Complet list of 1oaq hssp fileClick here to see the 3D structure Complete list of 1oaq.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1OAQ
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-11-09
HEADER     IMMUNE SYSTEM, ALLERGY, IGE, CONFORMATI 2004-01-15 1OAQ
COMPND     HEAVY CHAIN; LIGHT CHAIN
SOURCE     MUS MUSCULUS; MUS MUSCULUS
AUTHOR     James, L.C.; Roversi, P.; Tawfik, D.
SEQLENGTH   230
NCHAIN        2 chain(s) in 1OAQ data set
NALIGN     2064
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : LV1A_MOUSE  1SM3    0.99  1.00  122  218   21  117   97    0    0  117  P01723     Ig lambda-1 chain V region OS=Mus musculus PE=1 SV=2
    2 : A2MXS5_MOUSE        0.98  0.99  122  218    1   97   97    0    0   97  A2MXS5     A6 anti-[4-hydroxy-3-nitrophenyl(Phenolate form)] acetyl mAb V-L region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
    3 : LV1B_MOUSE  1Q0Y    0.98  0.99  122  231   20  129  110    0    0  129  P01724     Ig lambda-1 chain V regions MOPC 104E/RPC20/J558/S104 OS=Mus musculus PE=1 SV=1
    4 : A2NVW1_MOUSE        0.97  0.98  122  220    1   99   99    0    0   99  A2NVW1     Light chain variable region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
    5 : A2NVW3_MOUSE        0.97  0.99  122  220    1   99   99    0    0   99  A2NVW3     Light chain variable region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
    6 : A2MXS7_MOUSE        0.96  0.98    1   97    1   97   97    0    0   98  A2MXS7     A6 anti-[4-hydroxy-3-nitrophenyl(Phenolate form)] acetyl mAb V-H region (Fragment) OS=Mus musculus PE=2 SV=1
    7 : G0YP42_MOUSE        0.96  0.98  122  231   20  129  110    0    0  234  G0YP42     Anti-human Langerin 2G3 lambda chain OS=Mus musculus PE=2 SV=1
    8 : HVM10_MOUSE         0.96  0.99    1   98   20  117   98    0    0  117  P01754     Ig heavy chain V region 1-62-3 OS=Mus musculus GN=Ighv1-62-3 PE=4 SV=2
    9 : HVM49_MOUSE         0.96  0.99    2   98   21  117   97    0    0  117  P06328     Ig heavy chain V region VH558 B4 OS=Mus musculus PE=4 SV=1
   10 : LV1D_MOUSE          0.96  0.99  122  231   20  129  110    0    0  129  P01726     Ig lambda-1 chain V region H2020 OS=Mus musculus PE=3 SV=1
   11 : LV1E_MOUSE          0.96  0.99  122  231   20  129  110    0    0  129  P01727     Ig lambda-1 chain V region S43 OS=Mus musculus PE=3 SV=1
   12 : A2NVW5_MOUSE        0.95  0.98  122  220    1   99   99    0    0   99  A2NVW5     Light chain variable region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
   13 : LV1C_MOUSE          0.95  0.98  122  231    1  110  110    0    0  110  P01725     Ig lambda-1 chain V region S178 OS=Mus musculus PE=1 SV=1
   14 : Q8VDE2_MOUSE        0.95  0.96  122  231   20  129  110    0    0  129  Q8VDE2     Immunoglobulin lambda chain variable region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
   15 : A2MY58_MOUSE        0.94  0.98  122  230    1  109  109    0    0  109  A2MY58     Lambda (Fragment) OS=Mus musculus GN=lambda PE=2 SV=1
   16 : HVM07_MOUSE 1NQB    0.94  0.98    1  120   20  139  120    0    0  139  P01751     Ig heavy chain V region B1-8/186-2 OS=Mus musculus GN=Gm16709 PE=1 SV=1
   17 : HVM09_MOUSE         0.94  0.98    1   98   20  117   98    0    0  117  P01753     Ig heavy chain V region 186-1 OS=Mus musculus PE=4 SV=2
   18 : Q8CGS1_MOUSE        0.94  0.96  122  231    1  111  111    1    1  113  Q8CGS1     Anti-deoxynivalenol scFv lambda light chain variable region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
   19 : Q924Q7_MOUSE        0.94  0.98    1  120    1  120  120    0    0  145  Q924Q7     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   20 : A2NVW4_MOUSE        0.93  0.96  122  220    1   99   99    0    0   99  A2NVW4     Light chain variable region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
   21 : Q924R8_MOUSE        0.93  0.97    1  120    1  121  121    1    1  146  Q924R8     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   22 : A4FU62_MOUSE        0.92  0.95  122  231   20  129  110    0    0  233  A4FU62     LOC207685 protein (Fragment) OS=Mus musculus GN=LOC207685 PE=2 SV=1
   23 : Q9ET13_MOUSE        0.92  0.97  122  231    1  109  110    1    1  109  Q9ET13     Imunoglobulin light chain variable region (Fragment) OS=Mus musculus GN=Iglv1 PE=2 SV=1
   24 : A2NVW2_MOUSE        0.91  0.96  122  220    1   99   99    0    0   99  A2NVW2     Light chain variable region (Fragment) OS=Mus musculus GN=Iglv2 PE=2 SV=1
   25 : LV2A_MOUSE          0.91  0.96  122  219   20  117   98    0    0  117  P01728     Ig lambda-2 chain V region OS=Mus musculus PE=3 SV=1
   26 : Q924R3_MOUSE        0.91  0.94    1  120    1  120  120    0    0  145  Q924R3     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   27 : A2KTK0_MOUSE        0.90  0.94    8  112    1  103  105    1    2  103  A2KTK0     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   28 : A2KTK5_MOUSE        0.90  0.91    8  112    1  103  105    1    2  103  A2KTK5     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   29 : I0ITL1_MOUSE        0.90  0.95    1  116    1  113  116    1    3  113  I0ITL1     I (Fragment) OS=Mus musculus GN=IgVH PE=2 SV=1
   30 : Q924Q4_MOUSE        0.90  0.93    1  120    1  116  120    1    4  141  Q924Q4     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   31 : Q924Q5_MOUSE        0.90  0.93    1  120    1  118  120    1    2  143  Q924Q5     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   32 : Q924R4_MOUSE        0.90  0.94    1  120    1  120  120    0    0  145  Q924R4     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   33 : A2KTK1_MOUSE        0.89  0.93    8  112    1  103  105    1    2  103  A2KTK1     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   34 : A2KTK7_MOUSE        0.89  0.92    8  112    1  103  105    1    2  103  A2KTK7     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   35 : A2MXS6_MOUSE        0.89  0.91  122  218    1   97   97    0    0   97  A2MXS6     E3 anti-[4-hydroxy-3-nitrophenyl(Phenolate + phenolic form)] acetyl mAb V-L region (Fragment) OS=Mus musculus PE=2 SV=1
   36 : LV2B_MOUSE          0.89  0.96  122  231   20  129  110    0    0  129  P01729     Ig lambda-2 chain V region MOPC 315 OS=Mus musculus PE=1 SV=1
   37 : Q924Q3_MOUSE        0.89  0.93    1  120    1  121  121    1    1  146  Q924Q3     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   38 : Q924Q6_MOUSE1I8M    0.89  0.93    1  120    1  120  120    0    0  145  Q924Q6     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=1 SV=1
   39 : Q924Q8_MOUSE        0.89  0.93    1  120    1  121  121    1    1  146  Q924Q8     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   40 : Q924Q9_MOUSE        0.89  0.93    1  120    1  120  120    0    0  145  Q924Q9     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   41 : Q924R1_MOUSE        0.89  0.94    1  120    1  120  120    0    0  145  Q924R1     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
   42 : Q924R7_MOUSE        0.89  0.94    1  120    1  118  120    1    2  143  Q924R7     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   43 : A2KTK8_MOUSE        0.88  0.91    8  111    1  102  104    1    2  102  A2KTK8     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   44 : HVM04_MOUSE         0.88  0.95    1   98   20  117   98    0    0  117  P01748     Ig heavy chain V region 23 OS=Mus musculus PE=4 SV=1
   45 : Q91VA2_MOUSE        0.88  0.94    1  120    1  118  120    1    2  143  Q91VA2     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   46 : Q924P5_MOUSE        0.88  0.92    1  120    1  119  120    1    1  144  Q924P5     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   47 : Q924P7_MOUSE        0.88  0.94    1  120    1  120  120    0    0  145  Q924P7     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   48 : Q924R0_MOUSE        0.88  0.93    1  120    1  118  120    1    2  143  Q924R0     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   49 : Q924R2_MOUSE        0.88  0.93    1  120    1  115  120    1    5  140  Q924R2     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   50 : Q924R6_MOUSE        0.88  0.92    1  120    1  112  120    2    8  137  Q924R6     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   51 : A2KTK9_MOUSE        0.87  0.90    8  112    1  103  105    1    2  103  A2KTK9     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   52 : HVM06_MOUSE 1QNZ    0.87  1.00    1   97   20  116   97    0    0  117  P01750     Ig heavy chain V region 102 OS=Mus musculus PE=1 SV=1
   53 : Q8K172_MOUSE        0.87  0.92    1  120   20  137  121    3    4  482  Q8K172     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
   54 : HVM11_MOUSE 2FAT    0.86  0.93    1  120   20  137  120    1    2  137  P01755     Ig heavy chain V region S43 OS=Mus musculus PE=1 SV=1
   55 : F1MAE7_RAT          0.84  0.93  122  218    5  101   97    0    0  101  F1MAE7     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
   56 : HVM05_MOUSE 1A14    0.84  0.95    1   98   20  117   98    0    0  117  P01749     Ig heavy chain V region 3 OS=Mus musculus GN=Igh-VJ558 PE=1 SV=1
   57 : Q924P6_MOUSE        0.84  0.91    1  120    1  118  120    1    2  143  Q924P6     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   58 : Q924R5_MOUSE        0.84  0.90    1  120    1  114  120    1    6  139  Q924R5     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
   59 : A0N7H8_9MURI        0.83  0.93    1  120    1  117  120    1    3  117  A0N7H8     Anti-anti-Id Ab3-2C4 (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
   60 : A2KTJ9_MOUSE        0.83  0.93    8  112    1  103  105    1    2  103  A2KTJ9     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   61 : A2NB68_RAT          0.83  0.90  122  224   20  120  103    1    2  120  A2NB68     Productively rearranged V-lambda-1 (Precursor) OS=Rattus norvegicus PE=2 SV=1
   62 : HVM14_MOUSE         0.83  0.91    1   98   20  117   98    0    0  117  P01758     Ig heavy chain V region 108A OS=Mus musculus GN=Igh-VJ558 PE=4 SV=1
   63 : L7N238_MOUSE        0.83  0.91    1   98    7  104   98    0    0  111  L7N238     Protein Ighv1-83 OS=Mus musculus GN=Ighv1-83 PE=4 SV=1
   64 : Q924Q0_MOUSE2FD6    0.83  0.90    1  120    1  118  120    1    2  143  Q924Q0     V165-D-J-C mu protein (Fragment) OS=Mus musculus GN=V165-D-J-C mu PE=1 SV=1
   65 : A2NB72_RAT          0.82  0.91  122  225   20  123  104    0    0  123  A2NB72     Productively rearranged V-lambda-1 (Precursor) OS=Rattus norvegicus PE=2 SV=1
   66 : D3ZCD6_RAT          0.82  0.93    1   98   20  117   98    0    0  118  D3ZCD6     RCG21069 OS=Rattus norvegicus GN=rCG_21069 PE=4 SV=2
   67 : HVM03_MOUSE 1JFQ    0.82  0.92    2  120    1  120  120    1    1  120  P01747     Ig heavy chain V region 36-65 OS=Mus musculus PE=1 SV=1
   68 : HVM52_MOUSE         0.82  0.95    1   98   20  117   98    0    0  117  P06327     Ig heavy chain V region VH558 A1/A4 OS=Mus musculus GN=Gm5629 PE=4 SV=1
   69 : K7TD20_MOUSE        0.82  0.88    9  120    1  109  112    1    3  109  K7TD20     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   70 : K7TD54_MOUSE        0.82  0.88    9  120    1  111  112    1    1  111  K7TD54     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   71 : M0RBX3_RAT          0.82  0.97    1   98   20  117   98    0    0  117  M0RBX3     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
   72 : Q924P8_MOUSE        0.82  0.91    1  120    1  115  120    1    5  140  Q924P8     V23-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighv1-53 PE=2 SV=1
   73 : Q924Q1_MOUSE        0.82  0.92    1  120    1  117  120    1    3  142  Q924Q1     V23-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighv1-53 PE=2 SV=1
   74 : Q9D9B8_MOUSE        0.82  0.95    1   98    7  104   98    0    0  111  Q9D9B8     Putative uncharacterized protein OS=Mus musculus GN=Igh-VJ558 PE=4 SV=1
   75 : Q9JL75_MOUSE1P7K    0.82  0.89   10  120    1  109  111    1    2  109  Q9JL75     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   76 : A2KTK2_MOUSE        0.81  0.92    8  112    1  106  106    1    1  106  A2KTK2     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   77 : A2NB79_RAT          0.81  0.91  122  224   20  122  103    0    0  122  A2NB79     Productively rearranged V-lambda-1 (Precursor) OS=Rattus norvegicus PE=2 SV=1
   78 : M0R693_RAT          0.81  0.92    1   98   20  117   98    0    0  117  M0R693     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
   79 : Q65ZR6_MOUSE        0.81  0.88    1  120   18  134  120    1    3  134  Q65ZR6     Ab 126.33 heavy chain variable and joining regions (Fragment) OS=Mus musculus PE=2 SV=1
   80 : Q9JL81_MOUSE        0.81  0.92    9  120    1  114  114    2    2  114  Q9JL81     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   81 : A0N1D5_MOUSE        0.80  0.93    1   97   20  116   97    0    0  116  A0N1D5     VH104B protein (Precursor) OS=Mus musculus GN=VH104B PE=4 SV=1
   82 : A2KTK4_MOUSE        0.80  0.91    8  112    1  106  106    1    1  106  A2KTK4     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   83 : A2KTL0_MOUSE        0.80  0.89    8  112    1  104  105    1    1  104  A2KTL0     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHVDJ PE=4 SV=1
   84 : K7T993_MOUSE        0.80  0.90    9  120    1  112  112    0    0  112  K7T993     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   85 : K7U5V5_MOUSE        0.80  0.89    9  120    1  107  112    1    5  107  K7U5V5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   86 : Q7TPE3_MOUSE        0.80  0.90    4  120    1  117  119    3    4  136  Q7TPE3     V23-D-J-IgG1 protein (Fragment) OS=Mus musculus GN=V23-D-J-IgG1 PE=2 SV=1
   87 : Q924P9_MOUSE        0.80  0.90    1  120    1  118  121    2    4  143  Q924P9     V303-D-J-C mu protein (Fragment) OS=Mus musculus GN=V303-D-J-C mu PE=2 SV=1
   88 : K7T9T8_MOUSE        0.79  0.87    9  120    1  113  113    1    1  113  K7T9T8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   89 : Q6PJB2_MOUSE1YNK    0.79  0.87    1  120   20  135  121    2    6  465  Q6PJB2     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   90 : Q8K0F2_MOUSE        0.79  0.90    1  120   20  143  124    3    4  488  Q8K0F2     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
   91 : Q924Q2_MOUSE        0.79  0.88    1  120    1  117  120    1    3  142  Q924Q2     V303-D-J-C mu protein (Fragment) OS=Mus musculus GN=V303-D-J-C mu PE=2 SV=1
   92 : Q9QXF0_MOUSE        0.79  0.87    1  120    1  117  120    1    3  117  Q9QXF0     Immunoglobulin heavy chain V-D-J region (Fragment) OS=Mus musculus PE=2 SV=1
   93 : A0N1R4_MOUSE        0.78  0.89    1   98   20  117   98    0    0  117  A0N1R4     Immunglobulin heavy chain (Precursor) OS=Mus musculus PE=4 SV=1
   94 : A0N1R5_MOUSE        0.78  0.89    1   98   20  117   98    0    0  117  A0N1R5     Immunglobulin heavy chain (Precursor) OS=Mus musculus domesticus PE=4 SV=1
