -     0   0   14  228   24  sPPPPPPSPpPPsppppPppPpppPpppPpSPSSlSpPPPPpSPPPpppPPPppPSPPpsSSPPpPPSPP
    94   94 G L        +     0   0  102  174   55  v........v..vvvvv.vv.vvv.vvv.v....v.v....l....vvv..Nvi....vv....v.....
    95   95 G L    >>  +     0   0    1  175   14  F........F..FFFFF.FF.FFF.FFF.F....F.F....F....FFF..LFF....FF....F.....
    96   96 G G  T 34 S+     0   0    8  179   44  N........N..DDDDD.DD.DDD.HDD.D....N.A....S....DDD..SDD.D..DN....DA.D..
    97   97 G Q  T 34 S+     0   0  168  185   66  PE...E...L..QHQHK.QQ.HQP.QSS.K....P.HE...T....HQD..LKS.D.EQP..E.QD.D..
    98   98 G T  T <4 S+     0   0    6   48   63  ......................................................................
    99   99 G L    ><  +     0   0    0  175    2  L........L..LLLLL.LL.LLL.LLL.L....L.L....V....LLL..LLL....LL....L.....
   100  100 G P  T 3  S+     0   0   58  174   71  A........T..VVVVT.VV.VTN.VTT.G....T.T....T....VVT..TTT....TA....R.....
   101  101 G A  T 3  S+     0   0   37  175   66  E........E..ENNSS.NN.AEN.KKK.K....E.E....K....NEE..NQK....EE....E.....
   102  102 G L    <   +     0   0    0  175    1  L........L..LLLLL.LL.LLL.LLL.L....L.L....L....LLL..LLL....LL....L.....
   103  103 G T        +     0   0   38  175   67  K........K..DDNDT.AT.GGN.ETT.T....K.G....E....NDG..NTT....GK....K.....
   104  104 G V  E     +ef  81 128A  22  175   83  T........T..EKKKQ.ED.TTE.KYY.H....T.N....R....ERT..KYW....TT....D.....
   105  105 G L  E     -ef  82 129A   1  175    1  L........L..LLLLL.LL.LLL.LLL.L....L.L....L....LLL..LLL....LL....L.....
   106  106 G D  E     +ef  83 130A  30  175   88  G........G..YYYVY.RR.NVH.WST.D....G.G....E....REW..IDN....VG....Y.....
   107  107 G V        +     0   0    0  175   26  L........L..LLLLL.LL.LLL.LLL.L....L.L....L....LLL..LLL....LL....L.....
   108  108 G S        +     0   0    9  175   74  N........N..RNQNG.DR.NQQ.KSR.H....Q.S....D....GGT..SAE....LN....Q.....
   109  109 G F  S    S+     0   0   84  175   97  G........S..QQEKA.RQ.NFF.NEE.K....N.G....N....TRN..HVR....NG....F.....
   110  110 G N  S    S-     0   0   14  175    2  N........N..NNNNN.NN.NNN.NNN.S....N.N....N....NNN..NNN....NN....N.....
   111  111 G R        +     0   0  117  175   49  A........A..QQKQK.QQ.KQQ.KKQ.Q....Q.Q....Q....QQQ..RQK....QV....Q.....
   112  112 G L        +     0   0    0  175    4  L........L..LLLLL.LL.LLL.LLL.L....I.L....I....LLL..ILL....LL....L.....
   113  113 G T        +     0   0   56  175   72  T........T..TQEEQ.KE.QKK.TQQ.T....R.A....K....EKK..TTQ....KA....K.....
   114  114 G S        -     0   0   69  175   39  T........V..SSSST.SS.SSS.ASR.T....A.N....S....SSS..SAS....ST....S.....
   115  115 G L        -     0   0   15  175    4  L........L..LLLLL.LL.ILL.LLL.V....L.I....L....LLL..VLL....LL....L.....
   116  116 G P        -     0   0   55  175   28  P........P..PPPPP.PP.PPP.PPP.P....P.H....P....PPT..PPP....PP....P.....
   117  117 G L  S    S+     0   0  160  218   79  P.AVS.APSPAPPDPQAASQVDELAEHEPAPPPPTAA.PASAAPSPQSPAVDVNP.G.PLAP.AP.A.PA
   118  118 G G  S >  S+     0   0   34  224   21  GGGGGGGGGGGGRGRGGGKGGGRGGGGGGGGGGGGGKGGGGGGGGGGKRGGAGGG.GGRGGGGGR.G.GG
   119  119 G A  T 3  S+     0   0    4  228   48  VVVVVVLVAVLVVVVIVVIIVVVVVVVVIVLVVLVVAVVVVLVVVVIIVVVAVVVVVVVVVVVLVVLVVL
   120  120 G L  T >  S+     0   0    6  228    8  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFFFFFFFFFFFFFFFFFFFFFFFFFF
   121  121 G R  T <  S+     0   0  174  228   41  DDDDAADDDDDDDDDDDDDDDDDDDDDDDNDDDDDNHADDDDNDADDDDDDHDHDNDADDDDDDDNDNDD
   122  122 G G  T 3  S+     0   0   42  228   79  NQQQQHQQQRQHSTSKQESKHKRRQRKKKRHQHHRPGHHHQQPQQHKSNQQHRNRPQHSHDHQQSLQPQQ
   123  123 G L    X   +     0   0    1  228    5  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   124  124 G G  T 3   +     0   0   27  227   64  RTVTGTATVIAVTTTTKKTTVTTTTVTSGVPRPPITTTTTTATRGTTTRTKKVPTAATTTTPTATTAARA
   125  125 G E  T 3  S+     0   0   81  227   62  KENEQEEEANENKSKKNNKKNQKQENEQKNEEEENEREEEEEEEQEKKKENNNLSEEEKQEEEEKEEEEE
   126  126 G L    <   +     0   0    0  228    1  LLLLLLLLLLLLLLLILLLILLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLL
   127  127 G Q        +     0   0   62  228   70  TGKGKGKGKDKDTTTTEETTDKTTGQKQTQGKRGDKTGKKGKKKKKTTTGNQQKEKKGTDGGGKTKKKKK
   128  128 G E  E     +fg 104 152A  46  228   79  WTETNNQTEKQYYHYYTTIYKELLTRTKHNTDTTKTYNNNTQTDNNNWWTEQTEKTQNTKTTTQWTQTDQ
   129  129 G L  E     -fg 105 153A   2  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   130  130 G Y  E     +fg 106 154A  51  228   82  NWYVYGYWYYYGSASDWYWDYYDQWWRYEFGYGGYGAGYYWYGYYYDTNWRYDHYGYGSYGGWYTGYGYY
   131  131 G L    >   +     0   0    3  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   132  132 G K  T 3   +     0   0   27  228   82  QNLQNSQSGAYSNNSESHNDRYQSSNDHHNAGPANKESYNSQKTNASSQSSQHNNNLNSGAASQANYNGQ
   133  133 G G  T 3  S+     0   0   19  228   74  YDRDSGTNEQGTSEYGEQDNQKQSNNNEHQYSSYLGQGSLNYGTSGGEYNSHNNVGNDTGNNATQRGGSG
   134  134 G N  S <  S-     0   0    6  228    1  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNNNNNNNNNNNNNNNNNNNNNNNNN
   135  135 G E        +     0   0  111  228   45  QQEQQQQQQQQEKQEKQQQKQKQQQQQQQQRQRQQMKQQQQQMQQQKKQQQGQQQAQQQQQQQQQAQVQQ
   136  136 G L        +     0   0    0  228    2  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLILLLLLLLLLL
   137  137 G K        +     0   0  102  228   54  QKTKKKKKKTKKQQQQKTQQKQQQKTHQQSEKQKKLQKKKKKLKKKQQQKKHQRKTKKQTAAKKQTKAKK
   138  138 G T        -     0   0   75  228   54  SSSSSSSSSSSSSSRSSSRRSSSSSSSRAASSSSSVSSSSSSVSSSSSSSSYARSTSSSSSSSSSTSTSS
   139  139 G L        -     0   0    5  228    9  ILLLLLLLLLLLLLLLLLLLLPIILPLLLLLLLLLLLLLLLLLLLLLLILLLIVLLLLILLLLLILLLLL
   140  140 G P    >   -     0   0   19  228    8  PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPQPPPPPPPQPPPPPRPPPPPSPPPPPPPRPPPPEPPPPP
   141  141 G P  T 3  S+     0   0  102  228   62  APPPPPPPPPPPHVDNSPENPPEEPTENAAPTLPPPVPPTPSLPPPHHASPEKEPPPPAPPLPAAPSLPT
   142  142 G G  T >  S+     0   0   38  228   46  GRGGRRRGRRRGGAGGGGGGGGGGGGGGGGGGGGRGGRRGRGGRRGGGGGRQEGRGRRGRGGGTGGGGRG
   143  143 G L  T <  S+     0   0    8  228   33  VVVVVVVVVVVIVVVVIIVVIVIIVVVVLMVVVVVVVVVVVVVVVVVVVVVVAVVVVVLVVVVLLVVVVV
   144  144 G L  T >  S+     0   0    6  228    9  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   145  145 G T  T <  S+     0   0  110  228   51  DDDDDDDDDDDDDDDHDDDDDDKKDDDDDDDDDDDDDDDDDDDDDDDDDDDEDDDDDDDDDDDDDDDDDD
   146  146 G P  T 3  S+     0   0   36  228   70  KRSKSSNRSSSKKHNNKRKKSHTTSRKKRRNSRRSRQRSSRSRSSRKKKRRHRKSRSSKRRSRRKSRRSS
   147  147 G T    X   +     0   0    0  228   46  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLSLLLLLLLLLLLLLLLLLL
   148  148 G P  T 3  S+     0   0   65  228   57  TTTTTTRTTTTTTTAPTTTTTTTTTVTTGVRTTSTTTTTTTTTTTTATTTTQVTTSTTTTSTSTTTTTST
   149  149 G K  T 3  S+     0   0   93  228   51  NKKKKKKKKKKKEKKLKKQQKKNNKNKSNHKKQKKKEKKKKKQRKKEENKNQHQRKKKNKKKKQNKKQKK
   150  150 G L    <   +     0   0    0  228    2  LLLLLLLLLLLLLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   151  151 G E        +     0   0   56  228   64  DKTTTTTTKTTTKTTKTTTTTTQQTKTNEKTTDTTTGTTTKTDTTTKKNTKHKGTTTTQTTTTDQTKDTT
   152  152 G K  E     +gh 128 176A  58  228   88  REIVWLWLELYRTIREDRKIWITTWEYDVEWLKWWLTYYREIKYYLTTRTETETYWWYTYWWWKTLEKYR
   153  153 G L  E     -gh 129 177A   0  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   154  154 G S  E     +gh 130 178A   5  228   83  DWEYTSDNYSSDSWEYRDSYSGAYSHDRGYNNYNNNGSNDWYYTGDDTDSWDFYTDTGDSNNNYDNWYSD
   155  155 G L    >   +     0   0    1  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLVL
   156  156 G A  T 3   +     0   0    0  228   75  DNQNAEQDNDNDNNNDNDSHYGDNDYDQCCNGAGQGQSNDNHGGSSQSDSDSCNGQASQSGYGGQGNGGD
   157  157 G N  T 3  S+     0   0   62  228   75  TTSNQRYRNNDNVNNYVRENEETNQGNYCCTEQGQSSEVQSSTDQTTNTTTYCDDYQQVEGNGGVESTQQ
   158  158 G N  S <  S-     0   0    9  228    0  NNNNNNNNNNNNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   159  159 G N        +     0   0   75  228   51  QQQQQEQQQQQQKKQQKQQKKQQQQQKQKKQQQQQQQQQQQQQQQQQQQQQKKQQQQQQQQQQQQQQQQQ
   160  160 G L        +     0   0    0  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLILLLTLL
   161  161 G T  S    S+     0   0   57  228   62  QQQQQQQQQQQQQQQKQEKQQQQQQTQETTQQTQQQKQQQQQTQQQKKQQQVTKQQQQQQQQQTQQQTQQ
   162  162 G E        -     0   0  116  228   58  SSSSSSSSSSSRSSSRSFSSSSSSSVSREESSSSSSSSSSSSSSSSRRSSSSESSSSSSSSSSSSSSSSS
   163  163 G L        -     0   0    8  228   25  IIIIIIIIIIILLLLILLLILLIIILLLLLIILIIILIIIIILIIIVIIVIVLLIVIIIIIIVLIIILII
   164  164 G P    >   -     0   0   19  228   10  PEPPPPPPPPAPPPPPPPPPPPPPPPPPPPEPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPPPPPP
   165  165 G A  T 3  S+     0   0   83  228   77  NAAIKHAKAKSENHEEKDPDHHAKETNNSRAKPAASPEKEEEPEHSEEKHARRDNDEKESKEDTNEALEK
   166  166 G G  T >  S+     0   0   35  228   16  GGGGGGGGGGGGGGGGGGKGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGHGGGGGGGGGGGGGGGGGG
   167  167 G L  T <  S+     0   0   11  228   55  ALAAVVVAVAAVVVVAVVIVVVAAIVVVVILAVAVAVAAAAAVAAAAAVAALIVAVAAIAAAVVAIVVAV
   168  168 G L  T >  S+     0   0   17  228   18  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFEFFFFFFFFFFFFFFFFFFFFFIEFFFFFFFFFFFFFFFFF
   169  169 G N  T <  S+     0   0  112  228   35  DDDDDDDDDDDDHDDDDDDDDDDDNDHDDRDDDDDDDDDDDDDDDDDDDDDSRDDDDDNDDDDDDKDDDD
   170  170 G G  T 3  S+     0   0   42  228   67  KKKKKKKKKMKKNKKKkKkKKKKKKrnKKLKMRKKKKTKTTTRTHKKKKKKHLKKKKKKKKTKSKTKSTK
   171  171 G L    X   +     0   0    6  222    1  LLLLLLLLLLLLLLLLlLlLLLLLLllLL.LLLLLLLLLLLLLLLLLLLLLA.LLLLLLLLLLLLLLLLL
   172  172 G E  T 3  S+     0   0  115  227   59  VTTRTGTTTRTTPTTTTTTTTTATATTTTTTRTTVTTTTTTTTTTTTTVTTETSVGTTATTTGTVTTTTT
   173  173 G N  T 3  S+     0   0   91  228   60  NNNNQSNNNNNELEQQQLEEEESKSHEQRQNNKRNNKNNNNNKNKNEENNNKHQNSNRSNKNSKNNNQNK
   174  174 G L    <   +     0   0    4  228    1  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   175  175 G D        +     0   0   36  228   61  DQQQQEDQDQQKKKKGTEKRKKQEQTRGKTQQTEEQTQQQDQTQEQKKEQQDTQEEQEQQEQETEQNTQG
   176  176 G T  E     +hi 152 199A  17  228   48  KTTTQRRTRTTTETTTKKTTTETTTHTTHHTTLKTTVTTTKTLTDTTTTTTKHKTRTKTTTTRWTTRLTT
   177  177 G L  E     -hi 153 200A   2  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFLLLLLLLLLLLLLLLLLL
   178  178 G L  E     +hi 154 201A  11  228   91  YDSDYQEDDHDHYYQYYYTERSQHYAEHGAANYYYNYDYTYYNYRNRRWESYAYWYDYYNQYDNWYVQYT
   179  179 G L        +     0   0    1  228    1  PLLLLLLLLLLLLLMLLLLMLLLLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   180  180 G Q        +     0   0    2  228   75  NQSESTSRSYELSRTNHQSSDNSQSDRNDDDFQESFNRQNNRQRNFDDRSSTDHRERESFTREQRNDSRD
   181  181 G E  S    S+     0   0   86  228   72  DQTQTNTNTQQNNSSSYNNNNNDTNQNTGQNQQQEQDNQRDDLDDQNDETTGQEERNRNQNDQQEDDSDR
   182  182 G N  S    S-     0   0   14  228    0  NNNNNNNNNNNNNNNXNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   183  183 G S        +     0   0   33  228   65  RQQQQKQEQGQQQQQQQQQQQQQQQQQQQQQEEQKERQEERKQKKEQQKQQRQQKEEEQEKKQQKRQQKE
   184  184 G L        -     0   0    0  228    0  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   185  185 G Y        -     0   0  108  228   70  QQQQQQQQQQQRKRRKKRRKRRQQQKRRKKQQQQQQQQQQQQQQQQRRQQQTRRQQQQQQQQQQQQQQQQ