   95 : D3ZFF8_RAT          0.78  0.89    1   98   21  118   98    0    0  119  D3ZFF8     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
   96 : D4A4L6_RAT          0.78  0.88    1   98   20  117   98    0    0  117  D4A4L6     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
   97 : D4A5Y5_RAT          0.78  0.91    1   98   20  117   98    0    0  118  D4A5Y5     Uncharacterized protein OS=Rattus norvegicus GN=LOC100363779 PE=4 SV=2
   98 : F1LYM5_RAT          0.78  0.91    1   98    6  103   98    0    0  103  F1LYM5     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
   99 : HVM02_MOUSE         0.78  0.89    1  120   20  140  122    3    3  140  P01746     Ig heavy chain V region 93G7 OS=Mus musculus PE=2 SV=1
  100 : HVM50_MOUSE         0.78  0.91    1  120    1  120  120    0    0  120  P06329     Ig heavy chain V region AC38 15.3 OS=Mus musculus PE=1 SV=1
  101 : I3MSW8_SPETR        0.78  0.92  122  219   20  117   98    0    0  117  I3MSW8     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
  102 : K7T9N4_MOUSE        0.78  0.88    9  120    1  112  112    0    0  112  K7T9N4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  103 : K7TRS2_MOUSE        0.78  0.88    9  120    1  112  112    0    0  112  K7TRS2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  104 : Q91V67_MOUSE        0.78  0.89    1  120    1  118  120    1    2  143  Q91V67     V304-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
  105 : Q9QXE9_MOUSE        0.78  0.89    1  120    1  117  120    1    3  117  Q9QXE9     Immunoglobulin heavy chain V-D-J region (Fragment) OS=Mus musculus PE=2 SV=1
  106 : A2N1N0_MOUSE        0.77  0.88    1  120   20  137  120    1    2  150  A2N1N0     B cell antigen receptor (Precursor) OS=Mus musculus PE=4 SV=1
  107 : HVM13_MOUSE 2OZ4    0.77  0.86    1  120    1  117  120    1    3  117  P01757     Ig heavy chain V region J558 OS=Mus musculus PE=1 SV=1
  108 : K7T9B2_MOUSE        0.77  0.90    9  120    1  109  112    1    3  109  K7T9B2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  109 : K7TD97_MOUSE        0.77  0.87    9  120    1  110  112    1    2  110  K7TD97     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  110 : K7TDB3_MOUSE        0.77  0.88    9  120    1  112  112    0    0  112  K7TDB3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  111 : K7TDI0_MOUSE        0.77  0.83    9  120    1  105  112    1    7  105  K7TDI0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  112 : K7TDV0_MOUSE        0.77  0.86   13  120    1  106  108    1    2  106  K7TDV0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  113 : K7TR43_MOUSE        0.77  0.92    9  120    1  111  112    1    1  111  K7TR43     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  114 : M0R4G1_RAT          0.77  0.89    1   98   20  117   98    0    0  117  M0R4G1     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
  115 : M0R692_RAT          0.77  0.88    1   98    1   98   98    0    0   98  M0R692     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  116 : M0RCU6_RAT          0.77  0.88    1   98   20  117   98    0    0  117  M0RCU6     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
  117 : M0RE02_RAT          0.77  0.90    1   98   20  117   98    0    0  123  M0RE02     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
  118 : Q3KQK2_MOUSE        0.77  0.87    1  120   20  134  120    1    5  479  Q3KQK2     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  119 : Q5R3X0_MOUSE        0.77  0.89    1   98   20  117   98    0    0  118  Q5R3X0     Pot. H26-1 variable region (Precursor) OS=Mus musculus PE=4 SV=1
  120 : Q9JL77_MOUSE        0.77  0.89   11  120    3  110  110    1    2  110  Q9JL77     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  121 : Q9Z1C4_MOUSE        0.77  0.87    1  120    1  118  120    1    2  118  Q9Z1C4     Anti-porcine VCAM mAb 3F4 heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  122 : A0N5T9_9MURI        0.76  0.88    1  120    1  118  120    1    2  118  A0N5T9     Anti-hepatitis B virus core antigen MoAb 13C9 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  123 : D3ZC54_RAT          0.76  0.89    1   98   19  116   98    0    0  117  D3ZC54     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=2
  124 : HVM12_MOUSE         0.76  0.84    1  120    1  117  120    1    3  117  P01756     Ig heavy chain V region MOPC 104E OS=Mus musculus PE=1 SV=1
  125 : K7TD85_MOUSE        0.76  0.89    9  120    1  112  113    2    2  112  K7TD85     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  126 : K7TDF1_MOUSE        0.76  0.85    9  120    1  109  112    1    3  109  K7TDF1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  127 : K7TGX3_MOUSE        0.76  0.87    9  120    1  108  112    1    4  108  K7TGX3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  128 : K7TH06_MOUSE        0.76  0.87    9  120    1  113  113    1    1  113  K7TH06     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  129 : K7TH34_MOUSE        0.76  0.88    9  120    1  111  112    1    1  111  K7TH34     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  130 : K7THA4_MOUSE        0.76  0.88    9  120    1  109  112    1    3  109  K7THA4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  131 : K7THH3_MOUSE        0.76  0.86   13  120    1  108  110    3    4  108  K7THH3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  132 : K7TR77_MOUSE        0.76  0.85    9  120    1  111  112    1    1  111  K7TR77     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  133 : K7TRG3_MOUSE        0.76  0.88    9  120    1  109  112    1    3  109  K7TRG3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  134 : K7U5Z8_MOUSE        0.76  0.87    9  120    1  109  112    1    3  109  K7U5Z8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  135 : Q6PJA7_MOUSE3CMO    0.76  0.84    1  120   20  142  123    1    3  472  Q6PJA7     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
  136 : Q91WT1_MOUSE        0.76  0.86    1  120   20  136  121    3    5  481  Q91WT1     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  137 : Q9D8L4_MOUSE1F11    0.76  0.88    1  120   20  138  120    1    1  473  Q9D8L4     Putative uncharacterized protein OS=Mus musculus GN=Ighg2a PE=1 SV=1
  138 : A0N6Q0_9MURI        0.75  0.84    1  117    1  117  117    0    0  117  A0N6Q0     Rheumatoid factor RF10-2 (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  139 : A0N6Q8_9MURI        0.75  0.83    1  117    1  118  119    3    3  118  A0N6Q8     Rheumatoid factor RFA28-A (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  140 : A0NA69_MOUSE        0.75  0.87    1   97   20  116   97    0    0  122  A0NA69     VDJ complex (Fragment) OS=Mus musculus PE=4 SV=1
  141 : HVM48_MOUSE         0.75  0.88    1  120   20  138  120    1    1  138  P03980     Ig heavy chain V region TEPC 1017 OS=Mus musculus PE=4 SV=1
  142 : HVM51_MOUSE         0.75  0.87    1  120    1  118  120    1    2  118  P06330     Ig heavy chain V region AC38 205.12 OS=Mus musculus PE=1 SV=1
  143 : K7T9A5_MOUSE        0.75  0.88    9  120    1  109  112    1    3  109  K7T9A5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  144 : K7T9P1_MOUSE        0.75  0.86    9  120    1  112  113    2    2  112  K7T9P1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  145 : K7THE6_MOUSE        0.75  0.91   14  120    1  108  108    1    1  108  K7THE6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  146 : K7TRE7_MOUSE        0.75  0.86   10  120    2  113  113    3    3  113  K7TRE7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  147 : K7TRR2_MOUSE        0.75  0.85   15  120    1  105  106    1    1  105  K7TRR2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  148 : K7U5N8_MOUSE        0.75  0.85   11  120    3  108  110    1    4  108  K7U5N8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  149 : K7U5Q2_MOUSE        0.75  0.85    9  120    1  110  112    1    2  110  K7U5Q2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  150 : K7U661_MOUSE        0.75  0.86    9  120    1  112  113    2    2  112  K7U661     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  151 : Q2NLC3_MOUSE        0.75  0.88    1  120   20  135  121    3    6  480  Q2NLC3     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  152 : Q569W9_MOUSE3OZ9    0.75  0.86    1  120   20  138  121    3    3  468  Q569W9     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
  153 : A0N274_MOUSE2GKI    0.74  0.88    1  120   20  139  121    2    2  152  A0N274     Antigen, B-cell receptor (Precursor) OS=Mus musculus PE=1 SV=1
  154 : D3ZK68_RAT          0.74  0.89    1   98   20  117   98    0    0  122  D3ZK68     Uncharacterized protein OS=Rattus norvegicus GN=LOC100360610 PE=4 SV=2
  155 : D4AC77_RAT          0.74  0.91    1   97   20  116   97    0    0  125  D4AC77     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=2
  156 : HVM01_MOUSE         0.74  0.88    1  120    1  121  121    1    1  121  P01745     Ig heavy chain V region MPC 11 OS=Mus musculus PE=4 SV=1
  157 : K7T930_MOUSE        0.74  0.87    9  120    1  109  112    1    3  109  K7T930     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  158 : K7T9I5_MOUSE        0.74  0.88    9  120    1  112  113    2    2  112  K7T9I5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  159 : K7TDU3_MOUSE        0.74  0.90   16  120    1  102  105    1    3  102  K7TDU3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  160 : K7TGQ2_MOUSE        0.74  0.84    9  120    1  105  112    1    7  105  K7TGQ2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  161 : K7TRL3_MOUSE        0.74  0.83    9  120    1  110  112    1    2  110  K7TRL3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  162 : K7U6A0_MOUSE        0.74  0.87    9  120    1  109  112    1    3  109  K7U6A0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  163 : M0R9U2_RAT          0.74  0.91    1   98    1   98   98    0    0   98  M0R9U2     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  164 : M0RDI9_RAT          0.74  0.89    1   98   18  115   98    0    0  115  M0RDI9     Uncharacterized protein (Fragment) OS=Rattus norvegicus GN=LOC100360610 PE=4 SV=1
  165 : M3XG22_FELCA        0.74  0.88  122  219   20  117   98    0    0  123  M3XG22     Uncharacterized protein OS=Felis catus PE=4 SV=1
  166 : Q2T9K9_MOUSE        0.74  0.83    1  120   20  137  122    3    6  482  Q2T9K9     LOC677563 protein OS=Mus musculus GN=LOC677563 PE=2 SV=1
  167 : Q3SYJ4_MOUSE        0.74  0.87    1  120   20  139  121    2    2  484  Q3SYJ4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  168 : Q5BJZ2_RAT  2G60    0.74  0.85    1  120   20  136  121    4    5  458  Q5BJZ2     LOC367586 protein OS=Rattus norvegicus GN=LOC367586 PE=2 SV=1
  169 : Q7TQM2_MOUSE        0.74  0.85    1  120    1  116  121    3    6  243  Q7TQM2     ScFv 6H8 protein (Fragment) OS=Mus musculus GN=scFv 6H8 PE=4 SV=1
  170 : Q920E8_MOUSE        0.74  0.84    1  119    1  120  120    1    1  120  Q920E8     Pterin-mimicking anti-idiotope heavy chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
  171 : A2NW55_MOUSE        0.73  0.82    1  120    1  117  120    1    3  117  A2NW55     E8 variable heavy chain (Fragment) OS=Mus musculus PE=2 SV=1
  172 : H0Y125_OTOGA        0.73  0.90  122  219   23  120   98    0    0  120  H0Y125     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  173 : K7T9N8_MOUSE        0.73  0.84    9  120    1  112  113    2    2  112  K7T9N8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  174 : K7TDI1_MOUSE        0.73  0.88    9  120    1  109  112    1    3  109  K7TDI1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  175 : K7TDJ4_MOUSE        0.73  0.87    9  120    1  113  113    1    1  113  K7TDJ4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  176 : K7TH96_MOUSE        0.73  0.88    9  120    1  108  112    1    4  108  K7TH96     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  177 : K7THF9_MOUSE        0.73  0.84    9  120    1  111  112    1    1  111  K7THF9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  178 : M0RC98_RAT          0.73  0.90    1   98   20  117   98    0    0  117  M0RC98     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
  179 : Q6PF95_MOUSE1XGY    0.73  0.83    1  120   20  134  121    3    7  464  Q6PF95     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
  180 : A0N8M6_MOUSE        0.72  0.88    1   98   20  117   98    0    0  117  A0N8M6     H4a-3 coding region (Precursor) OS=Mus musculus PE=4 SV=1
  181 : F6W0Q5_HORSE        0.72  0.83  122  219   20  115   98    2    2  115  F6W0Q5     Uncharacterized protein OS=Equus caballus PE=4 SV=1
  182 : H0VU72_CAVPO        0.72  0.85  125  219   25  119   95    0    0  119  H0VU72     Uncharacterized protein OS=Cavia porcellus PE=4 SV=1
  183 : K7T947_MOUSE        0.72  0.82    9  120    1  113  113    1    1  113  K7T947     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  184 : K7T988_MOUSE        0.72  0.83    9  120    1  106  112    1    6  106  K7T988     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  185 : K7T9M7_MOUSE        0.72  0.88    9  120    1  108  112    1    4  108  K7T9M7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  186 : K7TDM1_MOUSE        0.72  0.87    9  120    1  108  112    1    4  108  K7TDM1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  187 : K7TDM5_MOUSE        0.72  0.87    9  120    1  109  112    1    3  109  K7TDM5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  188 : K7TH02_MOUSE        0.72  0.87    9  120    1  116  116    3    4  116  K7TH02     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  189 : K7TRK1_MOUSE        0.72  0.86    9  120    1  112  113    2    2  112  K7TRK1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  190 : K7TRL7_MOUSE        0.72  0.85    9  120    1  113  113    1    1  113  K7TRL7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  191 : K7U695_MOUSE        0.72  0.87    9  120    1  111  113    2    3  111  K7U695     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  192 : Q4VAB6_MOUSE        0.72  0.86    1  120   20  138  122    3    5  483  Q4VAB6     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  193 : Q58E56_MOUSE        0.72  0.83    1  120   20  142  123    2    3  477  Q58E56     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  194 : Q5HZY6_MOUSE        0.72  0.85    1  120   20  141  124    3    6  486  Q5HZY6     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  195 : Q8VDC9_MOUSE1Q0Y    0.72  0.87    1  120   20  138  120    1    1  168  Q8VDC9     Anti-MOG Z12 variable gamma 2a (Fragment) OS=Mus musculus GN=IgG2a PE=2 SV=1
  196 : Q91WT3_MOUSE        0.72  0.84    1  120   20  136  123    5    9  481  Q91WT3     Igh protein OS=Mus musculus GN=Igh-VJ558 PE=2 SV=1
  197 : Q925S3_MOUSE        0.72  0.88    1  120    3  121  120    1    1  147  Q925S3     MRP3 OS=Mus musculus PE=2 SV=1
  198 : A0N8M7_MOUSE        0.71  0.87    1   97   20  116   97    0    0  117  A0N8M7     H2b-3 coding region (Precursor) OS=Mus musculus PE=4 SV=1
  199 : A2IXM7_MOUSE        0.71  0.82    1  120    1  120  124    3    8  243  A2IXM7     Anti-CD30 moab Ki-4 scFv (Fragment) OS=Mus musculus PE=2 SV=1
  200 : G1Q6V1_MYOLU        0.71  0.93    1   98   21  118   98    0    0  124  G1Q6V1     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  201 : G1Q7W5_MYOLU        0.71  0.92    1   98   20  117   98    0    0  117  G1Q7W5     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  202 : H0VUA1_CAVPO        0.71  0.83  122  227   21  124  106    1    2  135  H0VUA1     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
  203 : H0W7Y0_CAVPO        0.71  0.83  122  227    1  104  106    1    2  107  H0W7Y0     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
  204 : K7TDJ2_MOUSE        0.71  0.81    9  120    1  110  112    1    2  110  K7TDJ2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  205 : K7TGV2_MOUSE        0.71  0.85    9  120    1  108  112    1    4  108  K7TGV2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  206 : K7TH77_MOUSE        0.71  0.79    9  120    1  109  112    1    3  109  K7TH77     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  207 : K7THC0_MOUSE        0.71  0.87    9  120    1  112  113    2    2  112  K7THC0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  208 : K7TR90_MOUSE        0.71  0.83    9  120    1  107  112    1    5  107  K7TR90     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  209 : K7TRH5_MOUSE        0.71  0.80    9  120    1  105  112    1    7  105  K7TRH5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  210 : K7TRK5_MOUSE        0.71  0.88    9  120    1  109  112    1    3  109  K7TRK5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  211 : K7U5S6_MOUSE        0.71  0.82    9  120    1  108  112    1    4  108  K7U5S6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  212 : K7U6B8_MOUSE        0.71  0.87    9  120    1  109  112    1    3  109  K7U6B8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  213 : K7U6D0_MOUSE        0.71  0.79    9  120    1  106  112    1    6  106  K7U6D0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  214 : K7U6I8_MOUSE        0.71  0.82    9  120    1  109  112    1    3  109  K7U6I8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  215 : Q2KHS9_MOUSE        0.71  0.81    1  120   20  141  123    3    4  486  Q2KHS9     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  216 : Q4QQW0_RAT          0.71  0.82    1  120   19  136  120    1    2  591  Q4QQW0     Igh-6 protein (Fragment) OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
  217 : Q99LC4_MOUSE2NTF    0.71  0.84    1  120   20  139  121    2    2  463  Q99LC4     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
  218 : Q9JL83_MOUSE        0.71  0.84    9  120    1  110  112    1    2  110  Q9JL83     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  219 : G1QFM5_MYOLU        0.70  0.90    1   98   20  117   98    0    0  147  G1QFM5     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  220 : H0W3W8_CAVPO        0.70  0.86  123  231    1  109  109    0    0  109  H0W3W8     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
  221 : K7T9J6_MOUSE        0.70  0.86    9  120    1  110  112    1    2  110  K7T9J6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  222 : K7T9Q4_MOUSE        0.70  0.81    9  120    1  104  112    1    8  104  K7T9Q4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  223 : K7T9R7_MOUSE        0.70  0.85   22  120    1   96   99    1    3   96  K7T9R7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  224 : K7TRJ3_MOUSE        0.70  0.80    9  120    1  109  112    1    3  109  K7TRJ3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  225 : K7U657_MOUSE        0.70  0.82    9  120    1  109  112    1    3  109  K7U657     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  226 : K7U6E0_MOUSE        0.70  0.84    9  120    1  110  112    1    2  110  K7U6E0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  227 : Q3KQK0_MOUSE        0.70  0.87    1  120   20  139  122    3    4  484  Q3KQK0     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  228 : Q52L51_MOUSE        0.70  0.84    1  120   20  138  121    3    3  483  Q52L51     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  229 : Q58E61_MOUSE        0.70  0.82    1  120   20  141  124    4    6  485  Q58E61     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  230 : Q5R3X1_MOUSE1MOE    0.70  0.81    7  120    1  113  115    2    3  114  Q5R3X1     V(H) region of G5 Bb 2.2 (Fragment) OS=Mus musculus PE=1 SV=1
  231 : Q8VIJ1_MOUSE        0.70  0.84    1  120    1  123  123    3    3  123  Q8VIJ1     Anti-DNA heavy chain (Fragment) OS=Mus musculus GN=J558 PE=2 SV=1
  232 : Q91WR1_MOUSE        0.70  0.83    1  120   20  143  124    1    4  488  Q91WR1     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  233 : B0AZK4_DROME        0.69  0.83    1  120   21  143  123    1    3  440  B0AZK4     BerH2-scFv-hpRNase (Precursor) OS=Drosophila melanogaster PE=2 SV=1
  234 : G1Q8C9_MYOLU        0.69  0.89    1   98   20  117   98    0    0  122  G1Q8C9     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  235 : G3RXY0_GORGO        0.69  0.88    1   98   20  117   98    0    0  118  G3RXY0     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101126730 PE=4 SV=1
  236 : K7T9L5_MOUSE        0.69  0.83    9  120    1  112  114    3    4  112  K7T9L5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  237 : K7TDF9_MOUSE        0.69  0.83    9  120    1  110  112    1    2  110  K7TDF9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  238 : K7TDK7_MOUSE        0.69  0.80    9  120    1  114  114    2    2  114  K7TDK7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  239 : K7TH46_MOUSE        0.69  0.80    9  120    1  109  112    1    3  109  K7TH46     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  240 : K7TR49_MOUSE        0.69  0.79    9  120    1  109  112    1    3  109  K7TR49     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  241 : K7TR86_MOUSE        0.69  0.79    9  120    1  106  112    1    6  106  K7TR86     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  242 : K7TRF0_MOUSE        0.69  0.80    9  120    1  113  113    1    1  113  K7TRF0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  243 : K7TRU2_MOUSE        0.69  0.84    9  120    1  115  115    3    3  115  K7TRU2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  244 : K7U6A3_MOUSE        0.69  0.85   11  120    3  112  110    0    0  112  K7U6A3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  245 : L5L777_PTEAL        0.69  0.87    1   98   20  117   98    0    0  120  L5L777     Ig heavy chain V-I region V35 OS=Pteropus alecto GN=PAL_GLEAN10000171 PE=4 SV=1
  246 : M0R6G5_RAT          0.69  0.86    1   98   22  119   98    0    0  120  M0R6G5     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
  247 : Q505N9_MOUSE1MVU    0.69  0.83    1  120   20  138  121    3    3  468  Q505N9     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
  248 : Q9JL85_MOUSE1J05    0.69  0.80    9  120    1  109  112    1    3  109  Q9JL85     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=1 SV=1
  249 : A0N1R6_MOUSE        0.68  0.83    1  120   20  134  120    1    5  134  A0N1R6     CC49 Fab (Precursor) OS=Mus musculus PE=2 SV=1
  250 : A0N6Q5_9MURI        0.68  0.82   14  119    1  106  107    2    2  106  A0N6Q5     Rheumatoid factor RF3-5A (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  251 : G1PB40_MYOLU        0.68  0.89    1   98   20  117   98    0    0  125  G1PB40     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  252 : G1Q1I8_MYOLU        0.68  0.88    1   98   20  117   98    0    0  118  G1Q1I8     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  253 : G1Q6J2_MYOLU        0.68  0.87    1   97   20  116   97    0    0  123  G1Q6J2     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  254 : H0WCN1_CAVPO        0.68  0.83  122  218    1   98   98    1    1   98  H0WCN1     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
  255 : HV102_HUMAN         0.68  0.87    1   98   20  117   98    0    0  117  P01743     Ig heavy chain V-I region HG3 OS=Homo sapiens PE=4 SV=1
  256 : HV103_HUMAN 1WT5    0.68  0.87    1   98   20  117   98    0    0  117  P23083     Ig heavy chain V-I region V35 OS=Homo sapiens PE=1 SV=1
  257 : K7T9J8_MOUSE        0.68  0.82    9  120    1  114  114    2    2  114  K7T9J8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  258 : K7T9M0_MOUSE        0.68  0.82    9  119    1  108  111    1    3  109  K7T9M0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  259 : K7T9M5_MOUSE        0.68  0.79    9  120    1  114  114    2    2  114  K7T9M5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  260 : K7T9S3_MOUSE        0.68  0.84    9  120    1  109  112    1    3  109  K7T9S3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  261 : K7TH85_MOUSE        0.68  0.87   10  120    2  107  111    1    5  107  K7TH85     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  262 : K7THE2_MOUSE        0.68  0.84    9  120    1  113  113    1    1  113  K7THE2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  263 : K7TRI7_MOUSE        0.68  0.81    9  120    1  109  112    1    3  109  K7TRI7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  264 : K7U6D5_MOUSE        0.68  0.80    9  120    1  110  112    1    2  110  K7U6D5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  265 : M0R8D8_RAT          0.68  0.89    1   98   20  117   98    0    0  118  M0R8D8     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
  266 : Q5BK05_RAT          0.68  0.81    1  120   20  136  121    2    5  458  Q5BK05     LOC367586 protein OS=Rattus norvegicus GN=LOC367586 PE=2 SV=1
  267 : Q5F2I1_MOUSE        0.68  0.84    1  119    1  120  120    1    1  120  Q5F2I1     Gamma heavy chain variable region (Fragment) OS=Mus musculus GN=IgG1 anti-TS1 VH PE=2 SV=1
  268 : Q8K0Z4_MOUSE        0.68  0.84    1  120   20  136  122    4    7  480  Q8K0Z4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  269 : Q925S2_MOUSE        0.68  0.86    1  120    3  123  121    1    1  170  Q925S2     MRP4 OS=Mus musculus PE=2 SV=1
  270 : Q9Z1C6_MOUSE        0.68  0.86    1  120    1  117  120    1    3  117  Q9Z1C6     Anti-porcine VCAM mAb 2A2 heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  271 : A2J1M4_HUMAN        0.67  0.89    1   98    1   98   98    0    0   98  A2J1M4     Rheumatoid factor RF-ET7 (Fragment) OS=Homo sapiens PE=2 SV=1
  272 : A2MY49_MOUSE        0.67  0.81    1  120    1  116  120    1    4  116  A2MY49     Anti-acid phosphatase variable heavy chain 18 (Fragment) OS=Mus musculus PE=2 SV=1
  273 : F6TDB5_CALJA        0.67  0.88    1   98   20  117   98    0    0  120  F6TDB5     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  274 : F6Z1C3_MONDO        0.67  0.87  124  220   25  119   97    1    2  119  F6Z1C3     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=1
  275 : G1PZK9_MYOLU        0.67  0.83  125  218   22  116   95    1    1  125  G1PZK9     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  276 : G1QCI8_MYOLU        0.67  0.86    1   98   20  117   98    0    0  118  G1QCI8     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  277 : G3S3C1_GORGO        0.67  0.87    1   98   20  117   98    0    0  120  G3S3C1     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  278 : G3SCH9_GORGO        0.67  0.88    1   98   20  117   98    0    0  120  G3SCH9     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  279 : G8F4H5_MACFA        0.67  0.88    1   98   20  117   98    0    0  120  G8F4H5     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_20425 PE=4 SV=1
  280 : H2NMK0_PONAB        0.67  0.87    1   97   20  116   97    0    0  129  H2NMK0     Uncharacterized protein OS=Pongo abelii PE=4 SV=2
  281 : H9KWY7_CALJA        0.67  0.86    1   98   20  117   98    0    0  117  H9KWY7     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  282 : H9KXA8_CALJA        0.67  0.87    1   98   15  112   98    0    0  115  H9KXA8     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  283 : HVM15_MOUSE         0.67  0.79    1  120   20  136  120    1    3  136  P01759     Ig heavy chain V region BCL1 OS=Mus musculus PE=4 SV=1
  284 : K7T9P5_MOUSE        0.67  0.81    9  120    1  113  113    1    1  113  K7T9P5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  285 : K7TDQ4_MOUSE        0.67  0.85    9  120    1  110  112    1    2  110  K7TDQ4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  286 : K7THA9_MOUSE        0.67  0.79    9  120    1  108  112    1    4  108  K7THA9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  287 : K7TRK9_MOUSE        0.67  0.85    9  120    1  110  112    1    2  110  K7TRK9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  288 : K7TRN8_MOUSE        0.67  0.80    9  120    1  110  112    1    2  110  K7TRN8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  289 : K7U5X0_MOUSE        0.67  0.83    9  120    1  115  115    3    3  115  K7U5X0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  290 : L5M050_MYODS        0.67  0.89    1   98   20  117   98    0    0  132  L5M050     Ig heavy chain V-I region V35 OS=Myotis davidii GN=MDA_GLEAN10001447 PE=4 SV=1
  291 : Q2TAW9_MOUSE        0.67  0.85    1  120   20  137  123    5    8  482  Q2TAW9     Uncharacterized protein OS=Mus musculus PE=2 SV=1
  292 : Q8R3H6_MOUSE        0.67  0.84    1  120   20  138  121    3    3  474  Q8R3H6     Ighg protein OS=Mus musculus GN=Ighg PE=2 SV=1
  293 : Q8VCX4_MOUSE        0.67  0.81    1  120   20  144  125    3    5  489  Q8VCX4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  294 : Q9GYZ2_MOUSE        0.67  0.82    1  120    1  119  120    1    1  119  Q9GYZ2     Monoclonal anti-idiotypic Schistosoma japonicum antibody NP30 heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  295 : S7QHA4_MYOBR        0.67  0.87    2   98    1   97   97    0    0  124  S7QHA4     Ig heavy chain V-I region HG3 (Fragment) OS=Myotis brandtii GN=D623_10000116 PE=4 SV=1
  296 : A2MYC6_9MURI        0.66  0.82    1  120    1  125  125    3    5  125  A2MYC6     MA-15 heavy chain (Fragment) OS=Mus sp. PE=2 SV=1
  297 : A2N7P4_HUMAN        0.66  0.82    1  114    4  119  116    2    2  120  A2N7P4     Immunoglobulin mu-chain D-J4-region (Fragment) OS=Homo sapiens GN=IGHM PE=4 SV=1
  298 : G1Q1K2_MYOLU        0.66  0.88    1   98   20  117   98    0    0  118  G1Q1K2     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  299 : G3SDS6_GORGO        0.66  0.85    1   97   20  116   97    0    0  117  G3SDS6     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  300 : G3TV93_LOXAF        0.66  0.88    1   97   20  116   97    0    0  117  G3TV93     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  301 : G8F1N7_MACMU        0.66  0.84    1   98   20  117   98    0    0  120  G8F1N7     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_21379 PE=4 SV=1