   186  186 G T        -     0   0   49  228   56  SSSSSSSSSSSRRNSXSKSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESSSSSSSSSSSSSSSSSS
   187  187 G I        -     0   0    3  228   17  VVVVVVVVVVVVVVVVLVVVVVVVIIVVIIVVVVVVVVVVVVVVVVVVVVVIIVVVVVVVVVVVVVVVVV
   188  188 G P    >   -     0   0   31  228    0  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   189  189 G K  T 3  S+     0   0  182  228   67  HHHYDHNNNHHEEHKDEEKEEKDNDHEQHHHHNHHHHHHHHHHHHHNKNHDDHDHHHHHHHHHHHHHHHH
   190  190 G G  T >  S+     0   0   34  228   18  GGGGGGGGGGGGEGEKGGGEGEGGGGGGGGGGGGGGGGGGGGGGGGREGGGDGKGGGGGGGGGGGGGGGG
   191  191 G F  T <  S+     0   0    2  228   68  AAAAAAAAAAAAAAAAVIAAAAVAAAAVAAAAAAAAAAAAAAAAAAAATATFAAAAAAAAAAAAAAAAAA
   192  192 G F  T >  S-     0   0    9  228    0  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   193  193 G G  T <   -     0   0   53  228   39  DDDDDDDNNDDNDDDDDDDDDDDNDDEDDDDDNDDDDDDDDDDDDDDDDDDEDEDDDDDDDDDDDDDDDD
   194  194 G S  T 3  S+     0   0  128  228   74  RRRRSRSAARRSSSNKSSSSSNSAHRSSRRRRARRRRPRRSRRRSPSNSNSGRKRRRRRRRRPRRRRRRR
   195  195 G H    <   -     0   0   48  228   44  llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll
   196  196 G L        -     0   0  117  228   81  kkkskkkkkkkkksnknssksnakkssssskkkkkkkkkkkkknkknndkknskkkkkkkkkskkksnkk
   197  197 G L        -     0   0    3  228   13  LLLLLLLLLLLLLIILLLLLLIMLLLLLLLLLLLLLLLLLLLLLLLIILLLLLLLLLLLLLLLLLLLLLL
   198  198 G P  S    S+     0   0   37  228   74  QQQKEQEEEQQTKSKENSSKSKDEETNSTTQQEQQQQAQQEQQQQQKKQEDATEQQQQQQQQKQQQKQQQ
   199  199 G F  E     +i  176   0A  57  228   87  TTTDTTTTTTTRMNDTTTLMDDRTTHNTHLTTTTTTTTTSTTTTTTTDDTYYHTTTSTTTTTNTTTNTTT
   200  200 G A  E     -ij 177 227A   0  228   53  IIIIIIIIIIILLVLILLVLILIILAIIAAIIIIIIIIIIIIIIIILLVTMVAIIIIIIIIIIIIIIIII
   201  201 G F  E     +i  178   0A   4  228   88  FTTFTTLTTTYQQQQVDRTQTRTTQYMSYYTTTTTTTVTYTTFIVQWRKTTYYTLTFVTTTTVFTLVTTF
   202  202 G L        +     0   0    0  228    4  LLLLLLLLLLLLLLLLLLLLLLLLLLLLFFLLLLLLLLLLLLLLLLLXLLLLLLLLLLLLLLLLLLLLLL
   203  203 G H        +     0   0   19  228   86  LYLRTYYTNYHEQYEISHYQDEENMFQEGFLYNIYYIYIHTYLTRWNEHDNDFYRLYRYYYYRLYYRTYL
   204  204 G G  S    S+     0   0   11  228   64  SSSTSSASVSTEEDKGITDETEGINGSAGGSSVNSSNNNTSSSATSDEGTNDGAASGNSSSSISSATSSN
   205  205 G N        -     0   0    0  228    0  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   206  206 G P        -     0   0   34  228   38  AQPPAPQAVQMPPPPPPPPPPPLPPPPDPPPAVPQPPPQMAQPTPPPPPPPPPDPPPAQQQQPPQQPAQP
   207  207 G W  B     -l  248   0C   0  227    2  WFWWWWWWWFWWWWWWWWWWWWWLWWWWWWWWWWFWWWWWWFWWWWWWWWWFWWWWWWFFFWWWFWWWFW
   208  208 G L        -     0   0   82  227   64  DDNDNNDDDDNDDDDDDDDDDDDDDDDDDDDDDNDNNDGNNDDNDNDDDDDQDDNNNDDDDDDDDDNDDN
   209  209 G b        +     0   0   25  227    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   210  210 G N  S >  S-     0   0   48  227   58  sssssssssssSSTSSSSSSSSEAEESaEEsssssssssssgsgssSSEEENEessssssssssssssss
   211  211 G c  G >  S+     0   0   45  224    1  cccccccccccCCCCCCCCCCCCCCCCcCCccccccccccccccccCCCCCCCccccccccccccccccc
   212  212 G E  G 3  S+     0   0  125  227   67  EEETGSEETETrrnrknknnrrasarrDrrEEDSSSSTESGDEDTSrraaaArDSSSEEEEETTEESEEE
   213  213 G I  G <> S+     0   0    0  226    8  IIVIIIIIIIIiiiiiiiiiiiiiiiiIiiIIIIIIIIIIIIVIIIiiiiiLiIIIIIVIIIIIIIIIIV
   214  214 G L  H <> S+     0   0   36  227   29  LLLLLLLLLLLLLILLLLLLLLIIIMLLMMLLLLLLLLLLLLLLLLLLIIIEMLLLLLLLLLLLLLLLLL
   215  215 G Y  H  > S+     0   0   45  227   10  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYNYYYYYYYYYYYYYYYYYY
   216  216 G F  H  > S+     0   0    1  227   10  LLLLLLLLFLLLLMLLLLLLLLFLFLLLLLLLLLLLLLLLLLLLLLLLFFFFLLLLLLLLLLLLLLLLLL
   217  217 G R  H  X S+     0   0   61  227   67  SSGSSSSSSSSRRASRSRSSRRVRVRSSRRGSSSSSSSSSSSSSSSARVVVKRSSSSSSSSSSSSSSSSS
   218  218 G R  H  X S+     0   0  141  227   67  GDQDEDSQDEDNNKKDKDKKNNNTNNKQNNQQDEDDDEQDEQEQDDKNNNNANQDDDQEERDDDDQGQDD
   219  219 G W  H  X S+     0   0   17  227    2  WWWWWWWWWFWWWWWWWWWWWWWFWWWWWWWWWFWWWFWWWWWWWFWWWWWWWWFWFWFFWFWWFWWWFW
   220  220 G L  H  < S+     0   0    0  226   26  IIIIIIIIIIIIILIIIIIIIILILVIIVVIIIIIIIIIIIIIIIILILLLVVIIIIIIIIIIIIIIIII
   221  221 G Q  H >< S+     0   0   71  226   69  RRRGRQRRRNQRRKRDRDRRRRKAKARKAAERRNQRRDRQGRTRGKARKKKEARKRKRNNEKRRTQRRKE
   222  222 G D  H 3< S+     0   0   92  227   55  NEEQDNENGAREEKEDEDEEEEEKEDEADDEEENNEVKVKAVLVQNTEEEEDDVNENEAADNVERNEENR
   223  223 G N  T >< S+     0   0   21  227   37  NNNNYNNNNNHKKKKNKNKKKKNNNHKNHHNNNNNNNNHNHHNHNNNKNNNNHNNNNNNNNNNNNNNNNN
   224  224 G A  G X  S+     0   0   28  226   70  AAAAGSSASSPQQAEKEKQEQQPTPTESTTSSAASADASAGSPSAALQPPPSTAASASSSSADAASASAP
   225  225 G E  G 3  S+     0   0  135  226   60  DNANPDADADKGGDGDGDGGGGKDKSGESSQNNNDNNNQDPQSQNEEGKKKFSEEAENDDQENNNDAKES
   226  226 G N  G <  S+     0   0   31  226   67  KKKKTRKKKKVNNETKTKNTNNHKHITKIIKKKKRKKKTKTTKTKKRNHHHNIKKKKKKKKKKKIRKKKK
   227  227 G V  B <   +j  200   0A   0  206    8  VVVVVVVVVVVVV VVVVVVVV I VVVVVVVVVVVVVVVVVVVVV V   IVVVVVVVVVVVVVVVVVV
   228  228 G Y        -     0   0   27   98   83           K               M KMM      KK      KK     YMKK K KK KKKK   KK
   229  229 G V        -     0   0   50   94   85           L               R RRR      MK      KR     TRNR R RL RMKQ   RV
   230  230 G W        -     0   0   90   93   63           F               W YWW      RY      YL     MWFL H FF LRYH   LN
   231  231 G K    >   -     0   0  112   93   77           T               D IDD      ST      TL     KDLL L TT LSTL   LA
   232  232 G Q  T 3  S+     0   0  142   85   68           G                 S G      DG      GS     D TS S GG SDGG   SN
   233  233 G G  T 3  S+     0   0   71   79   28           G                 G         G      GG     G GG G GG G GS   GS
   234  234 G V    <   -     0   0   66   73   76           S                 Q                 S     D QS S SS S  S   SE
   235  235 G D        -     0   0  115   74   48           T                 E                 E     T NE E TT E  Q   EA
   236  236 G V        +     0   0   33   74   84           Y                 F                 Y     T DY Y YY Y  Y   YA
   237  237 G K  S    S-     0   0  176   74   65           E                 V                 R     Q LR R EE R  Q   RP
   238  238 G A  S    S+     0   0   83   74   68           T                 P                 S     D PS S TT S  T   SE
   239  239 G M        -     0   0   47   74   81           D                 D                 E     E DE E DD E  D   EM
   240  240 G T        -     0   0  124   74   63           P                 P                 P     Y PP P PP P  P   PV
   241  241 G S        -     0   0   21   74   75           D                 D                 D     S DD D DD D  D   DT
   242  242 G N    >   +     0   0   72   72   65           G                 G                 G     V GG G GG S  G   G 
   243  243 G V  G >  S+     0   0   15   72   26           V                 V                 V     V VV V VV V  V   V 
   244  244 G A  G 3  S+     0   0   33   72   75           T                 T                 T     C TT T TT T  T   T 
   245  245 G S  G <  S+     0   0    9   72   56           C                 C                 C     T CC C CC C  C   C 
   246  246 G V  S <  S-     0   0    0   73   57           S                 Q                 S     S QS S SS S  S   S 
   247  247 G Q  B >   -M  255   0D  21   73   73           D                 G                 D     P GD D DD Q  D   D 
   248  248 G b  B >  S-l  207   0C  11   64   50                             T                       N T       S        
   249  249 G D  T 3  S-     0   0  108   64   79                             M                       K M       S        
   250  250 G N  T <  S+     0   0   76   64   50                             E                       V E       N        
   251  251 G S    X   -     0   0   50   64   81                             S                       P S       A        
   252  252 G D  T 3  S+     0   0  122   64   78                             V                       L V       V        
   253  253 G K  T 3  S+     0   0  168   64   67                             n                       L n       K        
   254  254 G F    <   -     0   0  128   49   88                             i                       . i                
   255  255 G P  B >   -M  247   0D  20   56   61                             T                       . T                
   256  256 G V  G >  S+     0   0    0   58   28                             K                       . K                
   257  257 G Y  G 3  S+     0   0   61   55   48                             E                       . E                
   258  258 G K  G <  S+     0   0  135   57   77                             N                       N N                
   259  259 G Y    <   -     0   0   43   58   59                             T                       F T                
   260  260 G P        -     0   0   85   58   81                             F                       P F                
   261  261 G G    >   -     0   0    9   58   50                             Q                       M Q                
   262  262 G K  T 3  S+     0   0  186   58   61                             A                       D A                
   263  263 G G  T 3  S+     0   0   78   55   44                             G                       H G                
   264  264 G c    <   -     0   0   31   55   26                             C                       C C                
   265  265 G P              0   0  109   55   26                             P                       S P                
   266  266 G T              0   0  193   52   34                             T                       N T                
## ALIGNMENTS  211 -  227
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 G H              0   0  111   43   47                   
     2    2 G P        +     0   0  121   97   60    GGG   GGGGG    
     3    3 G I  S    S+     0   0   77  201   59  TTVVV  AVVVVV    
     4    4 G a  S    S-     0   0    6  220    0  CCCCC  CCCCCCCCC 
     5    5 G E  E     -A   16   0A 118  220   58  eeSSS  PTTTTSPSs 
     6    6 G V  E     -A   15   0A  44  163   74  cc...  S.....STc 
     7    7 G S  E     +A   14   0A  56  163   71  TT...  Q.....QGT 
     8    8 G K        +     0   0  155  221   68  CCCCC  CCCCCCCCC 
     9    9 G V  S >  S-     0   0  103  221   67  NNNNN  SNNNNNSTD 
    10   10 G A  T 3  S+     0   0  100  221   74  EENNN  CDDDDNCCG 
    11   11 G S  T 3  S-     0   0   95  221   57  GGNNN  SQKQNNPDN 
    12   12 G H    <   -     0   0   68  221   64  KKKKK  RTTTTKGGK 
    13   13 G L        -     0   0   28  221   82  KKNNN  TKKKKNTNM 
    14   14 G E  E     -Ab   7  35A  65  222   52  EESSS  TNSNSSDKS 
    15   15 G V  E     -Ab   6  36A   0  224    8  VVVVV  VVVVVVVMV 
    16   16 G N  E     +Ab   5  37A  59  224   36  NDDDD  DDDDDDNST 
    17   17 G a    >   +     0   0    0  224    2  CCCCC  CCCCCCCVC 
    18   18 G D  T 3   +     0   0   34  223   71  QQSSA  NSSSSSHT. 