  302 : G8F202_MACMU        0.66  0.84    1   98   20  117   98    0    0  120  G8F202     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_21564 PE=4 SV=1
  303 : G8F4H4_MACFA        0.66  0.84    1   98   20  117   98    0    0  120  G8F4H4     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_20424 PE=4 SV=1
  304 : H9H495_MACMU        0.66  0.84    1   98   20  117   98    0    0  120  H9H495     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  305 : H9KXW1_CALJA        0.66  0.83    1   98    1   98   98    0    0   98  H9KXW1     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  306 : H9KYA6_CALJA        0.66  0.83    1   98   20  117   98    0    0  120  H9KYA6     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  307 : I3LT74_PIG          0.66  0.86  124  221   21  116   98    1    2  119  I3LT74     Uncharacterized protein OS=Sus scrofa PE=4 SV=1
  308 : K7T9N2_MOUSE        0.66  0.83    9  120    1  110  112    1    2  110  K7T9N2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  309 : K7TDH5_MOUSE        0.66  0.81    9  120    1  111  112    1    1  111  K7TDH5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  310 : K7TR29_MOUSE        0.66  0.80    9  120    1  112  113    2    2  112  K7TR29     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  311 : K7TR71_MOUSE        0.66  0.83    9  120    1  110  112    1    2  110  K7TR71     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  312 : K7TRM7_MOUSE        0.66  0.79    9  120    1  110  112    1    2  110  K7TRM7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  313 : K7U5T7_MOUSE        0.66  0.77    9  120    1  116  116    2    4  116  K7U5T7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  314 : L7N1B7_MYOLU        0.66  0.89    1   98   20  117   98    0    0  117  L7N1B7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  315 : Q32NZ5_MOUSE        0.66  0.80    1  120   20  137  121    3    4  482  Q32NZ5     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  316 : Q8VCV5_MOUSE        0.66  0.82    1  120   20  137  120    1    2  481  Q8VCV5     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  317 : S7P4I0_MYOBR        0.66  0.85    1   98   20  117   98    0    0  120  S7P4I0     Ig heavy chain V-I region HG3 OS=Myotis brandtii GN=D623_10000597 PE=4 SV=1
  318 : A2MY48_MOUSE        0.65  0.83    1  120    1  120  121    2    2  120  A2MY48     Anti-acid phosphatase variable light chain 11 (Fragment) OS=Mus musculus PE=2 SV=1
  319 : G1PXX6_MYOLU        0.65  0.88    1   98   20  117   98    0    0  123  G1PXX6     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  320 : G1PZL4_MYOLU        0.65  0.87    1   98   20  117   98    0    0  117  G1PZL4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  321 : G1QA40_MYOLU        0.65  0.89    1   98   20  117   98    0    0  117  G1QA40     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  322 : G1QD53_MYOLU        0.65  0.83  122  217   20  115   96    0    0  115  G1QD53     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  323 : G1SBX0_NOMLE        0.65  0.85    1   97    1   97   97    0    0   97  G1SBX0     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=LOC100583923 PE=4 SV=1
  324 : G8F1H9_MACMU        0.65  0.79    1   97   20  116   97    0    0  116  G8F1H9     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21278 PE=4 SV=1
  325 : G8F1K6_MACMU        0.65  0.84    1   98   20  117   98    0    0  117  G8F1K6     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21328 PE=4 SV=1
  326 : G8F671_MACFA        0.65  0.79    1   98   20  117   98    0    0  120  G8F671     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_21268 PE=4 SV=1
  327 : G8F6A1_MACFA        0.65  0.84    1   98   20  117   98    0    0  120  G8F6A1     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_19439 PE=4 SV=1
  328 : H2NMK2_PONAB        0.65  0.84    1   98   20  117   98    0    0  117  H2NMK2     Uncharacterized protein OS=Pongo abelii GN=IGHV1-3 PE=4 SV=1
  329 : H9KVK6_CALJA        0.65  0.79  122  218    1   98   98    1    1   98  H9KVK6     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  330 : H9KY04_CALJA        0.65  0.89    1   98   20  117   98    0    0  120  H9KY04     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  331 : H9KYD2_CALJA        0.65  0.86    1   98   20  117   98    0    0  118  H9KYD2     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  332 : K7TDK2_MOUSE        0.65  0.81    9  120    1  113  113    1    1  113  K7TDK2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  333 : K7TDN5_MOUSE        0.65  0.80    9  120    1  108  112    1    4  108  K7TDN5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  334 : K7TDT9_MOUSE        0.65  0.79   10  120    1  106  111    1    5  106  K7TDT9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  335 : K7TGS5_MOUSE        0.65  0.81    9  120    1  112  113    2    2  112  K7TGS5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  336 : K7TRJ0_MOUSE        0.65  0.79    9  120    1  108  112    1    4  108  K7TRJ0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  337 : K7TRQ3_MOUSE        0.65  0.82    9  120    1  113  113    1    1  113  K7TRQ3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  338 : K7U5Z3_MOUSE        0.65  0.80    9  120    1  113  113    1    1  113  K7U5Z3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  339 : K7U639_MOUSE        0.65  0.85    9  120    1  110  112    1    2  110  K7U639     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  340 : K7U681_MOUSE        0.65  0.79    9  120    1  108  112    1    4  108  K7U681     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  341 : L5M6Y3_MYODS        0.65  0.88    1   98   20  117   98    0    0  120  L5M6Y3     Ig heavy chain V-I region HG3 OS=Myotis davidii GN=MDA_GLEAN10001347 PE=4 SV=1
  342 : Q5R3U9_MOUSE        0.65  0.79   10  120    1  110  112    2    3  111  Q5R3U9     VH region of G7 Ab 2.9 (Fragment) OS=Mus musculus PE=2 SV=1
  343 : Q9UL92_HUMAN        0.65  0.81    1  120    1  124  124    3    4  124  Q9UL92     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  344 : Q9UL94_HUMAN        0.65  0.82    1  120    1  119  120    1    1  119  Q9UL94     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  345 : S7MDV2_MYOBR        0.65  0.90    1   98   20  117   98    0    0  124  S7MDV2     Ig heavy chain V-I region HG3 OS=Myotis brandtii GN=D623_10000822 PE=4 SV=1
  346 : A2J1M2_HUMAN        0.64  0.86    1   98    1   98   98    0    0   98  A2J1M2     Rheumatoid factor RF-IP9 (Fragment) OS=Homo sapiens PE=2 SV=1
  347 : F7IGX7_CALJA        0.64  0.83    1   98   20  117   98    0    0  117  F7IGX7     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  348 : F7IR38_CALJA        0.64  0.90    1   98   20  117   98    0    0  117  F7IR38     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  349 : G1P3J6_MYOLU        0.64  0.83  122  217   20  115   96    0    0  115  G1P3J6     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  350 : G1Q3V7_MYOLU        0.64  0.83  122  213   20  111   92    0    0  111  G1Q3V7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  351 : G1Q9D1_MYOLU        0.64  0.88    1   98   20  117   98    0    0  117  G1Q9D1     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  352 : G1QEP1_MYOLU        0.64  0.87    1   98   20  117   98    0    0  125  G1QEP1     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  353 : G3VPY9_SARHA        0.64  0.81  122  217   20  115   96    0    0  115  G3VPY9     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  354 : G8F212_MACMU        0.64  0.79  122  218   25  123   99    1    2  133  G8F212     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_21578 PE=4 SV=1
  355 : H9KW41_CALJA        0.64  0.80    1   98   20  113   98    1    4  116  H9KW41     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  356 : H9KY06_CALJA        0.64  0.83    1   98   20  117   98    0    0  118  H9KY06     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  357 : H9KY12_CALJA        0.64  0.89    1   98   20  117   98    0    0  120  H9KY12     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  358 : K7TDQ0_MOUSE        0.64  0.79    9  120    1  105  112    1    7  105  K7TDQ0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  359 : K7TQW9_MOUSE        0.64  0.80    9  120    1  111  112    1    1  111  K7TQW9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  360 : K7TRM1_MOUSE        0.64  0.78    9  119    1  109  111    1    2  109  K7TRM1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  361 : K9J4H1_DESRO        0.64  0.81  122  231   20  129  110    0    0  139  K9J4H1     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  362 : K9J4H4_DESRO        0.64  0.80    1  120   20  139  121    2    2  153  K9J4H4     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  363 : L5KEW0_PTEAL        0.64  0.82  122  209   20  107   88    0    0  107  L5KEW0     Ig lambda chain V region 4A OS=Pteropus alecto GN=PAL_GLEAN10000069 PE=4 SV=1
  364 : L5ME93_MYODS        0.64  0.90    1   98   20  117   98    0    0  120  L5ME93     Ig heavy chain V-I region V35 OS=Myotis davidii GN=MDA_GLEAN10000503 PE=4 SV=1
  365 : Q8CGS2_MOUSE        0.64  0.83    1  120    3  121  121    2    3  121  Q8CGS2     Anti-deoxynivalenol scFv lambda heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  366 : A0N589_9MURI        0.63  0.82    1  120   19  137  121    2    3  137  A0N589     Anti-CD4 mAb M-T310 variable region heavy chain (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  367 : G1Q3J7_MYOLU        0.63  0.82  122  218   22  120   99    1    2  125  G1Q3J7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  368 : G1QCB3_MYOLU        0.63  0.87    1   98   20  117   98    0    0  117  G1QCB3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  369 : G1RH42_NOMLE        0.63  0.85    1   98   20  117   98    0    0  120  G1RH42     Uncharacterized protein OS=Nomascus leucogenys GN=LOC100584252 PE=4 SV=1
  370 : G7PHC4_MACFA        0.63  0.80  122  218   21  118   98    1    1  118  G7PHC4     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_02492 PE=4 SV=1
  371 : H2NMJ0_PONAB        0.63  0.85    1   97   20  116   97    0    0  117  H2NMJ0     Uncharacterized protein OS=Pongo abelii GN=IGHV1-58 PE=4 SV=1
  372 : H2R8J1_PANTR        0.63  0.82    1   98   20  117   98    0    0  120  H2R8J1     Uncharacterized protein OS=Pan troglodytes GN=LOC467635 PE=4 SV=1
  373 : H9KWT1_CALJA        0.63  0.85    1   98   21  118   98    0    0  119  H9KWT1     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  374 : IV1U1_HUMAN         0.63  0.84    1   98   20  117   98    0    0  120  A6NJS3     Putative V-set and immunoglobulin domain-containing-like protein IGHV1OR21-1 OS=Homo sapiens GN=IGHV1OR21-1 PE=5 SV=1
  375 : K7TDN3_MOUSE        0.63  0.79    9  120    1  109  112    1    3  109  K7TDN3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  376 : K9IVD3_DESRO        0.63  0.83    1  120   20  144  126    3    7  160  K9IVD3     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  377 : L5LRZ6_MYODS        0.63  0.87    1   98   19  116   98    0    0  119  L5LRZ6     Ig heavy chain V-I region HG3 OS=Myotis davidii GN=MDA_GLEAN10000176 PE=4 SV=1
  378 : M3WSD2_FELCA        0.63  0.85    1   98   20  117   98    0    0  118  M3WSD2     Uncharacterized protein OS=Felis catus PE=4 SV=1
  379 : Q569X1_MOUSE1MPA    0.63  0.76    1  120   20  140  124    5    7  476  Q569X1     Ighg protein OS=Mus musculus GN=Ighg PE=1 SV=1
  380 : S7QH40_MYOBR        0.63  0.83  122  213   20  111   92    0    0  121  S7QH40     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10000469 PE=4 SV=1
  381 : A2N2G7_HUMAN        0.62  0.80    1  120    1  117  120    1    3  117  A2N2G7     VHC8 protein (Fragment) OS=Homo sapiens GN=VHC8 PE=2 SV=1
  382 : G1PFS9_MYOLU        0.62  0.81    1   97   20  112   97    1    4  113  G1PFS9     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  383 : G1QCT2_MYOLU        0.62  0.83    1  114   20  133  115    2    2  139  G1QCT2     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  384 : G3TY73_LOXAF        0.62  0.86    1   97   20  116   97    0    0  117  G3TY73     Uncharacterized protein OS=Loxodonta africana GN=LOC100669079 PE=4 SV=1
  385 : G3U0H6_LOXAF        0.62  0.86    1   97   20  116   97    0    0  117  G3U0H6     Uncharacterized protein OS=Loxodonta africana GN=LOC100676020 PE=4 SV=1
  386 : G3VL65_SARHA        0.62  0.79  122  224   20  123  104    1    1  123  G3VL65     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  387 : G8F1U9_MACMU        0.62  0.81    1   97   20  116   97    0    0  116  G8F1U9     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21478 PE=4 SV=1
  388 : H2PUF0_PONAB        0.62  0.83    1   98   20  117   98    0    0  120  H2PUF0     Uncharacterized protein OS=Pongo abelii GN=IGHV1-45 PE=4 SV=1
  389 : K7FS70_PELSI        0.62  0.84    1   97   21  117   97    0    0  117  K7FS70     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  390 : K7TH43_MOUSE        0.62  0.79    9  120    1  112  112    0    0  112  K7TH43     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  391 : K7TRM9_MOUSE        0.62  0.79    9  120    1  111  112    1    1  111  K7TRM9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  392 : K7TRP3_MOUSE        0.62  0.80    9  120    1  112  112    0    0  112  K7TRP3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  393 : K9IVC6_DESRO        0.62  0.77    1  120   20  133  120    1    6  147  K9IVC6     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  394 : K9IVD0_DESRO        0.62  0.77    1  120   26  139  120    1    6  152  K9IVD0     Uncharacterized protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  395 : L8YBG2_TUPCH        0.62  0.84  122  219   23  120   98    0    0  131  L8YBG2     Ig lambda-1 chain V OS=Tupaia chinensis GN=TREES_T100014443 PE=4 SV=1
  396 : M3X7S9_FELCA        0.62  0.83    1   98   20  117   98    0    0  118  M3X7S9     Uncharacterized protein OS=Felis catus PE=4 SV=1
  397 : Q9UL89_HUMAN        0.62  0.80    6  120    2  116  115    0    0  116  Q9UL89     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  398 : Q9UL95_HUMAN2D7T    0.62  0.79    1  120    1  125  125    3    5  125  Q9UL95     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  399 : S7N8Q6_MYOBR        0.62  0.79  125  227   22  126  105    2    2  151  S7N8Q6     Ig lambda-2 chain V region MOPC 315 OS=Myotis brandtii GN=D623_10001440 PE=4 SV=1
  400 : D2I5I5_AILME        0.61  0.78  122  213   21  112   92    0    0  118  D2I5I5     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_020949 PE=4 SV=1