    19   19 G K  T 3  S+     0   0  148  223   75  YSSYD  SSYSGSEC. 
    20   20 G R  S <  S-     0   0   81  224   36  KKKKK  RKKKKKRNN 
    21   21 G N        +     0   0  130  224   72  GGMKK  SGEGMKRGG 
    22   22 G L        -     0   0   25  224    3  LLLLL  LLLLLLLLL 
    23   23 G T  S    S+     0   0   98  224   64  QQTTT  ATTTTTAKK 
    24   24 G A  S    S-     0   0   55  224   41  AAAAA  SAAAAASNN 
    25   25 G L        -     0   0   28  225   30  VVIMM LVIIIIIVVV 
    26   26 G P        -     0   0    5  226    0  PPPPP PPPPPPPPPPP
    27   27 G P  S    S+     0   0  124  226   64  PPIII HAISSSSANNH
    28   28 G D        +     0   0   47  226   48  GGNNN RGNNNNNEDDR
    29   29 G L        -     0   0    9  226   22  IIIII LIIIIIIIIIL
    30   30 G P    >   -     0   0   15  226    9  PPPPP PPPPPPPPQQP
    31   31 G K  T 3  S+     0   0  118  226   64  AATVV ATATLTATKKA
    32   32 G D  T 3  S+     0   0   74  227   26  DDDDDDDDDDEDDTDDD
    33   33 G T    <   +     0   0    2  227   12  TTTTTTTKTTTTTTAAT
    34   34 G T        +     0   0   19  227   69  KKEDDTVQDDTDKQKKV
    35   35 G I  E     -bc  14  59A   8  227   85  SSNRRYYRRRQRKIKKY
    36   36 G L  E     -bc  15  60A   3  227    0  LLLLLLLLLLLLLLLLL
    37   37 G H  E     +bc  16  61A  30  227   82  DDKDLAVWDVRVDRDDV
    38   38 G L    >   +     0   0    0  227    3  LLLLLVVLLLLLLLLLV
    39   39 G S  T 3   +     0   0    2  227   75  KKDQGEENRQNQQYKKE
    40   40 G E  T 3  S+     0   0   73  227   92  YYYSRFFNGGLGSRYYF
    41   41 G N  S <  S-     0   0    4  227   23  NNNNNYFNNNNNNNNNF
    42   42 G L        +     0   0   61  227   83  AAKKKNNQKKSKKQSSN
    43   43 G L        +     0   0    1  227   10  FFLLLLLILLLLLILLL
    44   44 G Y  S    S+     0   0  123  227   82  TTSSSTTTSSSSSTSST
    45   45 G T  E    S+k   69   0B  58  227   71  QQSSSQQKSSKSSKKKQ
    46   46 G F  E     -k   70   0B   8  227   19  LLLLLLLLLLLLLLLLL
    47   47 G S  E >   -k   71   0B  19  227   49  PPPPPPREPPSPPESSR
    48   48 G L  G >  S+     0   0    1  227   88  FSGNNPAPHRPRSLPPA
    49   49 G A  G >  S+     0   0   30  227   71  NNMMTDDGTTTTKGTKD
    50   50 G T  G <  S+     0   0   63  227   52  AAAAAITVAAAAAVAAT
    51   51 G L  G X  S+     0   0    0  227   12  FFFFFLLFFFFFFFFFL
    52   52 G M  T <  S+     0   0   88  228   78  QQHHHQQDHHHHHDHHQ
    53   53 G P  T 3  S+     0   0   64  228   67  GGNGNGGSGGNGRSSHG
    54   54 G Y    X   +     0   0   18  228   17  LLLLLMALLLLLLLLLA
    55   55 G T  T 3  S+     0   0   99  228   52  TTKQKSSTNNKNTMSSS
    56   56 G R  T 3  S+     0   0  142  228   62  KKESENNQKKEKKESKN
    57   57 G L    <   +     0   0    6  228    1  LLLLLLLLLLLLLLLLL
    58   58 G T        +     0   0   61  228   34  TTTTTQQTTTTTRTTTQ
    59   59 G Q  E     -cd  35  81A  56  228   86  FWYYygeRINYNLYFYe
    60   60 G L  E     -cd  36  82A   0   86    1  ....lll.......L.l
    61   61 G N  E     +cd  37  83A  17   86   77  ....NDD.......E.D
    62   62 G L    >   +     0   0    1   86    6  ....LLL.......L.L
    63   63 G D  T 3   +     0   0   11   86   68  ....NTT.......S.T
    64   64 G R  T 3  S+     0   0   97   86   80  ....NRR.......Y.R
    65   65 G A  S <  S-     0   0    0   86   70  ....NNN.......N.N
    66   66 G E        -     0   0   77   86   55  ....QAA.......Q.A
    67   67 G L        +     0   0    1   86    7  ....LLL.......L.L
    68   68 G T        +     0   0   62   86   69  ....QTT.......Q.T
    69   69 G K  E     -k   45   0B 119   86   78  ....SQR.......T.R
    70   70 G L  E     -k   46   0B  22   86    7  ....LLL.......L.L
    71   71 G Q  E     -k   47   0B  85   86   67  ....PSP.......P.P
    72   72 G V        +     0   0   44   86   72  ....DPP.......A.P
    73   73 G D        +     0   0   76   86   50  ....ggg.......g.g
    74   74 G G  S    S-     0   0   26   85   59  ....dqr.......d.r
    75   75 G T        -     0   0   56   86   83  ....KNV.......E.V
    76   76 G L    >   -     0   0   11   86   14  ....LSS.......L.S
    77   77 G P  T 3  S+     0   0   83   86   63  ....TAA.......K.A
    78   78 G V  T 3  S+     0   0   68   86   91  ....SAA.......N.A
    79   79 G L    <   +     0   0    0   86    0  ....LLL.......L.L
    80   80 G G        +     0   0   14   86   70  ....THH.......E.H
    81   81 G T  E     +de  59 104A  35   86   77  ....LTT.......T.T
    82   82 G L  E     -de  60 105A   1  228    0  LLLLLLLLLLLLLLLLL
    83   83 G D  E     +de  61 106A  27  228   76  NANSAVVDNDNNYTWTV
    84   84 G L        +     0   0    0  228    8  LLLLLLLLLLLLLLILL
    85   85 G S        +     0   0    8  228   72  EDNSNTKYQQDWNRQSK
    86   86 G H  S    S+     0   0   91  228   82  YGYYQEENFWTGDNQTE
    87   87 G N  S    S-     0   0    2  228    1  NNNNNNNNNNNNNNNNN
    88   88 G Q        +     0   0   71  228   46  QQEDQQRQKEQQKQKQR
    89   89 G L        -     0   0    5  228    1  LLLLLLLLLLLLLLLLL
    90   90 G Q  S    S+     0   0  111  228   46  QQQKQEETQQQQQTKQE
    91   91 G S  S    S-     0   0   90  228   61  TSATSVIVTATTTASTI
    92   92 G L        -     0   0   14  228    5  LLLLILLLLLLLLLLLL
    93   93 G P        -     0   0   14  228   24  SPsppqePpppppPppe
    94   94 G L        +     0   0  102  174   55  ..vivww.vivvi.viw
    95   95 G L    >>  +     0   0    1  175   14  ..FFFLL.FFFFF.FFL
    96   96 G G  T 34 S+     0   0    8  179   44  ..DKDHQ.DKDDK.DKQ
    97   97 G Q  T 34 S+     0   0  168  185   66  ..QEKGG.HEEHE.HEG
    98   98 G T  T <4 S+     0   0    6   48   63  .................
    99   99 G L    ><  +     0   0    0  175    2  ..LLLLL.LLLLL.LLL
   100  100 G P  T 3  S+     0   0   58  174   71  ..VKTKQ.VKKVK.NKQ
   101  101 G A  T 3  S+     0   0   37  175   66  ..ENQAA.NNNAN.KNA
   102  102 G L    <   +     0   0    0  175    1  ..LLLLL.LLLLL.LLL
   103  103 G T        +     0   0   38  175   67  ..GETAG.NEEDE.TEG
   104  104 G V  E     +ef  81 128A  22  175   83  ..ETKHH.ETNRT.NTH
   105  105 G L  E     -ef  82 129A   1  175    1  ..LLLLL.LLLLL.LLL
   106  106 G D  E     +ef  83 130A  30  175   88  ..HWDDD.HWRHW.NWD
   107  107 G V        +     0   0    0  175   26  ..LVLLL.LVILV.LVL
   108  108 G S        +     0   0    9  175   74  ..TTGSS.GTQNT.RTS
   109  109 G F  S    S+     0   0   84  175   97  ..SDIGG.TDQND.GDG
   110  110 G N  S    S-     0   0   14  175    2  ..NNNNN.NNNNN.NNN
   111  111 G R        +     0   0  117  175   49  ..KKQRR.QKQQK.QER
   112  112 G L        +     0   0    0  175    4  ..LLLLL.LLLLL.LLL
   113  113 G T        +     0   0   56  175   72  ..KQQRQ.TQQTQ.QQQ
   114  114 G S        -     0   0   69  175   39  ..SASTM.SATSA.TAT
   115  115 G L        -     0   0   15  175    4  ..LLLLL.LLLLL.LLL
   116  116 G P        -     0   0   55  175   28  ..PPPPP.PPPPP.PPP
   117  117 G L  S    S+     0   0  160  218   79  ASPVANPAPIVPIAAIP
   118  118 G G  S >  S+     0   0   34  224   21  GGRGGGGGGGGGGRSGG
   119  119 G A  T 3  S+     0   0    4  228   48  VVVVVLLVIVVIVVVVL
   120  120 G L  T >  S+     0   0    6  228    8  FFFFFLLFFFFFFFFFL
   121  121 G R  T <  S+     0   0  174  228   41  DDDDDAADDDDDDNDDA
   122  122 G G  T 3  S+     0   0   42  228   79  DHSHENNRKQHQQKHHN
   123  123 G L    X   +     0   0    1  228    5  LLLLLFFLLLLLLLLLF
   124  124 G G  T 3   +     0   0   27  227   64  TTTVKTTVTVVTVTVVT
   125  125 G E  T 3  S+     0   0   81  227   62  EEKSNDSNKENKNRNNS
   126  126 G L    <   +     0   0    0  228    1  LLLLLLLLLLLLLLLLL
   127  127 G Q        +     0   0   62  228   70  GKTDERHKTDDTATDDH
   128  128 G E  E     +fg 104 152A  46  228   79  TNYKTIIEREKREVKRI
   129  129 G L  E     -fg 105 153A   2  228    0  LLLLLLLLLLLLLLLLL
   130  130 G Y  E     +fg 106 154A  51  228   82  GYSVWDDHDYYDRDYRD
   131  131 G L    >   +     0   0    3  228    0  LLLLILLLLLLLLLLLL
   132  132 G K  T 3   +     0   0   27  228   82  YARSQSSYDNTDDSNDS
   133  133 G G  T 3  S+     0   0   19  228   74  NQNDQNNGRSSRRGSDN
   134  134 G N  S <  S-     0   0    6  228    1  NNNNNNNNNSNNNNNNN
   135  135 G E        +     0   0  111  228   45  QQQQQQQQQQKQQQQQQ
   136  136 G L        +     0   0    0  228    2  LLLLLLLLLLLLLLLLL
   137  137 G K        +     0   0  102  228   54  KTQKQEKTKKKKKQKKK
   138  138 G T        -     0   0   75  228   54  SSSSTTTASSSSSAYST
   139  139 G L        -     0   0    5  228    9  LLLLLLLLLLLLLLLLL
   140  140 G P    >   -     0   0   19  228    8  PPPPPPPPPPPPPPPPP
   141  141 G P  T 3  S+     0   0  102  228   62  PPHSVPPSGQPDPEPPP
   142  142 G G  T >  S+     0   0   38  228   46  GGGGGDDGGGRGRGKGD
   143  143 G L  T <  S+     0   0    8  228   33  VVVIVLLAVIVVVVIVL
   144  144 G L  T >  S+     0   0    6  228    9  FFFFFLLFFFFFFFFFL
   145  145 G T  T <  S+     0   0  110  228   51  DDDDDRWDDDDDDDDDR
   146  146 G P  T 3  S+     0   0   36  228   70  SSKKHGGRKKSKSSSHG
   147  147 G T    X   +     0   0    0  228   46  LLLLLPPLLLLLLLLLP
   148  148 G P  T 3  S+     0   0   65  228   57  TTTTVLLVSTTTTVTTL
   149  149 G K  T 3  S+     0   0   93  228   51  KKEKNKQHQKKKKNKKQ
   150  150 G L    <   +     0   0    0  228    2  LLLLLLLLLILLLLLLL
   151  151 G E        +     0   0   56  228   64  TTKTDEEKQTTTTQTTE
   152  152 G K  E     +gh 128 176A  58  228   88  WWTDKQREKNYDYRWYR
   153  153 G L  E     -gh 129 177A   0  228    0  LLLLLLLLLLLLLLLLL
   154  154 G S  E     +gh 130 178A   5  228   83  GTSRYHHFYDSTSHNGH
   155  155 G L    >   +     0   0    1  228    1  LLLLLLLMLLLLLLLLL
   156  156 G A  T 3   +     0   0    0  228   75  EANNNEECQQRSGDEGE
   157  157 G N  T 3  S+     0   0   62  228   75  QQVSKGGCENEEYQREG
   158  158 G N  S <  S-     0   0    9  228    0  NNNNNNNNNNNNNNNNN
   159  159 G N        +     0   0   75  228   51  QQQKQRRKQKQKEQKQR
   160  160 G L        +     0   0    0  228    1  LLLLLLLLLLLLLLLLL
   161  161 G T  S    S+     0   0   57  228   62  QQKHKRQTQQQQQVQQR
   162  162 G E        -     0   0  116  228   58  SSRSSAVESSRSSSSSV
   163  163 G L        -     0   0    8  228   25  IIVLLLLLLLLLLLLLL
   164  164 G P    >   -     0   0   19  228   10  PPPPPEGPPPPPPPPPG
   165  165 G A  T 3  S+     0   0   83  228   77  KAEEPEERHNEHKANHE
   166  166 G G  T >  S+     0   0   35  228   16  GGGGKGGGGGGGGGGGG
   167  167 G L  T <  S+     0   0   11  228   55  AAAVILLIVVVVVVVVL
   168  168 G L  T >  S+     0   0   17  228   18  FFFFFLLEFFFFFLFFL
   169  169 G N  T <  S+     0   0  112  228   35  DDDDDVSRDDDDDDHDT
   170  170 G G  T 3  S+     0   0   42  228   67  KKKkkppLKKKKkKNKp
   171  171 G L    X   +     0   0    6  222    1  LLLllll.LLLLlLLLl
   172  172 G E  T 3  S+     0   0  115  227   59  TATTTKRTATTTTTPTR
   173  173 G N  T 3  S+     0   0   91  228   60  NNEQEQQHEENEEQLNQ
   174  174 G L    <   +     0   0    4  228    1  LLLLLLLLLLLLLLLLL
   175  175 G D        +     0   0   36  228   61  QQKKKDDTKKKKKTKKD
   176  176 G T  E     +hi 152 199A  17  228   48  TTETTMMHTTETTHEEM
   177  177 G L  E     -hi 153 200A   2  228    0  LLLLLLLLLLLLLLLLL
   178  178 G L  E     +hi 154 201A  11  228   91  NSSDSDDADYWSKEYWD
   179  179 G L        +     0   0    1  228    1  LLLLLLLLLLLLLLLLL
   180  180 G Q        +     0   0    2  228   75  FSSQYSSDQRRRDQRRS
   181  181 G E  S    S+     0   0   86  228   72  QTNTDNNQNNNNNNDNN
   182  182 G N  S    S-     0   0   14  228    0  NNNNNNNNNNNNNNNNN
   183  183 G S        +     0   0   33  228   65  EQQQQLLQQQQQQQQQL
   184  184 G L        -     0   0    0  228    0  LLLLLLLLLLLLLLLLL
   185  185 G Y        -     0   0  108  228   70  QQKRRTTKQRQRKKRRT
   186  186 G T        -     0   0   49  228   56  SSRSSSGSRSRSRSSSA
   187  187 G I        -     0   0    3  228   17  VVVVVMVIVVVVVIVVV
   188  188 G P    >   -     0   0   31  228    0  PPPPPPPPPPPPPPPPP
   189  189 G K  T 3  S+     0   0  182  228   67  NHDEKKKHDNDNERDDK
   190  190 G G  T >  S+     0   0   34  228   18  GGGGGGGGGGGGGGKKG
   191  191 G F  T <  S+     0   0    2  228   68  AAAAALLAVAVAAAAAL
   192  192 G F  T >  S-     0   0    9  228    0  FFFFFWWFFFFFFFFFW
   193  193 G G  T <   -     0   0   53  228   39  NDDEDATDDDDDDDDDT
   194  194 G S  T 3  S+     0   0  128  228   74  ARSSSSSRSYSYSNKKS
   195  195 G H    <   -     0   0   48  228   44  lllllllllllllllll
   196  196 G L        -     0   0  117  228   81  kknssmmsnnnnkskkm
   197  197 G L        -     0   0    3  228   13  LLILLKKLLLLILLLLK
   198  198 G P  S    S+     0   0   37  228   74  EQKNNDETNGNKKTEED
   199  199 G F  E     +i  176   0A  57  228   87  TTTNIGGHTTTTMHMTG
   200  200 G A  E     -ij 177 227A   0  228   53  IILILFFALVLLLIIIF
   201  201 G F  E     +i  178   0A   4  228   88  ITWTYDDYDTDWQFITD
   202  202 G L        +     0   0    0  228    4  LLLLLIILLLLLLLLLI
   203  203 G H        +     0   0   19  228   86  TIQDNSSFNHSDQYADS
   204  204 G G  S    S+     0   0   11  228   64  ANSTDGGGDTIPENDTG
   205  205 G N        -     0   0    0  228    0  NNNNNNNNNNNNNNNNN
   206  206 G P        -     0   0   34  228   38  TPPPPPPPPPPPPPDHP
   207  207 G W  B     -l  248   0C   0  227    2  WWWWWWWWWWWWWWWWW
   208  208 G L        -     0   0   82  227   64  NNDDDVIDDDDDDDDDI
   209  209 G b        +     0   0   25  227    0  CCCCCCCCCCCCCCCCC
   210  210 G N  S >  S-     0   0   48  227   58  gsTSSDDESTSSTEeeD
   211  211 G c  G >  S+     0   0   45  224    1  ccCCC..CCCCCCCcc.
   212  212 G E  G 3  S+     0   0  125  227   67  DSnrrqerrnrnnrDDe
   213  213 G I  G <> S+     0   0    0  226    8  IIiiilliiiiiiiIIl
   214  214 G L  H <> S+     0   0   36  227   29  LLILLDDMLLLLIMLLD
   215  215 G Y  H  > S+     0   0   45  227   10  YYYYYDDYYYYYYYYYD
   216  216 G F  H  > S+     0   0    1  227   10  LLMLLLLLLMLMMLLLL
   217  217 G R  H  X S+     0   0   61  227   67  SSARRYYRSASAARSSY
   218  218 G R  H  X S+     0   0  141  227   67  QDKNNQENNKNKKNQQG
   219  219 G W  H  X S+     0   0   17  227    2  WWWWWWWWWWWWWWWWW
   220  220 G L  H  < S+     0   0    0  226   26  IILIILLVILILLVIIL
   221  221 G Q  H >< S+     0   0   71  226   69  RRKRRVVARKRKKARRM
   222  222 G D  H 3< S+     0   0   92  227   55  VEKEEDADEKEKKDDDA
   223  223 G N  T >< S+     0   0   21  227   37  HNKKKNNHKKKKKHNNN
   224  224 G A  G X  S+     0   0   28  226   70  SAAQQKRTKQKQATGGR
   225  225 G E  G 3  S+     0   0  135  226   60  QNDGGDDSGDGDDSNND
   226  226 G N  G <  S+     0   0   31  226   67  TKENNNKITETEEIKKK
   227  227 G V  B <   +j  200   0A   0  206    8  VV VVMMVVGVG VVVM
   228  228 G Y        -     0   0   27   98   83   K   FFMSLSL MKKF
   229  229 G V        -     0   0   50   94   85   M   F RNGNG RII 
   230  230 G W        -     0   0   90   93   63   D   R WIGIG WSS 
   231  231 G K    >   -     0   0  112   93   77   L   K DEVEV DNN 
   232  232 G Q  T 3  S+     0   0  142   85   68   G   N GADAD GTT 
   233  233 G G  T 3  S+     0   0   71   79   28   S   T  ATAT  NN 
   234  234 G V    <   -     0   0   66   73   76   G      EAEA  TM 
   235  235 G D        -     0   0  115   74   48   N      CGCG  DD 
   236  236 G V        +     0   0   33   74   84   F      DCDC  DD 
   237  237 G K  S    S-     0   0  176   74   65   Q      GEGE  PP 
   238  238 G A  S    S+     0   0   83   74   68   T      GEGE  DD 
   239  239 G M        -     0   0   47   74   81   D      TGTG  GG 
   240  240 G T        -     0   0  124   74   63   P      KGKG  VV 
   241  241 G S        -     0   0   21   74   75   D      AKAK  TT 
   242  242 G N    >   +     0   0   72   72   65   G      VAVA  CC 
   243  243 G V  G >  S+     0   0   15   72   26   V      LVLV  QQ 
   244  244 G A  G 3  S+     0   0   33   72   75   T      ELEL  GG 
   245  245 G S  G <  S+     0   0    9   72   56   C      IEID  TT 
   246  246 G V  S <  S-     0   0    0   73   57   S      TITV  MM 
   247  247 G Q  B >   -M  255   0D  21   73   73   D      ETET  EE 
   248  248 G b  B >  S-l  207   0C  11   64   50          EEEE  SS 
   249  249 G D  T 3  S-     0   0  108   64   79          EEEE  VV 
   250  250 G N  T <  S+     0   0   76   64   50          AEAE  NN 
   251  251 G S    X   -     0   0   50   64   81          AAAA  KK 
   252  252 G D  T 3  S+     0   0  122   64   78          EAEA  II 
   253  253 G K  T 3  S+     0   0  168   64   67          DEDE  TT 
   254  254 G F    <   -     0   0  128   49   88          .D.D  .. 
   255  255 G P  B >   -M  247   0D  20   56   61          CCCC  .. 