  401 : F1D893_MACMU        0.61  0.78  122  231    7  116  110    0    0  140  F1D893     Anti-quaternary epitope monoclonal antibody light chain (Fragment) OS=Macaca mulatta PE=2 SV=1
  402 : F6SWU6_MACMU        0.61  0.79  122  218    1   98   98    1    1   98  F6SWU6     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=IGLV7-46 PE=4 SV=1
  403 : G1L0S1_AILME        0.61  0.78  122  213   20  111   92    0    0  129  G1L0S1     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
  404 : G1PV02_MYOLU        0.61  0.83    1   98   20  116   98    1    1  116  G1PV02     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  405 : G1Q1Q4_MYOLU        0.61  0.81  122  218   22  120   99    1    2  134  G1Q1Q4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  406 : G1Q5K2_MYOLU        0.61  0.74  122  218    1   98   98    1    1   98  G1Q5K2     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  407 : G1QG95_MYOLU        0.61  0.82  122  218   22  118   97    0    0  118  G1QG95     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  408 : G3S676_GORGO        0.61  0.79  122  219   20  117   98    0    0  117  G3S676     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  409 : G3SCA0_GORGO        0.61  0.83    1   98   20  117   98    0    0  120  G3SCA0     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  410 : G3U0R6_LOXAF        0.61  0.86    1   98   21  118   98    0    0  118  G3U0R6     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  411 : G8F5L7_MACFA        0.61  0.79  122  218   21  118   98    1    1  118  G8F5L7     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_20973 PE=4 SV=1
  412 : K9IWW7_DESRO        0.61  0.76  122  231   20  131  113    3    4  236  K9IWW7     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  413 : L5MAE4_MYODS        0.61  0.79  122  213   20  111   92    0    0  120  L5MAE4     Ig lambda chain V region 4A OS=Myotis davidii GN=MDA_GLEAN10000945 PE=4 SV=1
  414 : M3X0V7_FELCA        0.61  0.82    1   98   20  117   98    0    0  118  M3X0V7     Uncharacterized protein OS=Felis catus PE=4 SV=1
  415 : Q5NV83_HUMAN        0.61  0.79  122  218    1   98   98    1    1   98  Q5NV83     V3-3 protein (Fragment) OS=Homo sapiens GN=IGLV7-46 PE=4 SV=1
  416 : S6BGF9_HUMAN        0.61  0.77  122  231   17  127  112    3    3  213  S6BGF9     IgG L chain OS=Homo sapiens PE=2 SV=1
  417 : S6C4R7_HUMAN        0.61  0.77  122  231   17  126  112    4    4  212  S6C4R7     IgG L chain OS=Homo sapiens PE=2 SV=1
  418 : A0N8J8_HUMAN        0.60  0.80  122  217   20  115   96    0    0  116  A0N8J8     V lambda (Precursor) OS=Homo sapiens PE=2 SV=1
  419 : G1Q1X4_MYOLU        0.60  0.82    1  118   20  132  118    1    5  134  G1Q1X4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  420 : G1QAQ6_MYOLU        0.60  0.80  122  213   20  111   92    0    0  111  G1QAQ6     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  421 : G1QGA2_MYOLU        0.60  0.82  122  213   20  111   92    0    0  115  G1QGA2     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  422 : G3VQP2_SARHA        0.60  0.75  122  230    1  110  110    1    1  110  G3VQP2     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
  423 : H0XKU9_OTOGA        0.60  0.79  122  218    1   98   98    1    1   98  H0XKU9     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  424 : H9KW09_CALJA        0.60  0.76    1  113   20  127  113    1    5  128  H9KW09     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  425 : K7THC5_MOUSE        0.60  0.79    9  118    1  109  110    1    1  111  K7THC5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  426 : K9IKE8_DESRO        0.60  0.79    1  120   20  140  123    2    5  478  K9IKE8     Putative secreted protein OS=Desmodus rotundus PE=2 SV=1
  427 : K9IRB0_DESRO        0.60  0.81    1  120   13  132  123    3    6  272  K9IRB0     Uncharacterized protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  428 : LV001_HUMAN         0.60  0.80  122  217   21  116   96    0    0  117  P04211     Ig lambda chain V region 4A OS=Homo sapiens PE=4 SV=1
  429 : S6AWE6_HUMAN        0.60  0.78  122  231   20  129  113    6    6  215  S6AWE6     IgG L chain OS=Homo sapiens PE=2 SV=1
  430 : S6B286_HUMAN        0.60  0.77  122  231   20  129  112    4    4  215  S6B286     IgG L chain OS=Homo sapiens PE=2 SV=1
  431 : F6WDM9_MONDO        0.59  0.79  122  217   21  116   96    0    0  117  F6WDM9     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
  432 : F7EXE0_MACMU        0.59  0.77  122  217   21  116   96    0    0  117  F7EXE0     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  433 : G1Q8K8_MYOLU        0.59  0.77    1  111   20  125  111    1    5  135  G1Q8K8     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  434 : G3VP73_SARHA        0.59  0.78  122  231    1  111  111    1    1  111  G3VP73     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
  435 : K7TD70_MOUSE        0.59  0.81    9  120    1  111  112    1    1  111  K7TD70     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  436 : K7THA1_MOUSE        0.59  0.77    9  120    1  104  112    1    8  104  K7THA1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  437 : K7THB2_MOUSE        0.59  0.78    9  120    1  111  112    1    1  111  K7THB2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  438 : K9J0X5_DESRO        0.59  0.77    1  120   17  136  123    4    6  163  K9J0X5     Putative conserved secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  439 : M3X3V5_FELCA        0.59  0.69  122  217   20  113   97    4    4  113  M3X3V5     Uncharacterized protein OS=Felis catus PE=4 SV=1
  440 : M7BRY8_CHEMY        0.59  0.81  122  218   12  110   99    1    2  112  M7BRY8     Ig lambda chain V region 4A (Fragment) OS=Chelonia mydas GN=UY3_02106 PE=4 SV=1
  441 : Q5NV80_HUMAN        0.59  0.80  122  218    1   98   98    1    1   98  Q5NV80     V3-2 protein (Fragment) OS=Homo sapiens GN=IGLV7-43 PE=2 SV=1
  442 : Q6N041_HUMAN        0.59  0.80    1  120   35  158  124    1    4  498  Q6N041     Putative uncharacterized protein DKFZp686O16217 (Fragment) OS=Homo sapiens GN=DKFZp686O16217 PE=2 SV=1
  443 : S7N8Q4_MYOBR        0.59  0.76  131  221    1   92   92    1    1  121  S7N8Q4     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10001435 PE=4 SV=1
  444 : G1NZ05_MYOLU        0.58  0.79    1  112    1  108  112    1    4  108  G1NZ05     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  445 : G1PXQ6_MYOLU        0.58  0.78  122  218    1   98   98    1    1   98  G1PXQ6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  446 : G1Q4N5_MYOLU        0.58  0.77    1  119   20  133  119    1    5  134  G1Q4N5     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  447 : G3S4P0_GORGO        0.58  0.79  122  218    1   98   98    1    1   98  G3S4P0     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  448 : H9KX27_CALJA        0.58  0.77    1   98   20  116   98    1    1  117  H9KX27     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  449 : H9KYJ3_CALJA        0.58  0.78    1  119   20  135  119    2    3  136  H9KYJ3     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  450 : HV101_HUMAN         0.58  0.79    1   97    1   97   97    0    0  117  P01742     Ig heavy chain V-I region EU OS=Homo sapiens PE=1 SV=1
  451 : HVM00_MOUSE         0.58  0.80    1  116    1  114  116    1    2  114  P01741     Ig heavy chain V region OS=Mus musculus PE=1 SV=1
  452 : K7FLU7_PELSI        0.58  0.81  122  214   20  112   93    0    0  112  K7FLU7     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  453 : K9J6F1_DESRO        0.58  0.78  122  231   20  129  110    0    0  182  K9J6F1     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  454 : L5MAA7_MYODS        0.58  0.79  122  211   20  109   90    0    0  134  L5MAA7     Ig lambda chain V region 4A OS=Myotis davidii GN=MDA_GLEAN10000952 PE=4 SV=1
  455 : M7BTY3_CHEMY        0.58  0.82  122  218   12  110   99    1    2  112  M7BTY3     Ig lambda chain V region 4A (Fragment) OS=Chelonia mydas GN=UY3_02104 PE=4 SV=1
  456 : Q65ZC8_HUMAN        0.58  0.77    1  120    1  121  125    6    9  244  Q65ZC8     Single-chain Fv (Fragment) OS=Homo sapiens GN=scFv PE=2 SV=1
  457 : Q6P089_HUMAN        0.58  0.78    1  120   20  140  125    5    9  480  Q6P089     IGH@ protein OS=Homo sapiens GN=IGH@ PE=1 SV=1
  458 : Q96QS0_HUMAN        0.58  0.80    1  120   20  149  130    4   10  159  Q96QS0     Putative matrix cell adhesion molecule-3 OS=Homo sapiens PE=1 SV=1
  459 : S6BAM6_HUMAN        0.58  0.77    1  120   20  144  125    2    5  319  S6BAM6     IgG H chain OS=Homo sapiens PE=2 SV=1
  460 : F6QBU2_HORSE        0.57  0.74  122  214    1   93   93    0    0   93  F6QBU2     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  461 : F7E5M1_CALJA        0.57  0.76    1  119   20  135  119    2    3  136  F7E5M1     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  462 : G1Q8R5_MYOLU        0.57  0.77  122  217   20  115   96    0    0  115  G1Q8R5     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  463 : G1Q9K5_MYOLU        0.57  0.78    1  120   20  134  120    1    5  134  G1Q9K5     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  464 : G1QE19_MYOLU        0.57  0.81  122  218    1   97   97    0    0   98  G1QE19     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  465 : S6BGE5_HUMAN        0.57  0.77    1  120   20  140  122    3    3  316  S6BGE5     IgG H chain OS=Homo sapiens PE=2 SV=1
  466 : S6C4S0_HUMAN        0.57  0.78    1  120   20  142  124    2    5  275  S6C4S0     IgG H chain OS=Homo sapiens PE=2 SV=1
  467 : A2N011_HUMAN        0.56  0.76    1  120    1  127  127    3    7  127  A2N011     Vh1-D-J3-region (Fragment) OS=Homo sapiens PE=2 SV=1
  468 : F6V6B7_MONDO        0.56  0.77  122  222    1   97  101    1    4   99  F6V6B7     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
  469 : G1Q097_MYOLU        0.56  0.77    1  117   20  136  120    2    6  139  G1Q097     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  470 : G1Q516_MYOLU        0.56  0.76    1  111   20  131  116    4    9  140  G1Q516     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  471 : G1QF79_MYOLU        0.56  0.79  122  218   20  116   97    0    0  116  G1QF79     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  472 : K7TRJ8_MOUSE        0.56  0.76    9  120    1  113  113    1    1  113  K7TRJ8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  473 : K7TRQ8_MOUSE        0.56  0.79    9  120    1  111  112    1    1  111  K7TRQ8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  474 : K9J6E9_DESRO        0.56  0.78  122  231   20  132  113    2    3  150  K9J6E9     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  475 : M3XR12_MUSPF        0.56  0.72  122  229   20  126  108    1    1  128  M3XR12     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
  476 : Q6N030_HUMAN2NY1    0.56  0.76    1  120   20  141  126    5   10  518  Q6N030     Putative uncharacterized protein DKFZp686I15212 OS=Homo sapiens GN=DKFZp686I15212 PE=1 SV=1
  477 : S6B2A6_HUMAN        0.56  0.75    1  120   20  144  125    3    5  300  S6B2A6     IgG H chain OS=Homo sapiens PE=2 SV=1
  478 : S9Y0L8_9CETA        0.56  0.77  122  230   20  123  109    1    5  123  S9Y0L8     Ig lambda chain V region 4A-like protein OS=Camelus ferus GN=CB1_000760039 PE=4 SV=1
  479 : A2NW97_HUMAN        0.55  0.79    1  120   20  134  120    1    5  134  A2NW97     Rheumatoid factor Vh I region (Fragment) OS=Homo sapiens PE=2 SV=1
  480 : G1P6J6_MYOLU        0.55  0.74  122  224    2  103  103    1    1  118  G1P6J6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  481 : G1Q4S4_MYOLU        0.55  0.72  122  229    1  107  108    1    1  111  G1Q4S4     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  482 : G1QCT5_MYOLU        0.55  0.76    1  120    1  127  127    3    7  127  G1QCT5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  483 : G1QF95_MYOLU        0.55  0.70    1  120   20  149  132    4   14  159  G1QF95     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  484 : G7N3C5_MACMU        0.55  0.78  122  224   25  121  103    1    6  123  G7N3C5     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_02836 PE=4 SV=1
  485 : HV104_HUMAN         0.55  0.76    1  120   20  147  128    3    8  147  P01744     Ig heavy chain V-I region ND (Fragments) OS=Homo sapiens PE=1 SV=2
  486 : HVM38_MOUSE 3U0W    0.55  0.78    1  120    1  118  120    1    2  119  P01808     Ig heavy chain V region T601 OS=Mus musculus PE=1 SV=1
  487 : HVM39_MOUSE         0.55  0.77    1  120    1  117  120    2    3  118  P01809     Ig heavy chain V region X24 OS=Mus musculus PE=1 SV=1
  488 : K7U6B4_MOUSE        0.55  0.79    9  120    1  114  114    1    2  114  K7U6B4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  489 : K9IV73_DESRO        0.55  0.79  122  213   21  112   92    0    0  120  K9IV73     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  490 : K9J0X2_DESRO        0.55  0.79  122  213   16  107   92    0    0  116  K9J0X2     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  491 : Q5EBM2_HUMAN        0.55  0.73    1  120   20  142  125    3    7  519  Q5EBM2     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  492 : Q6KB05_MOUSE1MVU    0.55  0.77    1  120    1  121  123    4    5  255  Q6KB05     ScFv B8E5 protein (Fragment) OS=Mus musculus GN=scFv B8E5 PE=1 SV=1
  493 : Q921A6_MOUSE1ZEA    0.55  0.78    1  120    1  118  122    2    6  241  Q921A6     Anti-CEA 79 single chain Fv (Fragment) OS=Mus musculus PE=1 SV=1
  494 : Q9Y298_HUMAN        0.55  0.72    1  120   20  136  123    6    9  150  Q9Y298     IgG VH protein (Precursor) OS=Homo sapiens GN=IgG VH PE=2 SV=1
  495 : S7PRE3_MYOBR        0.55  0.72  122  230   20  121  109    1    7  121  S7PRE3     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10001437 PE=4 SV=1
  496 : A2KBB9_HUMAN        0.54  0.78    1  120    1  116  120    2    4  238  A2KBB9     Anti-(ED-B) scFV (Fragment) OS=Homo sapiens PE=2 SV=1
  497 : F7DF83_MACMU        0.54  0.79  122  222    1   97  101    1    4   99  F7DF83     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  498 : G1PWV4_MYOLU        0.54  0.75    1  110   20  122  110    1    7  126  G1PWV4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  499 : G1QA07_MYOLU        0.54  0.73  122  230   18  121  109    1    5  130  G1QA07     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  500 : H8EAI0_CLOTM        0.54  0.78    1  120    2  120  120    1    1  151  H8EAI0     Immunoglobulin V-set domain protein (Fragment) OS=Clostridium thermocellum AD2 GN=AD2_3042 PE=4 SV=1