   256  256 G V  G >  S+     0   0    0   58   28          VVVV  KK 
   257  257 G Y  G 3  S+     0   0   61   55   48          YYYY  EE 
   258  258 G K  G <  S+     0   0  135   57   77          PPPP  NN 
   259  259 G Y    <   -     0   0   43   58   59          NNNN  TT 
   260  260 G P        -     0   0   85   58   81          TTTT  FF 
   261  261 G G    >   -     0   0    9   58   50          TTTT  QQ 
   262  262 G K  T 3  S+     0   0  186   58   61          TTTT  AA 
   263  263 G G  T 3  S+     0   0   78   55   44          AAAA  GG 
   264  264 G c    <   -     0   0   31   55   26          IIII  CC 
   265  265 G P              0   0  109   55   26          PPPP  PP 
   266  266 G T              0   0  193   52   34          TTTT  TT 
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1    1 G   0   0   0   0   0   0   0   0   0   0   0   0   0  60   0   0  23   0   0  16    43    0    0   0.939     31  0.52
    2    2 G   0   0   0   0   0   0   0  46   0  33   7   0   0   2   0   0   1   1   2   7    97    0    0   1.356     45  0.39
    3    3 G  31   0  17   0   0   0   0   0   4   2   0  43   0   0   0   0   0   0   1   0   201    0    0   1.323     44  0.41
    4    4 G   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   220    0    0   0.000      0  1.00
    5    5 G   0   0   0   0   0   0   0   0   0  11  27   7   0   0   0   0   0  53   1   1   220    0    0   1.224     40  0.42
    6    6 G  23   0   4   4   0   0   0   0   4   0   9   3  48   0   0   1   1   0   5   0   163    0    0   1.580     52  0.25
    7    7 G   0   0   0   0   1   0   0   3   1   0  23  50   0   0   2   5  10   1   4   0   163    0    0   1.497     49  0.29
    8    8 G   1   0   0   0   0   0   0   0   0   0   0   4  72   0   1  17   2   1   1   0   221    0    0   0.987     32  0.31
    9    9 G  20   0   0   0   0   0   0   1   1   0   9   2   0   0   0   1   0   0  62   4   221    0    0   1.205     40  0.33
   10   10 G   0   0   0   0   0   0   0   1  14   0   4   4  10   0   0   3   0  35  24   4   221    0    0   1.796     59  0.26
   11   11 G   0   0   0   0   0   0   0  35   0   1  27   1   0   0   0   1   2   0  25   6   221    0    0   1.509     50  0.42
   12   12 G   0   4   2   0   0   0   0   8   0   4   0   3   0  10   1  62   7   0   0   0   221    0    0   1.414     47  0.35
   13   13 G   8  13   0   2   0   0   0   0   2   0   0   7   0   0   0  38   1   4  25   0   221    0    0   1.719     57  0.18
   14   14 G   0   0   1   0   0   0   0   0   0   0  26   7   0   0   0   1   1  59   2   1   222    0    0   1.207     40  0.47
   15   15 G  95   0   0   2   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   224    0    0   0.281      9  0.91
   16   16 G   0   0   0   0   0   0   1   0   0   0   2   1   0   0   1   0   0   1  49  45   224    0    0   0.990     33  0.63
   17   17 G   1   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   224    0    0   0.071      2  0.97
   18   18 G   0   0   0   0   0   1   1   0   1   0  29   5   0   2   0   0  37   6   2  14   223    0    0   1.712     57  0.29
   19   19 G   0   0   0   0   0   0  16  13   0   0  43   0   1   1   1  11   1   1  10   2   223    0    0   1.735     57  0.24
   20   20 G   0   2   0   1   0   0   0   0   0   0   2   0   0   0  17  71   5   0   2   0   224    0    0   1.006     33  0.63
   21   21 G   0   0   0   2   0   0   0  33   2   0  12   0   0   0  16  16   0   1  11   7   224    0    0   1.879     62  0.27
   22   22 G   0  98   0   0   1   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   224    0    0   0.130      4  0.97
   23   23 G   0   0   0   0   0   0   0   0   5   0   4  47   0   0   4  20  11   0   0   8   224    0    0   1.596     53  0.35
   24   24 G   3   0   0   1   0   0   0   0  66   0  24   3   0   0   0   1   0   0   2   0   224    0    0   1.015     33  0.59
   25   25 G  53  16  24   4   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   225    0    0   1.192     39  0.70
   26   26 G   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   226    0    0   0.028      0  0.99
   27   27 G   0   2   8   0   0   0   0   0  11  30  39   7   0   1   0   0   0   0   2   0   226    0    0   1.564     52  0.35
   28   28 G   0   0   0   0   0   0   0  43   0   0   0   0   0   0   2   1   0   7  26  20   226    0    0   1.383     46  0.51
   29   29 G   0  26  74   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   226    0    0   0.570     19  0.78
   30   30 G   0   0   0   0   0   0   0   0   0  95   1   0   0   1   0   0   2   0   0   0   226    0    0   0.294      9  0.90
   31   31 G  11   1   0   0   0   0   0   1  52   2   2  13   0   0   0  12   0   4   0   0   226    0    0   1.581     52  0.36
   32   32 G   0   0   0   0   0   0   0   1   0   0   4   5   0   0   0   0   0   7   6  77   227    0    0   0.905     30  0.73
   33   33 G   0   0   0   1   0   0   0   0   4   0   0  93   0   0   0   1   0   0   0   0   227    0    0   0.356     11  0.87
   34   34 G   1   0   0   0   0   0   0   5   7   0   1  27   0   0   3  19   6  23   2   8   227    0    0   1.953     65  0.30
   35   35 G   2   0  26   0   0   0   2   0   0   0  11   4   0   0  10  26   2   5  11   0   227    0    0   1.993     66  0.15
   36   36 G   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   227    0    0   0.057      1  0.99
   37   37 G   9   7   0   0   1   0   3   1   1   0   0   0   0  18  10   5   2   7   5  30   227    0    0   2.189     73  0.17
   38   38 G   2  93   0   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   227    0    0   0.295      9  0.96
   39   39 G   0   0   0   1   0   0   3  13   1   0  11   0   0   4   5  13  21   5  15   8   227    0    0   2.219     74  0.24
   40   40 G   1   4   0   0   5   0  32   5   2   0  20   1   0   0   4   3   1  16   2   2   227    0    0   2.089     69  0.07
   41   41 G   0   0   0   0   1   0   0   0   0   0   0  14   0   0   0   0   0   0  85   0   227    0    0   0.475     15  0.77
   42   42 G   1   9   0   0   0   0   0  15  11   6  18   0   0   1   2  22  12   0   2   0   227    0    0   2.106     70  0.16
   43   43 G   0  80   7   0  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   227    0    0   0.627     20  0.89
   44   44 G   7   1   0   0   0   0   9   7  15   0  24  24   0   0   5   4   1   2   0   0   227    0    0   2.022     67  0.18
   45   45 G   0   0   0   0   0   0   0   1   1   0  26  32   0   1   1  15  18   4   1   0   227    0    0   1.668     55  0.29
   46   46 G   4  69   6   0  20   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   227    0    0   0.912     30  0.81
   47   47 G   0   1   0   0   0   0   0   0   0  27  58   1   0   0   1   0   0  11   0   2   227    0    0   1.128     37  0.50
   48   48 G   0  11   0   4   6   0   0   4   5  20  16  11   0   1   4   0   0   0   3  15   227    0    0   2.262     75  0.12
   49   49 G   0   0   0   7   0   0   0   8  26   0   3  26   0   0   0   9   0   0  16   4   227    0    0   1.891     63  0.29
   50   50 G  11   0   0   0   0   0   0   0  61   1  12  14   0   0   0   0   0   0   0   0   227    0    0   1.189     39  0.48
   51   51 G   3  19   0   0  78   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   227    0    0   0.610     20  0.87
   52   52 G   8   3   0   7   0   0   0   1   3   0   1   0   0  29  15   3  20   0   1   8   228    0    0   2.047     68  0.21
   53   53 G   0   0   0   0   1   0   0  47   0  14  14   0   0   8   5   2   0   0   7   0   228    0    0   1.665     55  0.32
   54   54 G   0  82   0   3   7   0   7   0   1   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.673     22  0.83
   55   55 G   1   0   0   0   0   0   0   0   4   2  10  61   0   0   2  10   2   0   6   0   228    0    0   1.404     46  0.47
   56   56 G   1   0   0   0   0   0   0   0   4   0   4   0   0   5  13  46  11  11   4   1   228    0    0   1.774     59  0.38
   57   57 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.028      0  0.99
   58   58 G   0   0   1   0   0   0   0   0   2   0   0  82   0   0   4   2   8   0   0   0   228    0    0   0.777     25  0.65
   59   59 G   0   4   1   0  13  25  20   1   0   0   0   0   0   1   5   1  18   5   3   3   228    0    0   2.074     69  0.13
   60   60 G   0  99   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    86    0    0   0.063      2  0.99
   61   61 G   0   0   0   0   2   0  27   0   0   0   5   0   0  16   1   1   0   2  23  22    86    0    0   1.742     58  0.23
   62   62 G   1  95   2   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0    86    0    0   0.236      7  0.94
   63   63 G   0   0   0   0   0   1   3   9   3   0  17   3   0   2   5   0   2   2   6  44    86    0    0   1.860     62  0.31
   64   64 G   0   1   0   0   0   2   7   5   0   0   2   2   0   3  28  12  13   3  12   9    86    0    0   2.217     74  0.19
   65   65 G   0   1   0   0   0   0   0   0   1   0  15   2  31   0   0   0   0   0  49   0    86    0    0   1.190     39  0.29
   66   66 G   0   1   0   0   0   0   0   9   5   0   0   0   0   0   1   7  40  35   2   0    86    0    0   1.475     49  0.44
   67   67 G   1  88   1   6   1   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0    86    0    0   0.482     16  0.92
   68   68 G   7   0   2   0   0   0   0   1   2   1   6  56   0   1   0   3  20   0   0   0    86    0    0   1.444     48  0.31
   69   69 G   3   1   0   0   0   0   0   0  14   0  24  16   0   2   3  26   2   2   3   1    86    0    0   1.981     66  0.21
   70   70 G   2  94   1   0   1   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0    86    0    0   0.299      9  0.93
   71   71 G   0   2   2   0   0   0   1   0   1  34   1   0   0   5   0   3  44   2   2   1    86    0    0   1.544     51  0.32
   72   72 G  35   3   2   2   0   0   0   1  21   8   1  19   0   0   0   1   0   3   1   1    86    0    0   1.880     62  0.27
   73   73 G   1   0   0   0   1   0   0  35   2   1   3   0   0   1   0   2   0   7   2  43    86    0    0   1.503     50  0.49
   74   74 G   2   0   0   0   0   0   1  45   8   1   2   1   0   1   2   1   2   2   2  27    85    0    0   1.710     57  0.41
   75   75 G   3   1   2   6   1   0   0   0   2   3   2  27   0  10   5  26   7   2   1   0    86    0    0   2.171     72  0.17
   76   76 G   0  94   0   1   0   0   0   0   1   0   3   0   0   0   0   0   0   0   0   0    86    0    0   0.277      9  0.86
   77   77 G  16   3   2   0   0   0   0   1   3  58   1  12   0   0   0   2   0   0   0   0    86    0    0   1.374     45  0.37
   78   78 G  22  13   0   0   0   0   0   1   8   0  12   5   0   0   8   7   8   3  13   0    86    0    0   2.220     74  0.08
   79   79 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    86    0    0   0.000      0  1.00
   80   80 G   1   1   0   0   0   0   0  27   1   0   2   9   0   3   3   9   6  26   0  10    86    0    0   2.022     67  0.29
   81   81 G   3   1   6   5   0   0   5   0   0   0   0  49   0   0   3   8   2  12   2   3    86    0    0   1.833     61  0.23
   82   82 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.000      0  1.00
   83   83 G   3   2   1   0   0   2   5   4  11   0  12   3   0   3   3   0   0   4  27  22   228    0    0   2.170     72  0.24
   84   84 G   6  91   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.382     12  0.92
   85   85 G   0   0   0   0   0   1   2   4   2   2  28   3   0   2   3   1  10  11  11  20   228    0    0   2.140     71  0.28
   86   86 G   0   0   0   0   0   1  20  11   0   0   4   5   0  22   2   2   8   2  11  11   228    0    0   2.197     73  0.18
   87   87 G   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   228    0    0   0.028      0  0.99
   88   88 G   0   0   0   0   0   0   0   0   4   0   1   0   1   0   4  17  63   4   3   1   228    0    0   1.307     43  0.53
   89   89 G   0  97   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.145      4  0.98
   90   90 G   1   0   0   0   0   0   0   0   0   1   1   5   0   0   4  12  66   7   0   0   228    0    0   1.252     41  0.53
   91   91 G   1   0   1   0   3   0   0   0  16   0  36  39   0   0   3   0   0   0   0   0   228    0    0   1.384     46  0.39
   92   92 G   3  93   2   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.329     10  0.95
   93   93 G   0   1   0   0   0   0   0   0   0  82  15   1   0   0   0   0   0   1   0   0   228    0    0   0.602     20  0.76
   94   94 G  56  18   5   0   2   2   0   0   4   2   7   1   0   0   0   1   0   0   2   0   174    0    0   1.485     49  0.44
   95   95 G   0  33   0   0  66   0   0   0   1   0   0   0   0   0   0   0   0   1   0   0   175    0    0   0.697     23  0.86
   96   96 G   0   1   0   0   0   0   0  26   3   0   2   0   0   2   0   3   4   1   3  56   179    0    0   1.321     44  0.55
   97   97 G   0   2   0   0   0   1   0   5   0   4   4   1   0  12   7   9  36   8   0  11   185    0    0   2.051     68  0.34
   98   98 G   0   2   0   0   4   0   0   4  42   0   8  40   0   0   0   0   0   0   0   0    48    0    0   1.284     42  0.36
   99   99 G   1  98   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   175    0    0   0.098      3  0.98
  100  100 G  24   1   0   1   0   0   0   1   4  32   0  29   0   0   1   7   1   0   1   0   174    0    0   1.607     53  0.29
  101  101 G   1   1   0   0   0   0   0   0  34   1   5   0   0   0   1   7   5  27  19   0   175    0    0   1.655     55  0.33
  102  102 G   1  99   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   175    0    0   0.070      2  0.99
  103  103 G   1   1   1   1   0   0   0  19   2   0   2  39   0   0   1  10   2   9   6   7   175    0    0   1.922     64  0.33
  104  104 G   9   0  10   0   0   1   5   0   0   0   2  35   0   5   7   8   5   9   2   3   175    0    0   2.136     71  0.17
  105  105 G   0  99   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   175    0    0   0.035      1  0.98
  106  106 G   3   1   1   0   0  10  13  17   5   0   2   2   0   4   5   0   0   3   5  31   175    0    0   2.148     71  0.12
  107  107 G  28  67   1   1   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   1   175    0    0   0.835     27  0.73
  108  108 G   1   1   0   0   0   0   5   6  16   0  36   5   1   2   3   1   9   1  14   2   175    0    0   2.023     67  0.26
  109  109 G   1   0   2   0  25   0   5   5   1   1   6   5   1   4   6   3   5   6  21   5   175    0    0   2.355     78  0.03
  110  110 G   0   0   0   0   1   0   0   0   0   0   1   0   0   0   0   0   0   0  99   0   175    0    0   0.070      2  0.97
  111  111 G   1   0   1   0   0   0   0   0   3   0   2   0   0   1  13  14  58   6   1   1   175    0    0   1.405     46  0.50
  112  112 G   1  96   3   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   175    0    0   0.200      6  0.95
  113  113 G   1   1   1   0   0   0   0   2  13   0   2  31   0   1   2  14  26   6   0   1   175    0    0   1.818     60  0.27
  114  114 G   1   1   0   1   0   0   0   0  13   0  73   7   0   0   1   0   1   1   2   0   175    0    0   0.994     33  0.61
  115  115 G   2  95   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   175    0    0   0.217      7  0.96
  116  116 G   0   0   0   0   1   0   0   0   5  80  14   1   0   1   0   0   0   0   0   0   175    0    0   0.681     22  0.71
  117  117 G   5  19   3   0   0   0   0   1  16  30  11   1   0   2   0   1   2   2   4   3   218    0    0   2.102     70  0.21
  118  118 G   0   0   0   0   0   0   0  87   2   0   1   2   0   0   4   2   0   1   0   2   224    0    0   0.655     21  0.78
  119  119 G  58  10   9   0   0   0   0   0  21   0   0   1   0   0   0   0   0   0   0   0   228    0    0   1.194     39  0.52
  120  120 G   0  21   0   0  79   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.509     16  0.92
  121  121 G   0   0   0   0   0   0   0   0   5   0   0   0   0   5  11   0   0   1   4  74   228    0    0   0.972     32  0.59
  122  122 G   0   1   0   0   0   0   0  21   2   2   5   1   1  18  11  18  15   1   3   2   228    0    0   2.150     71  0.20
  123  123 G   4  95   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.236      7  0.95
  124  124 G  11   0   2   0   0   0   0  12   5   5  10  48   0   0   3   3   0   0   2   0   227    0    0   1.731     57  0.35
  125  125 G   0   2   0   0   0   0   0   1   1   0   6   0   0   3   2  17  25  28  14   1   227    0    0   1.860     62  0.37
  126  126 G   0  99   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.070      2  0.99
  127  127 G   0   0   0   0   0   0   0   7   1   0   1  20   0   4   3  20  21   6   0  15   228    0    0   1.977     65  0.30
  128  128 G   2   2   5   0   1   2   4   0   0   0   0  14   0   1   5  19   4  28   7   7   228    0    0   2.189     73  0.21
  129  129 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.028      0  1.00
  130  130 G   1   0   0   0   0   6  49  10   1   0   6   1   0   2   6   0   2   0   2  12   228    0    0   1.814     60  0.18
  131  131 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.028      0  1.00
  132  132 G   0   1   0   0   0   1   5  13   6   0  12   2   1   6  11  11  10   1  12   7   228    0    0   2.471     82  0.17
  133  133 G   1   1   0   0   0   0   7  36   0   0   7   6   0   2   6   1   9   5  14   3   228    0    0   2.140     71  0.25
  134  134 G   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0  99   0   228    0    0   0.078      2  0.98
  135  135 G   0   0   0   1   0   0   0   0   2   0   0   0   0   0   5  15  61  11   0   2   228    0    0   1.314     43  0.54
  136  136 G   0  97   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.150      4  0.97
  137  137 G   0   2   0   0   0   0   0   0   1   0   1  10   0   1   5  54  21   5   0   0   228    0    0   1.424     47  0.46
  138  138 G   1   0   0   0   0   0   1   0   5   0  61  23   0   0   5   0   0   0   1   0   228    0    0   1.221     40  0.46
  139  139 G   2  91   6   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   228    0    0   0.372     12  0.91
  140  140 G   0   1   0   0   0   0   0   0   0  95   1   0   0   0   2   0   1   0   0   0   228    0    0   0.294      9  0.91
  141  141 G   2   2   0   0   0   0   0   1   6  51  11   2   0   4   0   1   3   9   5   2   228    0    0   1.812     60  0.38
  142  142 G   0   0   0   0   0   0   0  71   1   0   0   1   0   0  17   2   1   3   0   4   228    0    0   1.000     33  0.53
  143  143 G  60  23  11   0   1   0   0   0   4   0   0   1   0   0   0   0   0   0   0   0   228    0    0   1.138     37  0.66
  144  144 G   0  22   0   0  78   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.553     18  0.91
  145  145 G   1   1   0   3   0   0   0   0   8   0   0   8   0   0   1   2   0   3   1  70   228    0    0   1.214     40  0.49
  146  146 G   0   0   0   0   0   0   0   5   1  17  21   2   0   3  21  26   1   0   3   0   228    0    0   1.818     60  0.30
  147  147 G   2  77   0   0   0   0   0   0   1   1   0  18   0   0   0   0   0   0   0   0   228    0    0   0.746     24  0.54
  148  148 G   5   1   0   0   1   0   0   0   3  15   7  61   0   0   4   0   0   0   0   0   228    0    0   1.346     44  0.42
  149  149 G   1   1   0   0   0   0   0   0   2   0   4   0   0   3   4  60  14   4   8   0   228    0    0   1.456     48  0.49
  150  150 G   0  97   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.145      4  0.98
  151  151 G   0   0   0   0   0   0   0   1   0   0   0  46   0   0   4  25   7  13   1   3   228    0    0   1.534     51  0.35
  152  152 G   1   9   5   0   0   9   9   0   0   0   0   9   0   0   7  25   2  14   1   7   228    0    0   2.247     75  0.11
  153  153 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.004      0  1.00
  154  154 G   0   0   0   0   1   8  12   4   2   0  24   5   0   4   6   0   1   1  14  16   228    0    0   2.210     73  0.17
  155  155 G   1  97   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.156      5  0.99
  156  156 G   0   0   0   0   1   0   6   9  22   0  13   0   3   2   3   0   6   4  19  13   228    0    0   2.168     72  0.24
  157  157 G   4   0   1   0   0   0   5   4   1   0   4  13   3   0   4   1  10  10  30  10   228    0    0   2.259     75  0.24
  158  158 G   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   228    0    0   0.028      0  0.99
  159  159 G   0   1   0   0   0   0   0   0   1   0   0   0   0   2   4  22  57   2   7   1   228    0    0   1.359     45  0.49
  160  160 G   0  98   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.135      4  0.98
  161  161 G   1   0   0   0   0   0   0   0   0   0   3  18   0   4   3   8  55   6   2   0   228    0    0   1.529     51  0.37
  162  162 G   1   0   0   0   0   0   0   0   4   0  61   0   0   1   7   0   2  23   0   0   228    0    0   1.186     39  0.42
  163  163 G   7  57  36   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.875     29  0.74
  164  164 G   0   0   0   0   0   0   0   1   0  94   1   0   0   0   0   0   0   3   0   0   228    0    0   0.321     10  0.89
  165  165 G   1   2   1   0   0   0   0   0  25  12   4   1   0   8   4   9   0  20   6   4   228    0    0   2.222     74  0.23
  166  166 G   0   0   0   0   0   0   0  91   0   0   0   0   0   0   2   1   0   4   0   1   228    0    0   0.442     14  0.84
  167  167 G  36  28   7   0   1   0   0   0  27   0   0   0   0   0   0   0   0   0   0   0   228    0    0   1.322     44  0.45
  168  168 G   0  25   1   0  71   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0   228    0    0   0.740     24  0.82
  169  169 G   1   0   0   0   0   0   0   0   2   0   1   0   0   2   2   3   3   2  11  73   228    0    0   1.104     36  0.65
  170  170 G   0   3   0   1   0   0   0  19   0   1   2   5   0   1   3  56   0   1   4   4   228    0    0   1.518     50  0.33
  171  171 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   222    0    0   0.029      0  0.99
  172  172 G   4   0   0   0   0   0   0   8   7   1   0  57   0   0   4   0   1  15   0   1   227    0    0   1.490     49  0.40
  173  173 G   0   3   0   0   0   0   0   0   1   0   4   2   0   2   2   8  11  23  41   3   228    0    0   1.776     59  0.40
  174  174 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.028      0  0.99
  175  175 G   0   0   0   0   0   0   0   2   0   0   0  11   0   0   1  21  27  13   3  22   228    0    0   1.788     59  0.38
  176  176 G   0   3   1   1   0   0   0   0   0   0   0  70   0   4   5   6   1   5   0   1   228    0    0   1.262     42  0.51
  177  177 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.028      0  1.00
  178  178 G   1  10   0   0   2   7  28   2   4   0  12   2   0   3   5   0   3   6   5  11   228    0    0   2.365     78  0.09
  179  179 G   0  97   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.150      4  0.98
  180  180 G   0   2   0   0   3   0   3   1   0   0  22   2   0   4  12   0  31   4   6  10   228    0    0   2.017     67  0.24
  181  181 G   1   1   2   0   0   0   2  10   0   0   4  14   0   0   6   2  11  14  25   8   228    0    0   2.202     73  0.28
  182  182 G   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  99   0   228    0    0   0.033      1  0.99
  183  183 G   0   4   0   0   0   7   0   1   0   0   9   0   0   0   5   7  58   8   0   0   228    0    0   1.485     49  0.35
  184  184 G   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.000      0  1.00
  185  185 G   0   0   0   0   0   0   9   0   0   2   1   2   0   1  29  15  41   0   0   0   228    0    0   1.504     50  0.29
  186  186 G   1   0   0   0   0   0   0   0   2   0  60  21   0   0  11   1   0   0   2   0   228    0    0   1.198     39  0.43
  187  187 G  67   5  27   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.801     26  0.82
  188  188 G   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   228    0    0   0.028      0  0.99
  189  189 G   0   0   0   0   1   0   0   0   0   0   2   2   0  36   3  23   1  16   8  10   228    0    0   1.767     58  0.33
  190  190 G   0   0   0   0   0   0   0  87   0   0   0   0   0   0   1   2   0   6   1   3   228    0    0   0.563     18  0.82
  191  191 G   4   2   1   0  25   0   0   0  68   0   0   1   0   0   0   0   0   0   0   0   228    0    0   0.907     30  0.31
  192  192 G   0   1   0   0  98   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.120      4  0.99
  193  193 G   1   0   0   0   0   0   0  19   0   3   0   1   0   0   0   1   0   2   8  64   228    0    0   1.174     39  0.60
  194  194 G   0   0   0   1   3   0   1   0   4   2  34   1   0   1  33   3   0   3   7   6   228    0    0   1.819     60  0.26
  195  195 G   0  82   0   0   0   0   0   3   0   0   0   0   0  11   1   0   0   0   0   0   228    0    0   0.721     24  0.55
  196  196 G   0  20   2   2   2   0   0   0   0   0  17   0   0   0   0  46   0   0   9   0   228    0    0   1.544     51  0.19
  197  197 G   0  86   7   0   4   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   228    0    0   0.542     18  0.86
  198  198 G   0   0   0   0   0   0   0   0   5  19   7  11   0   0   0  11  30   9   6   2   228    0    0   2.005     66  0.25
  199  199 G   0   4   1   4  17   1   8   1   0   0   3  42   0   6   4   1   1   0   3   5   228    0    0   2.002     66  0.13
  200  200 G  12  21  45   0   1   0   0   0  18   0   0   2   0   0   0   0   0   0   0   0   228    0    0   1.405     46  0.46
  201  201 G   3   2   2   1  30   4   8   0   0   0   0  29   0   0   4   0  12   1   0   3   228    0    0   1.966     65  0.12
  202  202 G   0  95   1   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.224      7  0.96
  203  203 G   0   6   3   0  11   1  14   0   1   0   4   9   0  25   4   0   7   5   5   6   228    0    0   2.363     78  0.13
  204  204 G   1   0   3   0   0   0   0  25   6   1  22   9   0   0   0   1   0  10  14   8   228    0    0   2.013     67  0.36
  205  205 G   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   228    0    0   0.028      0  0.99
  206  206 G   1   1   1   1   0   0   0   0   4  72   2   2   0   0   0   0  13   0   0   1   228    0    0   1.090     36  0.62
  207  207 G   0   0   0   0  11  89   0   0   0   0   0   0   0   0   0   0   0   0   0   0   227    0    0   0.365     12  0.97