  501 : K7TD05_MOUSE        0.54  0.74    9  120    1  109  112    1    3  109  K7TD05     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  502 : K7TDA3_MOUSE        0.54  0.76    9  120    1  108  112    1    4  108  K7TDA3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  503 : K7TGW3_MOUSE        0.54  0.79    9  120    1  110  112    1    2  110  K7TGW3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  504 : K7TGW8_MOUSE        0.54  0.78    9  120    1  110  112    1    2  110  K7TGW8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  505 : K7TGZ2_MOUSE        0.54  0.78    9  120    1  109  112    1    3  109  K7TGZ2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  506 : K7TR23_MOUSE        0.54  0.76    9  120    1  111  112    1    1  111  K7TR23     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  507 : K7TR59_MOUSE        0.54  0.78    9  120    1  110  112    1    2  110  K7TR59     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  508 : K7TRF6_MOUSE        0.54  0.77    9  120    1  111  112    1    1  111  K7TRF6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  509 : K7TRT7_MOUSE        0.54  0.75    9  120    1  106  112    1    6  106  K7TRT7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  510 : K7U5H8_MOUSE        0.54  0.74    9  120    1  109  112    1    3  109  K7U5H8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  511 : K7U5W1_MOUSE        0.54  0.76    9  120    1  109  112    1    3  109  K7U5W1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  512 : K9J6F0_DESRO        0.54  0.75  122  231   20  132  113    2    3  156  K9J6F0     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  513 : L7N0J2_CANFA        0.54  0.76  122  214   25  117   93    0    0  126  L7N0J2     Uncharacterized protein OS=Canis familiaris GN=LOC100685205 PE=4 SV=1
  514 : L7N0J5_CANFA        0.54  0.75  122  231   49  155  111    3    5  170  L7N0J5     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
  515 : M7BPU2_CHEMY        0.54  0.80  122  226   20  123  107    2    5  156  M7BPU2     Ig lambda chain V region 4A OS=Chelonia mydas GN=UY3_02833 PE=4 SV=1
  516 : Q5NV62_HUMAN        0.54  0.78  122  222    1   97  101    1    4   99  Q5NV62     V3-4 protein (Fragment) OS=Homo sapiens GN=IGLV8-61 PE=4 SV=1
  517 : Q6N091_HUMAN        0.54  0.74    1  120   38  160  125    3    7  500  Q6N091     Putative uncharacterized protein DKFZp686C02220 (Fragment) OS=Homo sapiens GN=DKFZp686C02220 PE=1 SV=1
  518 : Q8WY24_HUMAN        0.54  0.77    1  120   20  144  125    2    5  497  Q8WY24     SNC66 protein OS=Homo sapiens PE=2 SV=1
  519 : A2KBC2_HUMAN        0.53  0.78    1  120    1  116  120    2    4  238  A2KBC2     Anti-(ED-B) scFV (Fragment) OS=Homo sapiens PE=2 SV=1
  520 : A2KBC3_HUMAN        0.53  0.79    1  120    1  116  120    2    4  238  A2KBC3     Anti-(ED-B) scFV (Fragment) OS=Homo sapiens PE=2 SV=1
  521 : A2KBC4_HUMAN        0.53  0.77    1  120    1  116  121    3    6  238  A2KBC4     Anti-TN-C scFv (Fragment) OS=Homo sapiens PE=2 SV=1
  522 : A2KBC5_HUMAN        0.53  0.78    1  120    1  116  120    2    4  238  A2KBC5     Anti-HCS scFv (Fragment) OS=Homo sapiens PE=2 SV=1
  523 : A2KBC6_HUMAN        0.53  0.78    1  120    1  116  121    3    6  238  A2KBC6     Anti-FactorVIII scFv (Fragment) OS=Homo sapiens PE=2 SV=1
  524 : A2KBC7_HUMAN        0.53  0.77    1  120    1  116  121    3    6  238  A2KBC7     Anti-IFN-G scFv (Fragment) OS=Homo sapiens PE=2 SV=1
  525 : A2KBC8_HUMAN        0.53  0.77    1  120    1  116  120    1    4  238  A2KBC8     Anti-TeTox scFv (Fragment) OS=Homo sapiens PE=2 SV=1
  526 : A2NPL2_MOUSE        0.53  0.79    1  120    3  121  120    1    1  121  A2NPL2     QY1.5 Vh (Fragment) OS=Mus musculus PE=2 SV=1
  527 : B5UB66_MOUSE        0.53  0.79    1  120    1  121  121    1    1  121  B5UB66     EP3-1 heavy chain variable region (Fragment) OS=Mus musculus GN=EP3-1VH PE=2 SV=1
  528 : E2QUU8_CANFA        0.53  0.76  122  224   44  143  103    1    3  145  E2QUU8     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
  529 : E2RCC8_CANFA        0.53  0.79    1  120   20  138  121    2    3  473  E2RCC8     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
  530 : F6PVY5_HORSE        0.53  0.78  122  213    1   92   92    0    0   92  F6PVY5     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  531 : HVM37_MOUSE         0.53  0.77    1  120    1  118  120    1    2  119  P01807     Ig heavy chain V region X44 OS=Mus musculus PE=1 SV=1
  532 : HVM40_MOUSE 2FBJ    0.53  0.77    1  120    1  118  120    1    2  119  P01810     Ig heavy chain V region J539 OS=Mus musculus PE=1 SV=1
  533 : HVM41_MOUSE 1UZ8    0.53  0.77    1  120    1  117  120    1    3  117  P01811     Ig heavy chain V region UPC10 OS=Mus musculus PE=1 SV=1
  534 : K7F7N7_PELSI        0.53  0.68    1  110  128  236  115    4   11  242  K7F7N7     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  535 : K7FLV7_PELSI        0.53  0.78  122  221   20  120  101    1    1  120  K7FLV7     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  536 : K7T958_MOUSE        0.53  0.75    9  120    1  111  113    2    3  111  K7T958     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  537 : K7TD77_MOUSE        0.53  0.76    9  120    1  114  114    2    2  114  K7TD77     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  538 : K7THF4_MOUSE        0.53  0.78   15  120    1  107  107    1    1  107  K7THF4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  539 : K7TRN5_MOUSE        0.53  0.78    9  120    1  114  114    2    2  114  K7TRN5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  540 : K7U5Q9_MOUSE        0.53  0.75    9  120    1  111  113    2    3  111  K7U5Q9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  541 : L5KZ88_PTEAL        0.53  0.74  122  230   20  121  109    1    7  121  L5KZ88     Ig lambda chain V region 4A OS=Pteropus alecto GN=PAL_GLEAN10000188 PE=4 SV=1
  542 : L7N0E5_CANFA        0.53  0.76  122  224   44  143  103    1    3  145  L7N0E5     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
  543 : O95978_HUMAN        0.53  0.75    1  120   20  140  122    3    3  157  O95978     VH1 protein (Precursor) OS=Homo sapiens GN=VH1 PE=1 SV=1
  544 : Q0ZCH4_HUMAN        0.53  0.78    2  120    2  117  119    1    3  117  Q0ZCH4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  545 : Q0ZCI6_HUMAN        0.53  0.77    2  120    3  122  120    1    1  122  Q0ZCI6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  546 : Q0ZCJ2_HUMAN        0.53  0.78    2  120    2  124  123    2    4  124  Q0ZCJ2     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  547 : Q4VBH1_RAT  2HLF    0.53  0.77    1  120   20  141  122    2    2  467  Q4VBH1     Ighg protein OS=Rattus norvegicus GN=Ighg PE=2 SV=1
  548 : Q91WP5_MOUSE        0.53  0.75    1  120   20  134  120    1    5  479  Q91WP5     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  549 : Q91Z07_MOUSE        0.53  0.73    1  120   20  142  124    3    5  486  Q91Z07     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  550 : Q920E7_MOUSE        0.53  0.77    1  120    1  119  121    2    3  119  Q920E7     Pterin-mimicking anti-idiotope heavy chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
  551 : S6AWG0_HUMAN        0.53  0.73    1  120   20  143  128    5   12  236  S6AWG0     IgG H chain OS=Homo sapiens PE=2 SV=1
  552 : S7MCY4_MYOBR        0.53  0.69  136  230   16  105   95    1    5  105  S7MCY4     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10000643 PE=4 SV=1
  553 : S7NWR3_MYOBR        0.53  0.69  131  230    1   93  100    1    7   93  S7NWR3     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10000642 PE=4 SV=1
  554 : A2KBC0_HUMAN        0.52  0.77    1  120    1  116  120    2    4  238  A2KBC0     Anti-(ED-B) scFV (Fragment) OS=Homo sapiens PE=2 SV=1
  555 : A2KBC1_HUMAN        0.52  0.77    1  120    1  116  120    2    4  236  A2KBC1     Anti-(ED-B) scFV (Fragment) OS=Homo sapiens PE=2 SV=2
  556 : A2KUC3_HUMAN        0.52  0.77    1  120    1  121  121    1    1  121  A2KUC3     UGa8H (Fragment) OS=Homo sapiens GN=IGHV PE=4 SV=1
  557 : A2NKM6_HUMAN        0.52  0.77    4  120    1  115  117    1    2  121  A2NKM6     NANUC-1 heavy chain (Fragment) OS=Homo sapiens PE=2 SV=1
  558 : A2NUT3_HUMAN        0.52  0.75    1  120   20  144  126    3    7  161  A2NUT3     Mu-chain (AA -19 to 142) (Precursor) OS=Homo sapiens PE=2 SV=1
  559 : A8K008_HUMAN3CFJ    0.52  0.73    1  120   20  142  126    6    9  472  A8K008     cDNA FLJ78387 OS=Homo sapiens PE=2 SV=1
  560 : B5UB70_MOUSE        0.52  0.77    1  120    1  116  120    1    4  116  B5UB70     EP3-31 heavy chain variable region (Fragment) OS=Mus musculus GN=EP3-31VH PE=2 SV=1
  561 : E2RTC1_CANFA        0.52  0.75  122  222   29  128  101    1    1  129  E2RTC1     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=2
  562 : F7DB46_HORSE        0.52  0.75  122  223    1   99  102    1    3   99  F7DB46     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  563 : H2PXS9_PONAB        0.52  0.77  122  224   20  116  103    1    6  118  H2PXS9     Uncharacterized protein OS=Pongo abelii GN=IGLV8-61 PE=4 SV=1
  564 : HVM42_MOUSE         0.52  0.76    1  120    1  117  120    1    3  117  P01812     Ig heavy chain V region MOPC 173 OS=Mus musculus PE=1 SV=1
  565 : K7T9J4_MOUSE        0.52  0.77    9  120    1  111  113    2    3  111  K7T9J4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  566 : K7T9L3_MOUSE        0.52  0.76    9  120    1  115  115    2    3  115  K7T9L3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  567 : K7TD00_MOUSE        0.52  0.78    9  120    1  109  112    2    3  109  K7TD00     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  568 : K7TD49_MOUSE        0.52  0.75    9  120    1  111  113    2    3  111  K7TD49     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  569 : K7TH23_MOUSE        0.52  0.77    9  120    1  111  113    2    3  111  K7TH23     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  570 : K7TH90_MOUSE        0.52  0.75    9  120    1  115  115    2    3  115  K7TH90     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  571 : K7THE9_MOUSE        0.52  0.75   15  120    1  105  108    3    5  105  K7THE9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  572 : K7TQZ1_MOUSE        0.52  0.75    9  120    1  112  113    2    2  112  K7TQZ1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  573 : K7U686_MOUSE        0.52  0.75    9  120    1  115  115    2    3  115  K7U686     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  574 : L5MBY3_MYODS        0.52  0.74  122  230   31  132  109    1    7  132  L5MBY3     Ig lambda chain V region 4A OS=Myotis davidii GN=MDA_GLEAN10000943 PE=4 SV=1
  575 : M7BRT9_CHEMY        0.52  0.79  122  226   20  123  107    2    5  136  M7BRT9     Ig lambda chain V region 4A OS=Chelonia mydas GN=UY3_02836 PE=4 SV=1
  576 : Q0ZCG7_HUMAN        0.52  0.76    2  120    3  121  120    2    2  121  Q0ZCG7     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  577 : Q0ZCI0_HUMAN        0.52  0.74    2  120    2  122  121    1    2  122  Q0ZCI0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  578 : Q0ZCJ0_HUMAN        0.52  0.77    2  120    3  125  123    2    4  125  Q0ZCJ0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  579 : Q5F2I8_MOUSE        0.52  0.76    1  119    1  119  119    0    0  119  Q5F2I8     Gamma heavy chain variable region (Fragment) OS=Mus musculus GN=IgG1 TS1 VH PE=2 SV=1
  580 : Q5RE17_PONAB        0.52  0.74    1  119   20  144  125    2    6  475  Q5RE17     Putative uncharacterized protein DKFZp469C2335 OS=Pongo abelii GN=DKFZp469C2335 PE=2 SV=1
  581 : Q65ZC9_HUMAN2GHW    0.52  0.77    1  120    1  117  120    1    3  240  Q65ZC9     Single-chain Fv (Fragment) OS=Homo sapiens GN=scFv PE=1 SV=1
  582 : Q6ZP87_HUMAN        0.52  0.74    1  120   20  140  123    2    5  208  Q6ZP87     CDNA FLJ26266 fis, clone DMC05613 OS=Homo sapiens PE=1 SV=1
  583 : Q925S1_MOUSE        0.52  0.77    1  120    3  120  123    6    8  218  Q925S1     MRP5 (Fragment) OS=Mus musculus GN=Ighv9-4 PE=2 SV=1
  584 : Q96DK0_HUMAN        0.52  0.73    1  120   20  143  124    1    4  496  Q96DK0     CDNA FLJ25298 fis, clone STM07683, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=2 SV=1
  585 : Q99KA4_MOUSE        0.52  0.73    1  120   20  143  124    3    4  487  Q99KA4     Igh protein OS=Mus musculus GN=Igh-VJ558 PE=2 SV=1
  586 : S7NAU9_MYOBR        0.52  0.73  122  230   20  123  109    1    5  123  S7NAU9     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10001434 PE=4 SV=1
  587 : S7QB31_MYOBR        0.52  0.71  122  230   20  121  109    1    7  121  S7QB31     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10000620 PE=4 SV=1
  588 : A2JA14_HUMAN        0.51  0.74    1  119    1  124  124    3    5  124  A2JA14     Anti-mucin1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  589 : A2NN81_MOUSE2OTU    0.51  0.74    1  120   20  142  123    2    3  269  A2NN81     B9-scFv OS=Mus musculus GN=Igh-V7183 PE=2 SV=1
  590 : A2NV20_MOUSE        0.51  0.72    1  120   20  138  120    1    1  138  A2NV20     Precursor polypeptide (AA -19 to 119) (480 is 1st base in codon) (Precursor) OS=Mus musculus GN=Ighv5-9 PE=2 SV=1
  591 : A2NZ55_HUMAN        0.51  0.76    1  120    1  123  123    3    3  131  A2NZ55     Variable immnoglobulin anti-estradiol heavy chain (Fragment) OS=Homo sapiens PE=2 SV=1
  592 : F6RZJ5_HORSE        0.51  0.70  124  218    4   99   96    1    1   99  F6RZJ5     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  593 : G3SCK2_GORGO        0.51  0.73    1  110   20  121  110    1    8  125  G3SCK2     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  594 : G8F4Z1_MACFA        0.51  0.75  122  229   20  121  108    1    6  121  G8F4Z1     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_20680 PE=4 SV=1
  595 : HV105_HUMAN         0.51  0.70    1  120    1  122  122    2    2  124  P01760     Ig heavy chain V-I region WOL OS=Homo sapiens PE=1 SV=1
  596 : HV108_HUMAN         0.51  0.73    2  120    2  120  120    2    2  120  P80421     Ig heavy chain V-I region DOT OS=Homo sapiens PE=1 SV=1
  597 : HVM16_MOUSE 4KVC    0.51  0.75    1  120   17  136  122    3    4  136  P01783     Ig heavy chain V region MOPC 21 (Fragment) OS=Mus musculus PE=1 SV=1
  598 : I3N7X2_SPETR        0.51  0.72  125  229    2  100  105    1    6  100  I3N7X2     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=IGLV8-61 PE=4 SV=1
  599 : J9NVC6_CANFA        0.51  0.77    1  120   26  143  123    4    8  620  J9NVC6     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