  208  208 G   1  10   1   0   2   0   3   0   0   0   3   0   0   4   1   0   0   0  10  65   227    0    0   1.333     44  0.35
  209  209 G   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   227    0    0   0.000      0  1.00
  210  210 G   0   0   0   0   0   0   0   2   3   0  54   5   0   0   0   0   0  11  11  15   227    0    0   1.418     47  0.42
  211  211 G   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   224    0    0   0.029      0  0.99
  212  212 G   0   0   0   0   0   0   0   2   4   1  11   7   0   0  15   3   0  36  13   8   227    0    0   1.931     64  0.32
  213  213 G   2   7  91   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   226    0    0   0.377     12  0.91
  214  214 G   1  79   7   5   0   0   0   0   0   0   1   0   0   0   2   0   1   0   0   2   227    0    0   0.911     30  0.71
  215  215 G   0   0   0   0   0   0  96   0   0   0   0   0   0   1   0   0   0   0   0   2   227    0    0   0.215      7  0.90
  216  216 G   0  73   0   5  22   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   227    0    0   0.730     24  0.89
  217  217 G   3   1   0   0   0   0   1   1  10   0  48   1   0   0  33   2   1   0   0   0   227    0    0   1.352     45  0.32
  218  218 G   0   0   0   0   0   0   0   3   0   0   2   3   0   4  17  14  17   4  20  17   227    0    0   2.046     68  0.32
  219  219 G   0   0   0   0   6  93   0   0   0   0   0   0   0   0   0   0   0   0   0   0   227    0    0   0.260      8  0.97
  220  220 G   5  31  62   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   226    0    0   0.862     28  0.73
  221  221 G   2   3   0   0   0   0   0   4   8   0   0   1   0   0  44  11  18   2   3   4   226    0    0   1.815     60  0.31
  222  222 G   4   2   0   0   0   0   0   2   3   0   0   3   0   0   2  10   5  37   5  26   227    0    0   1.851     61  0.44
  223  223 G   0   0   0   0   0   0   0   0   0   0   0   0   0  10   0  22   0   0  67   0   227    0    0   0.873     29  0.62
  224  224 G   0   2   0   0   0   0   0   2  31   7  21   7   0   0   1   4  14   8   0   1   226    0    0   1.984     66  0.29
  225  225 G   0   0   0   0   1   0   0  21   4   1   9   0   0   0   0   4   4  15  21  19   226    0    0   1.980     66  0.39
  226  226 G   0   0   7   0   0   0   0   0   0   0   4   8   0   3   4  38   0   5  30   0   226    0    0   1.666     55  0.33
  227  227 G  94   0   2   1   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.315     10  0.92
  228  228 G   0   4   1  11   4   0  52   0   0   0   2   0   0   0   0  23   0   0   2   0    98    0    0   1.392     46  0.16
  229  229 G  27  23   3   5   1   1   0   4   0   1   0   1   0   1  20   3   2   3   3   0    94    0    0   2.069     69  0.15
  230  230 G   0   4   2   1   5  60   4   4   0   4   3   0   0   2   4   1   0   0   1   2    93    0    0   1.644     54  0.37
  231  231 G   4  10   1   0   0   0   0   1   1   0   3   8   0   0   0  47   0  10   2  13    93    0    0   1.740     58  0.23
  232  232 G   0   0   0   0   0   0   0  15   4   0   7   4   0   1   5   2  26  25   2   9    85    0    0   2.001     66  0.32
  233  233 G   0   0   0   0   0   0   0  78   3   0   6   6   0   0   0   0   0   0   3   4    79    0    0   0.850     28  0.71
  234  234 G  52   5   0   5   0   0   0   3   7   0  12   1   0   0   0   0   4   8   0   1    73    0    0   1.652     55  0.23
  235  235 G   0   0   0   0   0   0   0   8   4   0   0   5   3   0   0   0   1  16   5  57    74    0    0   1.421     47  0.52
  236  236 G  50   1   3   0   4   0  12   0   5   0   1   1   5   0   0   4   0   1   3   8    74    0    0   1.810     60  0.16
  237  237 G   1   3   0   0   0   0   0   4   0   4   0   5   0   0   8  58   7   9   0   0    74    0    0   1.498     49  0.34
  238  238 G   4   0   0   0   0   0   0   3  50   3  11   8   0   0   1   5   0   7   0   8    74    0    0   1.718     57  0.32
  239  239 G   5   0   0  54   0   0   1   8   0   1   0  11   0   0   0   0   0   8   0  11    74    0    0   1.495     49  0.18
  240  240 G   4   0   0   0   0   0   1   5   0  18   1  61   0   0   0   3   0   5   0   1    74    0    0   1.325     44  0.36
  241  241 G   5   0   0   0   0   0   0   0   4  27  34   5   0   0   1   5   0   0   0  18    74    0    0   1.687     56  0.24
  242  242 G   4   0   0   0   0   0   0  15  11   0   4   0   3   0   0   1   0   0  54   7    72    0    0   1.472     49  0.35
  243  243 G  86   4   0   0   0   0   0   0   0   7   0   0   0   0   0   0   3   0   0   0    72    0    0   0.546     18  0.73
  244  244 G   0   6   0   0   0   0   0   3  33   0   1  24   1   0   1   7   1  14   0   8    72    0    0   1.871     62  0.24
  245  245 G   0   0   3   0   0   0   0   0   0   0  63   6  18   0   0   6   0   4   0   1    72    0    0   1.215     40  0.44
  246  246 G  68   0   4   3   0   0   0   0   3   0  16   3   0   0   0   0   3   0   0   0    73    0    0   1.081     36  0.42
  247  247 G   0   7   0   0   0   0   0   3   0   1   0   5   0   0  22   3  41   5   0  12    73    0    0   1.714     57  0.27
  248  248 G   0   0   0   0   0   0   0   0   0   0   6   3  80   0   0   0   0   9   2   0    64    0    0   0.749     25  0.50
  249  249 G  20   0   0   3   0   0   0   3   8   0  11   0   0   3   0   2   3  13   0  34    64    0    0   1.890     63  0.21
  250  250 G   5   0   0   0   0   0   0   3   3   0   6   0   0   2   0   0   0   9  72   0    64    0    0   1.058     35  0.49
  251  251 G   3  17   3   5   0   2   0   0  13  13  41   2   0   0   0   3   0   0   0   0    64    0    0   1.787     59  0.19
  252  252 G   6   2   3   0   0   0   0   9  16   3   6   0   0   5   0   5   0   6   5  34    64    0    0   2.111     70  0.21
  253  253 G   0   2   0   0   0   0   0   6   0   2   2   6   0   0   0  41   0  13  22   8    64    0    0   1.699     56  0.32
  254  254 G   8   0  12   8  27   0   0   0   8   0   0  27   0   0   0   0   0   2   0   8    49    0    0   1.859     62  0.12
  255  255 G   0   0   0   0   2   0   4   0   2  68   5   5  11   4   0   0   0   0   0   0    56    0    0   1.198     39  0.39
  256  256 G  84   3   5   0   0   0   0   0   0   0   0   0   0   0   0   7   0   0   0   0    58    0    0   0.596     19  0.72
  257  257 G   0   0   0   0   2   0  78   0   0   0   5   0   0   7   0   0   0   7   0   0    55    0    0   0.805     26  0.51
  258  258 G   0   0   0   0   0   0   0   0   5  12   9  19   0   0   4  26   0   7  14   4    57    0    0   1.992     66  0.23
  259  259 G   2   0   0   0  10   0  69   0   0   0   0   7   0   2   0   0   0   0  10   0    58    0    0   1.050     35  0.40
  260  260 G   3   3   0   2   7   0   0   0   0  53   7  12   0   0   3   2   5   2   0   0    58    0    0   1.670     55  0.18
  261  261 G   0   0   0   2   0   0   0  74   3   0   2  10   0   0   0   0   9   0   0   0    58    0    0   0.924     30  0.49
  262  262 G   0   0   2   0   0   0   0   0   7   0   0  10   0   0   0  67   0   5   3   5    58    0    0   1.179     39  0.39
  263  263 G   0   0   2   0   0   0   0  65  11   0   2   0   0   2   0   0   0   5   2  11    55    0    0   1.211     40  0.55
  264  264 G   0   0  11   0   0   0   0   0   0   0   0   0  89   0   0   0   0   0   0   0    55    0    0   0.345     11  0.74
  265  265 G   0   0   0   0   0   0   0   4   2  84   5   2   0   0   0   0   0   0   4   0    55    0    0   0.695     23  0.73
  266  266 G   0   0   0   0   0   0   0   0   4  10   8  77   0   0   0   0   0   0   2   0    52    0    0   0.826     27  0.65
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
    27   252   268     1 pAe
    33     4    22     2 eTEi
    39     6    22     4 nVEIEv
    46   182   182     1 nIi
    47   180   180     1 eHm
    48   190   190     1 gHl
    49   181   181     1 gHi
    50     3     4     2 pWEm
    50    57    60     3 gILLl
    50    95   101     1 pLg
    50   193   200     1 gHl
    51     3    30     2 pSEm
    51   192   221     1 gHl
    52     5    24     2 pWEm
    52   194   215     1 gHl
    53     5    23     2 pWEm
    53   194   214     1 gHl
    54     6    22     2 pSEm
    54   195   213     1 gHi
    55     4     4     4 eTVTGc
    55    70    74     2 sPGl
    55   186   192     1 sRc
    56    71    83     2 gVFd
    56    91   105     2 pDGv
    56   192   208     1 lSs
    56   209   226     1 nDi
    57    70    83     2 gVFd
    57    90   105     2 pIGv
    57   191   208     1 lEk
    57   208   226     1 nDi
    58     4     4     4 eTVTGc
    58    70    74     2 sPGv
    58   171   177     1 lGk
    58   186   193     1 sTc
    59     4     4     4 eTVTGc
    59    70    74     2 pSGa
    59   171   177     1 lGk
    59   186   193     1 sNc
    60     4     5     4 eTVTGc
    60    70    75     2 sAGv
    60   171   178     1 lGk
    60   186   194     1 sRc
    61     4     5     4 eTVTGc
    61    70    75     2 sAGv
    61   171   178     1 lGk
    61   186   194     1 sRc
    62     4     5     4 eTVTGc
    62    70    75     2 sAGv
    62   171   178     1 lGk
    62   186   194     1 sRc
    63    71    83     2 sVFd
    63    91   105     2 pNGv
    63   192   208     1 lLn
    63   209   226     1 nDi
    64    71    80     2 gVFd
    64    91   102     2 pAGv
    64   190   203     1 lKs
    64   207   221     1 sDi
    65     4     4     4 eTVTGc
    65    70    74     2 pAGl
    65   171   177     1 lGk
    65   186   193     1 sVc
    66     4     5     4 eTVTGc
    66    70    75     2 sAGv
    66   171   178     1 lGk
    66   186   194     1 sRc
    67     4     5     4 eTVTGc
    67    70    75     2 sAGv
    67   171   178     1 lGk
    67   186   194     1 sRc
    68     4     5     4 eTVTGc
    68    70    75     2 sAGv
    68   171   178     1 lGk
    68   186   194     1 sRc
    69     4     5     4 eTVTGc
    69    70    75     2 sAGv
    69   171   178     1 lGk
    69   186   194     1 sRc
    70     4     5     4 eTVTGc
    70    70    75     2 sAGv
    70   171   178     1 lGk
    70   186   194     1 sRc
    71     4     5     4 eTVTGc
    71    70    75     2 sAGv
    71   171   178     1 lGk
    71   186   194     1 sRc
    72     4     5     4 eTVTGc
    72    70    75     2 sAGv
    72   171   178     1 lGk
    72   186   194     1 sRc
    73     4     5     4 eTVTGc
    73    70    75     2 sAGv
    73   171   178     1 lGk
    73   186   194     1 sRc
    74     4     5     4 eTVTGc
    74    70    75     2 sAGv
    74   171   178     1 lGk
    74   186   194     1 sRc
    75     4     5     4 eTVTGc
    75    70    75     2 sAGv
    75   171   178     1 lGk
    75   186   194     1 sRc
    76    71    83     2 sVFd
    76    91   105     2 pNGv
    76   192   208     1 lEk
    76   209   226     1 nDi
    77    57    69    24 yLGLEGNKLQTLPIGVFDQLVNLAEl
    77    71   107     2 gIFd
    77    91   129     2 pKGv
    77   192   232     1 lEk
    77   209   250     1 nGi
    78    71    83     2 sVFd
    78    91   105     2 pPGv
    78   192   208     1 lSs
    78   209   226     1 nDi
    79    71    94     2 gIFd
    79    91   116     2 pMGi
    79   192   219     1 lTs
    79   209   237     1 pGv
    80    72    72     2 gVFd
    80    92    94     2 pTLv
    80   193   197     1 lKs
    80   210   215     1 sDi
    81    71    82     2 gVFd
    81    91   104     2 pEGv
    81   192   207     1 lTk
    81   209   225     1 tDi
    82     4     4     4 eTVTGc
    82    70    74     2 sAGv
    82   171   177     1 lGk
    82   186   193     1 sRc
    83     4     4     4 eTVTGc
    83    70    74     2 pAGl
    83   171   177     1 lGk
    83   186   193     1 sNc
    84     4     4     4 eTVTGc
    84   164   168     1 sNc
    85     4     4     4 eTVTGc
    85    70    74     2 tADi
    85   171   177     1 lGk
    85   186   193     1 sRc
    86    68    81     2 pPGv
    86   169   184     1 lSs
    86   186   202     1 nDi
    87    68    81     2 pAGi
    87   169   184     1 lEk
    87   186   202     1 rDi
    88    68    81     2 pIGv
    88   169   184     1 lSk
    88   186   202     1 rDi
    89    68    81     2 pPGv
    89   169   184     1 lSs
    89   186   202     1 nDi
    90    68    81     2 pAGv
    90   169   184     1 lEk
    90   186   202     1 rDi
    91    69    81     2 pAGv
    91   170   184     1 lSn
    91   187   202     1 nDi
    92    69    81     2 pVGv
    92   170   184     1 lVq
    92   187   202     1 kDi
    93    69    81     2 pIGv
    93   170   184     1 lSs
    93   187   202     1 nDi
    94    68    81     2 pAGi
    94   169   184     1 lSn
    94   186   202     1 rDi
    95    68    81     2 pPGv
    95   169   184     1 lEk
    95   186   202     1 rDi
    96    71    83     2 gVFd
    96    91   105     2 pSGv
    96   167   183    24 kLTQLQKLWLDNNKLQSLPDGVFDKl
    96   192   232     1 lSs
    96   209   250     1 rDi
    97    69    81     2 pAGv
    97   170   184     1 lEk
    97   187   202     1 nGi
    98    68    81     2 tPGv
    98   169   184     1 lQn
    98   186   202     1 rDi
    99    71    83     2 gVFn
    99    91   105     2 pDGv
    99   167   183    24 kLTELKELSLFNNQLQRLPEGVFDKl
    99   192   232     1 lSs