  600 : K7FLT5_PELSI        0.51  0.76  122  226   20  128  109    2    4  134  K7FLT5     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  601 : K7T977_MOUSE        0.51  0.78    9  120    1  111  113    2    3  111  K7T977     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  602 : K7T999_MOUSE        0.51  0.77    9  120    1  110  112    2    2  110  K7T999     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  603 : K7T9D0_MOUSE        0.51  0.75    9  120    1  107  113    2    7  107  K7T9D0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  604 : K7T9G9_MOUSE        0.51  0.73    9  120    1  111  114    2    5  111  K7T9G9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  605 : K7TD11_MOUSE        0.51  0.75    9  120    1  110  113    2    4  110  K7TD11     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  606 : K7TD63_MOUSE        0.51  0.73    9  120    1  110  113    2    4  110  K7TD63     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  607 : K7TDP8_MOUSE        0.51  0.75    9  120    1  111  114    3    5  111  K7TDP8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  608 : K7TGR2_MOUSE        0.51  0.77    9  120    1  111  113    2    3  111  K7TGR2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  609 : K7TRG2_MOUSE        0.51  0.72   15  120    1  106  110    3    8  106  K7TRG2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  610 : K7TRH7_MOUSE        0.51  0.73    9  120    1  112  114    2    4  112  K7TRH7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  611 : K7U5I4_MOUSE        0.51  0.76    9  120    1  108  113    2    6  108  K7U5I4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  612 : K7U664_MOUSE        0.51  0.76    9  120    1  107  112    2    5  107  K7U664     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  613 : K7U6J5_MOUSE        0.51  0.74   16  120    1  102  106    2    5  102  K7U6J5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  614 : K9IQU5_DESRO        0.51  0.78    1  120   36  153  122    4    6  166  K9IQU5     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  615 : Q0ZCG5_HUMAN        0.51  0.75    2  120    3  122  120    1    1  122  Q0ZCG5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  616 : Q0ZCH7_HUMAN        0.51  0.76    2  120    2  117  119    1    3  117  Q0ZCH7     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  617 : Q0ZCI8_HUMAN        0.51  0.77    2  120    2  124  123    2    4  124  Q0ZCI8     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  618 : Q0ZCI9_HUMAN        0.51  0.74    1  120    1  126  126    2    6  126  Q0ZCI9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  619 : Q0ZCJ6_HUMAN        0.51  0.72    2  120    3  125  123    3    4  125  Q0ZCJ6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  620 : Q91Z05_MOUSE1T66    0.51  0.74    1  120   20  137  121    3    4  473  Q91Z05     Ighg protein OS=Mus musculus GN=Ighg PE=1 SV=1
  621 : Q99LA6_MOUSE        0.51  0.75    1  120   20  140  123    3    5  484  Q99LA6     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  622 : Q9NSD6_HUMAN        0.51  0.73  125  231    2  107  109    2    5  107  Q9NSD6     This CDS feature is included to show the translation of the corresponding V_region. Presently translation qualifiers on V_region features are illegal. (Fragment) OS=Homo sapiens GN=IGLV3-19 PE=2 SV=1
  623 : Q9UL73_HUMAN        0.51  0.76    1  120    1  119  120    1    1  119  Q9UL73     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  624 : S6BAP4_HUMAN        0.51  0.75    1  120   20  140  122    3    3  275  S6BAP4     IgG H chain OS=Homo sapiens PE=2 SV=1
  625 : A0N5G7_HUMAN        0.50  0.73    8  120    1  114  117    3    7  119  A0N5G7     Rheumatoid factor D5 heavy chain (Fragment) OS=Homo sapiens GN=VH3 PE=2 SV=1
  626 : A0N7J2_9MURI3VRL    0.50  0.74    1  120    1  116  121    2    6  219  A0N7J2     Mc5 VHCH1 (Fragment) OS=Mus sp. GN=Mc5 VHCH1 PE=1 SV=1
  627 : A2J422_HUMAN        0.50  0.74    1  120    1  122  125    2    8  244  A2J422     Anti-HER3 scFv (Fragment) OS=Homo sapiens PE=2 SV=1
  628 : A2J423_HUMAN        0.50  0.72    1  120    1  117  121    3    5  239  A2J423     Anti-Mpl scFv (Fragment) OS=Homo sapiens PE=2 SV=1
  629 : E2RMZ5_CANFA        0.50  0.70  122  230   11  112  109    1    7  112  E2RMZ5     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=2
  630 : F1D886_MACMU        0.50  0.71    1  120   12  144  133    4   13  163  F1D886     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
  631 : F6UJR1_ORNAN        0.50  0.78  122  217   22  116   96    1    1  117  F6UJR1     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=1
  632 : F7E2I9_XENTR        0.50  0.73    1  110    1  111  113    3    5  255  F7E2I9     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
  633 : G1PYQ8_MYOLU        0.50  0.73    1  119    1  117  119    1    2  118  G1PYQ8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  634 : HV310_HUMAN         0.50  0.75    1  120    1  121  122    3    3  121  P01771     Ig heavy chain V-III region HIL OS=Homo sapiens PE=1 SV=1
  635 : K7F2B4_PELSI        0.50  0.75  122  230   20  120  109    1    8  120  K7F2B4     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  636 : K7T935_MOUSE        0.50  0.77    9  120    1  108  113    2    6  108  K7T935     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  637 : K7T9U6_MOUSE        0.50  0.74    7  120    1  112  115    2    4  112  K7T9U6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  638 : K7TD38_MOUSE        0.50  0.71    9  120    1  108  113    2    6  108  K7TD38     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  639 : K7TGQ7_MOUSE        0.50  0.76    9  120    1  110  113    2    4  110  K7TGQ7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  640 : K7TGX7_MOUSE        0.50  0.74    9  120    1  114  115    4    4  114  K7TGX7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  641 : K7TGY7_MOUSE        0.50  0.70    9  120    1  111  115    3    7  111  K7TGY7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  642 : K7TQY2_MOUSE        0.50  0.72    9  120    1  110  114    2    6  110  K7TQY2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  643 : K7TRH0_MOUSE        0.50  0.75    9  120    1  114  114    1    2  114  K7TRH0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  644 : K7U634_MOUSE        0.50  0.75    9  120    1  111  113    2    3  111  K7U634     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  645 : K7U6I4_MOUSE        0.50  0.73    9  120    1  110  113    2    4  110  K7U6I4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  646 : K9J494_DESRO        0.50  0.73    1  120   37  157  125    3    9  171  K9J494     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  647 : L5LME0_MYODS        0.50  0.67    1  115   20  131  118    3    9  145  L5LME0     Ig heavy chain V-I region V35 OS=Myotis davidii GN=MDA_GLEAN10001230 PE=4 SV=1
  648 : M3XMR4_MUSPF        0.50  0.72  122  231   20  129  111    2    2  129  M3XMR4     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
  649 : Q0ZCG4_HUMAN        0.50  0.75    2  120    3  122  120    1    1  122  Q0ZCG4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  650 : Q0ZCG6_HUMAN        0.50  0.76    2  120    3  118  119    2    3  118  Q0ZCG6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  651 : Q0ZCH0_HUMAN        0.50  0.76    2  120    2  119  120    2    3  119  Q0ZCH0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  652 : Q0ZCH9_HUMAN        0.50  0.76    1  120    1  121  122    2    3  121  Q0ZCH9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  653 : Q0ZCI3_HUMAN        0.50  0.72    2  120    3  124  123    3    5  124  Q0ZCI3     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  654 : Q0ZCJ4_HUMAN        0.50  0.75    2  117    3  120  118    2    2  120  Q0ZCJ4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  655 : Q5I0J0_RAT          0.50  0.73    1  120   20  139  121    2    2  465  Q5I0J0     Immunoglobulin heavy chain (Gamma polypeptide) OS=Rattus norvegicus GN=Ighg PE=2 SV=1
  656 : Q5M7V3_RAT          0.50  0.69    1  120   20  139  124    5    8  461  Q5M7V3     LOC367586 protein OS=Rattus norvegicus GN=LOC367586 PE=2 SV=1
  657 : Q6GMX6_HUMAN1ZA6    0.50  0.76    1  120   20  135  120    3    4  465  Q6GMX6     IGH@ protein OS=Homo sapiens GN=IGH@ PE=1 SV=1
  658 : Q6N089_HUMAN1U6A    0.50  0.73    1  120   20  142  125    3    7  472  Q6N089     Putative uncharacterized protein DKFZp686P15220 OS=Homo sapiens GN=DKFZp686P15220 PE=1 SV=1
  659 : Q6N096_HUMAN        0.50  0.74    1  120   20  136  121    3    5  466  Q6N096     Putative uncharacterized protein DKFZp686I15196 OS=Homo sapiens GN=DKFZp686I15196 PE=2 SV=1
  660 : Q9HCC1_HUMAN1T2J    0.50  0.77    1  116    1  112  117    2    6  112  Q9HCC1     Single chain Fv (Fragment) OS=Homo sapiens PE=1 SV=1
  661 : S6B291_HUMAN        0.50  0.75    1  120   20  136  121    3    5  466  S6B291     IgG H chain OS=Homo sapiens PE=2 SV=1
  662 : S6C4Q7_HUMAN        0.50  0.75    1  120   20  140  122    3    3  300  S6C4Q7     IgG H chain OS=Homo sapiens PE=2 SV=1
  663 : S7N882_MYOBR        0.50  0.71  122  230   20  121  109    1    7  121  S7N882     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10001438 PE=4 SV=1
  664 : S7PY14_MYOBR        0.50  0.72  122  230   20  121  109    1    7  121  S7PY14     Ig lambda chain V region 4A OS=Myotis brandtii GN=D623_10001436 PE=4 SV=1
  665 : A0N587_9MURI        0.49  0.76    1  120   20  139  121    2    2  139  A0N587     Anti-CD4 mAb M-T151 variable region heavy chain (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  666 : A2J1N6_HUMAN        0.49  0.72    4  114    1  114  114    2    3  115  A2J1N6     Rheumatoid factor RF-ET9 (Fragment) OS=Homo sapiens PE=2 SV=1
  667 : A2KD56_LAMGL        0.49  0.72    1  120    1  118  120    1    2  118  A2KD56     Hi15 protein (Fragment) OS=Lama glama GN=hi15 PE=4 SV=1
  668 : A2N192_HUMAN        0.49  0.73    1  120   18  141  124    3    4  151  A2N192     Immunglobulin heavy chain (Precursor) OS=Homo sapiens GN=IGH@ PE=2 SV=1
  669 : F1D887_MACMU        0.49  0.70    1  120   12  143  133    6   14  162  F1D887     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
  670 : F6RL43_MACMU        0.49  0.76    1  120   20  136  121    3    5  469  F6RL43     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  671 : F8SQR6_RAT          0.49  0.73    1  120    2  117  120    1    4  117  F8SQR6     Immunglobulin heavy chain variable region (Fragment) OS=Rattus norvegicus PE=2 SV=1
  672 : G1FM85_HUMAN        0.49  0.72    1  120    1  129  129    3    9  129  G1FM85     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  673 : G3PGZ8_GASAC        0.49  0.73    4  120   23  137  118    2    4  587  G3PGZ8     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  674 : HVM35_MOUSE         0.49  0.75    6  120    1  111  117    3    8  111  P01804     Ig heavy chain V-III region HPC76 (Fragment) OS=Mus musculus PE=4 SV=1
  675 : HVM63_MOUSE 1ZAN    0.49  0.72    1  120    1  120  123    4    6  237  P84751     Ig heavy chain Mem5 (Fragment) OS=Mus musculus PE=1 SV=1
  676 : K7TDG3_MOUSE        0.49  0.73    9  120    1  111  113    2    3  111  K7TDG3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  677 : K7TDM9_MOUSE        0.49  0.75    9  120    1  111  114    3    5  111  K7TDM9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  678 : K7TDP0_MOUSE        0.49  0.74    9  120    1  111  114    2    5  111  K7TDP0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  679 : K7TGS1_MOUSE        0.49  0.75    9  120    1  111  114    3    5  111  K7TGS1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  680 : K7TH81_MOUSE        0.49  0.74    9  120    1  111  114    3    5  111  K7TH81     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  681 : K7THB6_MOUSE        0.49  0.72    9  120    1  111  114    2    5  111  K7THB6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  682 : K7TRB1_MOUSE        0.49  0.73    9  120    1  111  113    2    3  111  K7TRB1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  683 : K7TRG8_MOUSE        0.49  0.73    9  120    1  111  113    2    3  111  K7TRG8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  684 : K7TRP7_MOUSE        0.49  0.69   16  120    1  106  108    2    5  106  K7TRP7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  685 : K7TRS8_MOUSE        0.49  0.72    9  120    1  112  115    3    6  112  K7TRS8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  686 : K7TRU7_MOUSE        0.49  0.71    9  120    1  114  114    2    2  114  K7TRU7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  687 : K7U5Y3_MOUSE        0.49  0.73    9  120    1  108  113    3    6  108  K7U5Y3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  688 : K7U672_MOUSE        0.49  0.72    9  120    1  112  114    2    4  112  K7U672     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  689 : K7U6F6_MOUSE        0.49  0.70    9  120    1  113  115    3    5  113  K7U6F6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  690 : LV301_HUMAN         0.49  0.73  125  231    3  108  109    2    5  108  P01714     Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1
  691 : Q0ZCF2_HUMAN        0.49  0.75    2  120    3  122  122    3    5  122  Q0ZCF2     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  692 : Q0ZCH8_HUMAN        0.49  0.73    2  117    1  113  118    4    7  113  Q0ZCH8     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  693 : Q0ZCJ3_HUMAN        0.49  0.74    2  120    2  118  120    2    4  118  Q0ZCJ3     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  694 : Q4V9Z4_MOUSE        0.49  0.74    1  120   19  131  121    4    9  476  Q4V9Z4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  695 : Q6MZU6_HUMAN        0.49  0.76    1  120   20  138  122    3    5  464  Q6MZU6     Putative uncharacterized protein DKFZp686C15213 OS=Homo sapiens GN=DKFZp686C15213 PE=1 SV=1
  696 : Q6MZW0_HUMAN        0.49  0.70    1  120   37  153  122    3    7  506  Q6MZW0     Putative uncharacterized protein DKFZp686J11235 (Fragment) OS=Homo sapiens GN=DKFZp686J11235 PE=1 SV=1
  697 : Q6N095_HUMAN2NXY    0.49  0.73    1  120   20  145  127    3    8  475  Q6N095     Putative uncharacterized protein DKFZp686K03196 OS=Homo sapiens GN=DKFZp686K03196 PE=1 SV=1
  698 : Q6PDB8_MOUSE        0.49  0.75    1  120   20  140  123    2    5  485  Q6PDB8     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  699 : Q8NCL6_HUMAN        0.49  0.70    1  120   20  140  122    3    3  493  Q8NCL6     cDNA FLJ90170 fis, clone MAMMA1000370, highly similar to Ig alpha-1 chain C region OS=Homo sapiens PE=1 SV=1
  700 : Q8VEA0_MOUSE        0.49  0.70    1  120   20  139  122    2    4  484  Q8VEA0     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  701 : Q9UL90_HUMAN        0.49  0.74    1  120    1  113  120    1    7  113  Q9UL90     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  702 : Q9UL91_HUMAN        0.49  0.73    1  119    1  117  121    2    6  118  Q9UL91     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  703 : S6BAP0_HUMAN        0.49  0.75    1  120   20  136  121    3    5  229  S6BAP0     IgG H chain OS=Homo sapiens PE=2 SV=1
  704 : S6BGF5_HUMAN        0.49  0.73    1  120   20  147  128    2    8  240  S6BGF5     IgG H chain OS=Homo sapiens PE=2 SV=1
  705 : A0N4E8_RAT          0.48  0.64  122  227   20  126  109    4    5  126  A0N4E8     Productively rearranged V-lambda-2 (Precursor) OS=Rattus norvegicus PE=2 SV=1