    99   209   250     1 rDi
   100    68    81     2 pVGv
   100   169   184     1 lSs
   100   186   202     1 nDi
   101    72    72     2 gVFn
   101    92    94     2 pNGv
   101   192   196     1 lSs
   101   209   214     1 rDi
   102    72    72     2 gAFh
   102    92    94     2 pAGv
   102   193   197     1 lKs
   102   210   215     1 sDi
   103    70    70     2 pAGl
   103   170   172     1 lSs
   103   187   190     1 rDi
   104    69    80     2 pEGv
   104   170   183     1 lTf
   104   187   201     1 rDi
   105     4     4     4 eTVTGc
   105   149   153     1 lGk
   105   164   169     1 sTc
   106     4     4     4 eTVTGc
   106   149   153     1 lTk
   106   164   169     1 sNc
   107     4     4     4 eTVTGc
   107    70    74     2 pSGv
   107   171   177     1 lGk
   107   186   193     1 sQc
   108     4     4     4 eTVTGc
   108    70    74     2 pAGl
   108   171   177     1 lGk
   108   186   193     1 gAc
   109     4     4     4 eTVTGc
   109   149   153     1 lGk
   109   164   169     1 sRc
   110     4     4     4 eTVTGc
   110    70    74     2 sAGv
   110   171   177     1 lGk
   110   186   193     1 sNc
   111     4     4     4 eTVTGc
   111   149   153     1 lGk
   111   164   169     1 sRc
   112     4     4     4 eTVTGc
   112   149   153     1 lGk
   112   164   169     1 sNc
   113     4     4     4 eTVTGc
   113    70    74     2 sAGv
   113   171   177     1 lGk
   113   186   193     1 sRc
   114     4     4     4 eTVTGc
   114    70    74     2 pADv
   114   171   177     1 lGk
   114   186   193     1 sRc
   115    68    81     2 pDGv
   115   169   184     1 lQn
   115   186   202     1 rDi
   116    68    81     2 pPGv
   116   169   184     1 lSs
   116   184   200     1 sCr
   117    69    81     2 pPGv
   117   170   184     1 lSs
   117   187   202     1 rDi
   118    68    81     2 pAGv
   118   169   184     1 lEk
   118   186   202     1 nGi
   119    69    81     2 pAGv
   119   170   184     1 lEk
   119   187   202     1 nGi
   120    69    81     2 pIGv
   120   170   184     1 lQn
   120   187   202     1 rDi
   121    69    81     2 pAGv
   121   170   184     1 lEk
   121   187   202     1 nDi
   122    69    81     2 pEGv
   122   170   184     1 lEk
   122   187   202     1 nDi
   123    69    81     2 pPGv
   123   170   184     1 lEk
   123   187   202     1 nDi
   124    69    81     2 pAGv
   124   170   184     1 lSs
   124   187   202     1 kDi
   125    69    81     2 pPGv
   125   170   184     1 lSn
   125   187   202     1 kDi
   126    69    81     2 pEGv
   126   170   184     1 lEk
   126   187   202     1 nDi
   127    69    81     2 pTGv
   127   170   184     1 lSn
   127   187   202     1 kDi
   128    70    81     2 pAGv
   128   171   184     1 lTk
   128   188   202     1 aSi
   129     4    13     2 tCSn
   129    70    81     2 pAGl
   129   171   184     1 lAk
   129   188   202     1 sDi
   130     6    13     2 tCSn
   130    72    81     2 pAGl
   130   173   184     1 lAk
   130   190   202     1 sDi
   131    72    72     2 gVFd
   131    92    94     2 pAGv
   131   193   197     1 lKs
   131   210   215     1 sDi
   132    72    72     2 gVFd
   132    92    94     2 pVGv
   132   193   197     1 lKs
   132   210   215     1 tYi
   133    71    94     2 gVFd
   133    91   116     2 pNGv
   133   192   219     1 lTr
   133   209   237     1 pGi
   134    71   102     2 gVFd
   134    91   124     2 pRGv
   134   192   227     1 lVk
   134   209   245     1 nDi
   135    71   102     2 gVFd
   135    91   124     2 pRGv
   135   192   227     1 lVk
   135   209   245     1 nDi
   136    69    92     2 pDGv
   136   170   195     1 lTs
   136   187   213     1 pGi
   137    69    80     2 pVGv
   137   170   183     1 lTf
   137   187   201     1 rDi
   138    69    80     2 pARv
   138   169   182     1 lSs
   138   186   200     1 rDi
   139     4     4     4 eTVTGc
   139   149   153     1 lGk
   139   164   169     1 sNc
   140     4     4     4 eTVTGc
   140    70    74     2 pAGl
   140   171   177     1 lGk
   140   186   193     1 sAc
   141     4     4     4 eTVTGc
   141    70    74     2 sAGv
   141   171   177     1 lGk
   141   186   193     1 sRc
   142     4     4     4 eTVTGc
   142   149   153     1 lGk
   142   164   169     1 sRc
   143     4     4     4 eTVTGc
   143   149   153     1 lGk
   143   164   169     1 sVc
   144     4     4     4 eTVTGc
   144   149   153     1 lRs
   144   164   169     1 sNc
   145     4     4     4 eTVTGc
   145   149   153     1 lTk
   145   164   169     1 sSc
   146     4     4     4 eTVTGc
   146   149   153     1 lGk
   146   164   169     1 sTc
   147     4     4     4 eTVTGc
   147   149   153     1 lGk
   147   164   169     1 sRc
   148     4     4     4 eTVTGc
   148   149   153     1 lTk
   148   164   169     1 sRc
   149     4     4     4 eTVTGc
   149   149   153     1 lTk
   149   164   169     1 sNc
   150     4     4     4 eTVTGc
   150    70    74     2 pADv
   150   171   177     1 lGk
   150   186   193     1 sQc
   151     4     4     4 eTVTGc
   151   149   153     1 lGk
   151   164   169     1 sNc
   152   148   160     1 lEk
   152   165   178     1 rDi
   153    69    81     2 sAGv
   153   170   184     1 lEk
   153   187   202     1 rDi
   154    69    81     2 pVGv
   154   170   184     1 lSs
   154   187   202     1 nGi
   155    69    81     2 pEGv
   155   170   184     1 lQn
   155   187   202     1 rDi
   156    69    81     2 pPGv
   156   170   184     1 lSk
   156   187   202     1 kDi
   157    71    83     2 gVFd
   157    91   105     2 pNGv
   157   167   183    24 kLTQLTTLYLHQNQLQSLPNGVFDKl
   157   192   232     1 lLn
   157   209   250     1 nDi
   158   148   160     1 lSs
   158   165   178     1 kDi
   159    71    83     2 gIFk
   159    91   105     2 pIGv
   159   167   183    24 kLTKLTLLYLDTNKLQSLPNGVFDKl
   159   192   232     1 lSs
   159   209   250     1 nDi
   160    69    81     2 pIGv
   160   170   184     1 lEk
   160   187   202     1 nDi
   161   148   160     1 lSs
   161   165   178     1 rDi
   162    69    81     2 pPGv
   162   170   184     1 lQn
   162   187   202     1 rDi
   163     6    13     2 tCSn
   163    72    81     2 pVGv
   163   173   184     1 lKa
   163   190   202     1 aSi
   164     6    13     2 tCSn
   164    72    81     2 pVGv
   164   173   184     1 lTk
   164   190   202     1 sDi
   165     6    13     2 tCSn
   165   151   160     1 lAk
   165   168   178     1 aSi
   166    71    72     2 gVFd
   166    91    94     2 pADv
   166   167   172    23 rLVHLKELFMCCNKLTELPRGIERl
   166   192   220     1 lSs
   166   209   238     1 rDi
   167    71   102     2 gVFd
   167    91   124     2 pPRv
   167   167   202    24 nLPLLKELYLRENQLQRLPKGVFDKl
   167   192   251     1 lSs
   167   209   269     1 rDi
   168    71    97     2 gVFd
   168    91   119     2 pRGv
   168   192   222     1 lSs
   168   207   238     1 aSc
   168   250   282     1 nKi
   169   148   159     1 lSs
   169   165   177     1 rDi
   170    69    80     2 pEGv
   170   169   182     1 lSs
   170   186   200     1 rDi
   171     4     4     4 eTVTGc
   171   149   153     1 lGk
   171   164   169     1 sRc
   172     4     4     4 eTVTGc
   172   149   153     1 lGk
   172   164   169     1 sRc
   173     4     4     4 eTVTGc
   173   149   153     1 lTk
   173   164   169     1 sSc
   174     4     4     4 eTVTGc
   174   149   153     1 lGk
   174   164   169     1 sTc
   175     4     4     4 eTVTGc
   175    70    74     2 lAGv
   175   171   177     1 lRk
   175   186   193     1 sTc
   176     4     4     4 eTVTGc
   176   149   153     1 lGk
   176   164   169     1 sTc
   177     4     4     4 eTVTGc
   177    70    74     2 pEGv
   177   171   177     1 lGk
   177   186   193     1 sTc
   178     4     4     4 eTVTGc
   178   149   153     1 lKk
   178   164   169     1 sNc
   179     4     4     4 eTVTGc
   179   149   153     1 lGk
   179   164   169     1 sVc
   180     4     4     4 eTVTGc
   180   149   153     1 lGk
   180   164   169     1 sTc
   181     4     4     4 eTVTGc
   181   149   153     1 lGk
   181   164   169     1 sSc
   182     4     4     4 eTVTGc
   182    70    74     2 pDRl
   182   171   177     1 lGk
   182   186   193     1 gSc
   183     4     4     4 eTVTGc
   183   149   153     1 lGk
   183   164   169     1 sRc
   184     4     4     4 eTVTGc
   184   149   153     1 lGn
   184   164   169     1 gSc
   185     4     4     4 eTVTGc
   185   149   153     1 lGk
   185   164   169     1 sNc
   186     4     4     4 eTVTGc
   186   149   153     1 lGk
   186   164   169     1 sTc
   187    69    81     2 pTGv
   187   170   184     1 lSn
   187   187   202     1 rDi
   188    69    81     2 pASv
   188   170   184     1 lQn
   188   187   202     1 rDi
   189     6    13     2 tCSn
   189    72    81     2 pAGv
   189   173   184     1 lAd
   189   190   202     1 aSi
   190     6    13     2 tCSn
   190   151   160     1 lTk
   190   168   178     1 aSi
   191     6    13     2 tCSn
   191   151   160     1 lGk
   191   168   178     1 aSi
   192     5    21     2 tTEk
   192    26    44     1 pIt
   192   193   212     1 lAn
   193     3    10     1 gEq
   193    69    77     2 pAGv
   193   169   179     1 lSs
   193   186   197     1 rDi
   194    71    97     2 gVFd
   194    91   119     2 pPKi
   194   192   222     1 lSk
   194   207   238     1 eSc
   194   250   282     1 nKi
   195     4     4     4 eTVTGc
   195   149   153     1 lGk
   195   164   169     1 sTc
   196     4     4     4 eTVTGc
   196   149   153     1 lGk
   196   164   169     1 sTc
   197     4     4     4 eTVTGc
   197   149   153     1 lGk
   197   164   169     1 sTc
   198     4     4     4 eTVTGc
   198   149   153     1 lGk
   198   164   169     1 sRc
   199     4     4     4 eTVTGc
   199    70    74     2 pVGv
   199   171   177     1 lGk
   199   186   193     1 sRc
   200     4     4     4 eTVTGc
   200    70    74     2 sDDv
   200   171   177     1 lGk
   200   186   193     1 sQc
   201     4     4     4 eTVTGc
   201   149   153     1 lGk
   201   164   169     1 sRc
   202     4     4     4 eTVTGc
   202   149   153     1 lGk
   202   164   169     1 sQc
   203     4     4     4 eTVTGc
   203   149   153     1 lRs
   203   164   169     1 sNc
   204     4     4     4 eTVTGc
   204   149   153     1 lGk
   204   164   169     1 sNc
   205     4     4     4 eTVTGc
   205    70    74     2 pPGv
   205   171   177     1 lGk
   205   186   193     1 sQc
   206     4     4     4 eTVTGc
   206   149   153     1 lGk
   206   164   169     1 sVc
   207     4     4     4 eTVTGc
   207   149   153     1 lGs
   207   164   169     1 sTc
   208     4     4     4 eTVTGc
   208   149   153     1 lTn
   208   164   169     1 sRc
   209     4     4     4 eTVTGc
   209   149   153     1 lGk
   209   164   169     1 sQc
   210     4     4     4 eTVTGc
   210   149   153     1 lGk
   210   164   169     1 sRc
   211     4     4     4 eTVTGc
   211   149   153     1 lTk
   211   164   169     1 gSc
   212     4     4     4 eTVTGc
   212   149   153     1 lGk
   212   164   169     1 sTc
   213    69    81     2 sAGv
   213   170   184     1 lSn
   213   187   202     1 nGi
   214    69    81     2 pAGi
   214   145   159    24 kLTEXRTLEMRNNQLPRVPDGVFDKl
   214   170   208     1 lSs
   214   187   226     1 rDi
   215    57    69    24 yLNLDTNQLQTLPPGVFDHLVALGTl
   215    71   107     2 gVFd
   215    91   129     2 pDGv
   215   167   207    24 kLTKLTLLYLDQNKLQSLPHGVFDKl
   215   192   256     1 lSs
   215   209   274     1 rDi
   216    29    98    24 gLHLSSNGLKNLSARFLLPVPQLKVl
   216    43   136     2 gLFq
   216    63   158     2 qASw
   216   139   236    24 pQPNLHHLFLGNNQLATVAASTFQGl
   216   164   285     8 lGKPRAAQDm
   216   180   309     1 qNl
   217    36   104    24 eLHLSTNQLESLSPKFLLPVPLLKVl
   217    50   142     2 gLFr
   217    70   164     2 ePSw
   217   146   242    24 pQPDLRYLFLNDNRLATVAAGAFQGl
   217   171   291     6 lGQPTRDm
   217   187   313     1 eKl
   218   148   148     1 lSs
   218   165   166     1 rDi
   219    69   100     2 pTGv
   219   170   203     1 lLn
   219   187   221     1 rDi
   220    69   100     2 pAGi
   220   170   203     1 lSn
   220   187   221     1 nDi
   221    69   100     2 pAGv
   221   170   203     1 lLn
   221   187   221     1 rDi
   222    69   100     2 pPGv
   222   170   203     1 lSn
   222   187   221     1 nDi
   223    69   100     2 pAGi
   223   145   178    24 kLTSLKELRLYNNQLKRVPEGAFDKl
   223   170   227     1 lEk
   223   187   245     1 nGi
   224   148   157     1 lKs
   224   165   175     1 rDi
   225    71    97     2 gVFd
   225    91   119     2 pPGv
   225   192   222     1 lSk
   225   207   238     1 eSc
   226     3    29     2 sTGc
   226    67    95     2 pAGi
   226   168   198     1 lSk
   226   183   214     1 eSc
   227    35    97    24 eLHLSTNQLESLSPKFLLPVPLLKVl
   227    49   135     2 gLFr
   227    69   157     2 ePSw
   227   145   235    24 pQPDLRYLFLNDNRLATVAAGAFQGl
   227   170   284     6 lGQPTRDm
   227   186   306     1 eKl
//