  706 : A0N5T8_9MURI        0.48  0.75    1  120    1  125  126    4    7  125  A0N5T8     Anti-hepatitis B virus core antigen MoAb C1-5 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  707 : A1L3I1_XENLA        0.48  0.75    1  120   20  140  122    3    3  562  A1L3I1     LOC398774 protein OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
  708 : A2J1C8_MOUSE        0.48  0.70    1  120    1  117  122    2    7  117  A2J1C8     McAB 0.1C3 mmunoglobulin heavy chain (Fragment) OS=Mus musculus PE=2 SV=1
  709 : A2KUC4_HUMAN        0.48  0.69  125  231    2  110  110    3    4  112  A2KUC4     UGa8L (Fragment) OS=Homo sapiens GN=IGLV PE=4 SV=1
  710 : A2NUE8_MOUSE2AJV    0.48  0.73    1  120   19  137  123    5    7  149  A2NUE8     Vh gene product (Fragment) OS=Mus musculus PE=2 SV=1
  711 : A2NYV5_HUMAN        0.48  0.69  124  231    1  109  110    2    3  111  A2NYV5     Light chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
  712 : A8WG82_DANRE        0.48  0.71    4  120   20  130  117    4    6  568  A8WG82     Ighm protein OS=Danio rerio GN=ighm PE=2 SV=1
  713 : B6EDE2_HUMAN        0.48  0.75    2  120    2  123  122    2    3  123  B6EDE2     Epididymis luminal protein 180 (Fragment) OS=Homo sapiens GN=HEL180 PE=2 SV=1
  714 : F6RL61_MACMU        0.48  0.74    1  120   20  141  123    2    4  474  F6RL61     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  715 : F7D7L3_MACMU        0.48  0.73    1  120   20  142  124    2    5  475  F7D7L3     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  716 : F7H602_MACMU        0.48  0.72    1  120   20  147  128    3    8  480  F7H602     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  717 : G1PXZ7_MYOLU        0.48  0.75    1  111    1  108  113    3    7  244  G1PXZ7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  718 : G1PZF7_MYOLU        0.48  0.71    1  114    1  118  119    3    6  123  G1PZF7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  719 : G1Q1H9_MYOLU        0.48  0.74    1  112    1  106  112    1    6  114  G1Q1H9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  720 : G1Q4Z9_MYOLU        0.48  0.71    2  112    1  117  117    3    6  125  G1Q4Z9     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  721 : G1RH32_NOMLE        0.48  0.76    1  120   56  172  120    2    3  287  G1RH32     Uncharacterized protein OS=Nomascus leucogenys PE=4 SV=2
  722 : G3PGY2_GASAC        0.48  0.69    4  120   10  132  123    3    6  502  G3PGY2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  723 : G3PH38_GASAC        0.48  0.72    4  120   22  136  119    4    6  596  G3PH38     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  724 : HV107_HUMAN         0.48  0.72    1  120    1  125  125    3    5  125  P06326     Ig heavy chain V-I region Mot OS=Homo sapiens PE=1 SV=1
  725 : HV302_HUMAN         0.48  0.74    1  120    1  114  120    1    6  114  P01763     Ig heavy chain V-III region WEA OS=Homo sapiens PE=1 SV=1
  726 : HV304_HUMAN         0.48  0.70    1  120    1  115  122    3    9  115  P01765     Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1
  727 : HV307_HUMAN         0.48  0.74    1  120    1  122  122    2    2  122  P01768     Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1
  728 : HVM46_MOUSE         0.48  0.72    1  120   19  137  123    4    7  137  P01822     Ig heavy chain V region MOPC 315 OS=Mus musculus PE=1 SV=2
  729 : I3ISX9_DANRE        0.48  0.69    4  120   21  135  118    3    4  573  I3ISX9     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  730 : I6L985_MOUSE        0.48  0.71    1  120   20  145  126    3    6  469  I6L985     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  731 : K7T918_MOUSE        0.48  0.72    9  120    1  112  115    2    6  112  K7T918     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  732 : K7T942_MOUSE        0.48  0.71    9  120    1  110  114    2    6  110  K7T942     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  733 : K7T9H4_MOUSE        0.48  0.73    9  120    1  111  113    2    3  111  K7T9H4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  734 : K7T9L8_MOUSE        0.48  0.71    9  120    1  115  118    3    9  115  K7T9L8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  735 : K7TDE9_MOUSE        0.48  0.69    9  120    1  112  115    3    6  112  K7TDE9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  736 : K7TDR4_MOUSE        0.48  0.70   13  120    1  103  110    4    9  103  K7TDR4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  737 : K7TDT7_MOUSE        0.48  0.71    9  120    1  112  114    2    4  112  K7TDT7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  738 : K7TDU6_MOUSE        0.48  0.72   11  120    1  109  111    3    3  109  K7TDU6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  739 : K7TH28_MOUSE        0.48  0.74    9  120    1  108  112    2    4  108  K7TH28     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  740 : K7TH31_MOUSE        0.48  0.72    9  120    1  112  114    2    4  112  K7TH31     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  741 : K7TQZ6_MOUSE        0.48  0.73    9  120    1  111  115    4    7  111  K7TQZ6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  742 : K7U5K6_MOUSE        0.48  0.71    9  120    1  110  114    2    6  110  K7U5K6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  743 : K7U5S0_MOUSE        0.48  0.71    9  120    1  112  114    2    4  112  K7U5S0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  744 : K9IL19_DESRO        0.48  0.71    1  120   20  146  127    3    7  529  K9IL19     Putative secreted protein OS=Desmodus rotundus PE=2 SV=1
  745 : K9J2X3_DESRO        0.48  0.73    1  120   13  134  124    3    6  472  K9J2X3     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  746 : LV601_HUMAN         0.48  0.72  124  231    3  112  111    3    4  112  P01721     Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1
  747 : Q0ZCF5_HUMAN        0.48  0.75    2  120    3  122  122    3    5  122  Q0ZCF5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  748 : Q0ZCG9_HUMAN        0.48  0.74    2  120    3  121  122    3    6  121  Q0ZCG9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  749 : Q0ZCH1_HUMAN        0.48  0.72    2  120    2  118  122    4    8  118  Q0ZCH1     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  750 : Q0ZCH5_HUMAN        0.48  0.72    2  120    3  119  122    4    8  119  Q0ZCH5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  751 : Q0ZCI4_HUMAN        0.48  0.71    2  120    3  125  126    4   10  125  Q0ZCI4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  752 : Q0ZCJ1_HUMAN        0.48  0.71    2  113    2  114  116    2    7  121  Q0ZCJ1     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  753 : Q0ZCJ5_HUMAN        0.48  0.72    2  120    3  121  123    4    8  121  Q0ZCJ5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  754 : Q2VT28_MOUSE        0.48  0.71    1  120    1  123  126    4    9  123  Q2VT28     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  755 : Q5BJ31_DANRE        0.48  0.69    4  120   21  132  117    3    5  570  Q5BJ31     Ighm protein OS=Danio rerio GN=ighm PE=2 SV=1
  756 : Q5U413_MOUSE        0.48  0.73    1  120   19  138  122    4    4  483  Q5U413     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  757 : Q5XHD5_XENLA        0.48  0.73    1  120   18  136  122    2    5  589  Q5XHD5     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  758 : Q65ZL3_9MURI        0.48  0.73    1  120   20  139  123    2    6  140  Q65ZL3     Tg10H (Fragment) OS=Mus sp. GN=Tg10H PE=2 SV=1
  759 : Q91XE1_MOUSE        0.48  0.73    1  120   19  135  121    4    5  480  Q91XE1     Igh protein (Fragment) OS=Mus musculus GN=Igh PE=2 SV=1
  760 : Q96JD1_HUMAN1PW3    0.48  0.70  124  231    3  112  111    3    4  112  Q96JD1     Amyloid lambda 6 light chain variable region PIP (Fragment) OS=Homo sapiens PE=1 SV=1
  761 : Q9UL71_HUMAN        0.48  0.74    1  120    1  121  124    2    7  121  Q9UL71     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  762 : Q9UL72_HUMAN        0.48  0.75    1  120    1  118  121    3    4  118  Q9UL72     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  763 : Q9UL84_HUMAN        0.48  0.72    1  120    1  122  122    2    2  122  Q9UL84     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  764 : Q9UL88_HUMAN        0.48  0.69    1  120    1  131  131    4   11  131  Q9UL88     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  765 : Q9UL93_HUMAN        0.48  0.74    2  120    1  116  120    3    5  116  Q9UL93     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  766 : S6AWD9_HUMAN        0.48  0.74    1  120   20  136  121    3    5  311  S6AWD9     IgG H chain OS=Homo sapiens PE=2 SV=1
  767 : S6BAN1_HUMAN        0.48  0.70    1  120   20  143  130    5   16  318  S6BAN1     IgG H chain OS=Homo sapiens PE=2 SV=1
  768 : S6C4R2_HUMAN        0.48  0.72    1  120   20  141  126    6   10  275  S6C4R2     IgG H chain OS=Homo sapiens PE=2 SV=1
  769 : A2P2G2_SHEEP        0.47  0.71    1  120   20  140  122    3    3  140  A2P2G2     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  770 : B1N7B6_HUMAN        0.47  0.76    1  120    1  120  123    2    6  120  B1N7B6     Cryocrystalglobulin CC1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  771 : B1N7B7_HUMAN        0.47  0.71    1  120    1  121  124    2    7  121  B1N7B7     Cryocrystalglobulin CC2 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  772 : F6RL33_MACMU        0.47  0.73    1  120   20  137  123    3    8  470  F6RL33     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  773 : F6W3M2_MACMU        0.47  0.74    1  120   20  139  123    3    6  614  F6W3M2     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  774 : F7E0L9_MACMU        0.47  0.72    1  120   20  145  126    1    6  547  F7E0L9     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  775 : G1FM90_HUMAN        0.47  0.71    1  120    1  129  129    3    9  129  G1FM90     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  776 : G1FM92_HUMAN        0.47  0.71    1  120    1  129  129    3    9  129  G1FM92     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  777 : G1FM93_HUMAN        0.47  0.71    1  120    1  129  129    3    9  129  G1FM93     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  778 : G1Q6S7_MYOLU        0.47  0.69    1  120    1  117  123    5    9  238  G1Q6S7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  779 : G1QBP2_MYOLU        0.47  0.70    1  111    1  121  121    4   10  130  G1QBP2     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  780 : G1QD65_MYOLU        0.47  0.72    1  112    1  106  112    1    6  119  G1QD65     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  781 : G1QD73_MYOLU        0.47  0.70    1  114    1  112  116    2    6  118  G1QD73     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  782 : G5E604_BOVIN        0.47  0.68  122  230    1  103  109    1    6  107  G5E604     Uncharacterized protein (Fragment) OS=Bos taurus PE=4 SV=1
  783 : H9KVQ0_CALJA        0.47  0.72    1  112    1  117  117    3    5  125  H9KVQ0     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  784 : HV01_CANFA          0.47  0.74    1  120    1  114  120    1    6  114  P01784     Ig heavy chain V region GOM OS=Canis familiaris PE=1 SV=1
  785 : HV209_HUMAN         0.47  0.69    1  120   21  146  127    5    8  146  P06331     Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1
  786 : HV320_HUMAN         0.47  0.71    1  120    1  116  121    3    6  116  P01781     Ig heavy chain V-III region GAL OS=Homo sapiens PE=1 SV=1
  787 : HV321_HUMAN         0.47  0.69    1  120    1  120  123    3    6  120  P01782     Ig heavy chain V-III region DOB OS=Homo sapiens PE=1 SV=1
  788 : HVM25_MOUSE         0.47  0.73    1  120    1  123  123    2    3  123  P01794     Ig heavy chain V region HPCG14 OS=Mus musculus PE=1 SV=1
  789 : I3ISY6_DANRE        0.47  0.72    4  120   21  132  117    3    5  570  I3ISY6     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  790 : I3IT31_DANRE        0.47  0.71    4  120   20  130  117    4    6  568  I3IT31     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  791 : K7T952_MOUSE        0.47  0.72    9  120    1  112  115    3    6  112  K7T952     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  792 : K7T9F1_MOUSE        0.47  0.71    9  120    1  112  115    3    6  112  K7T9F1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  793 : K7T9K7_MOUSE        0.47  0.71   10  120    1  110  113    2    5  110  K7T9K7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  794 : K7T9P9_MOUSE        0.47  0.71    9  120    1  111  115    3    7  111  K7T9P9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  795 : K7T9R4_MOUSE        0.47  0.69   19  120    1  104  108    2   10  104  K7T9R4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  796 : K7TD58_MOUSE        0.47  0.71    9  120    1  111  115    3    7  111  K7TD58     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  797 : K7TDL7_MOUSE        0.47  0.72    9  120    1  111  115    5    7  111  K7TDL7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  798 : K7THD1_MOUSE        0.47  0.74    9  120    1  111  114    3    5  111  K7THD1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  799 : K7THH7_MOUSE        0.47  0.74   18  120    1  103  107    4    8  103  K7THH7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  800 : K7TQX5_MOUSE        0.47  0.75    9  120    1  112  113    2    2  112  K7TQX5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  801 : K7TR54_MOUSE        0.47  0.72    9  120    1  112  114    2    4  112  K7TR54     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  802 : K9IV85_DESRO        0.47  0.68    1  120   20  139  123    6    6  149  K9IV85     Putative conserved secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  803 : LV603_HUMAN 1PEW    0.47  0.68  124  231    3  111  110    2    3  111  P06317     Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1
  804 : LV605_HUMAN         0.47  0.68  124  231   22  131  111    3    4  131  P06319     Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1
  805 : Q0ZCF9_HUMAN        0.47  0.72    2  120    1  118  122    3    7  118  Q0ZCF9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  806 : Q0ZCG0_HUMAN        0.47  0.72    2  120    1  118  122    3    7  118  Q0ZCG0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  807 : Q0ZCH6_HUMAN        0.47  0.66    2  120    2  131  130    4   11  131  Q0ZCH6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  808 : Q2VT26_MOUSE        0.47  0.70    1  120    1  123  126    4    9  123  Q2VT26     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  809 : Q566J7_MOUSE        0.47  0.69    1  120   20  138  123    3    7  483  Q566J7     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  810 : Q569B4_RAT  2J4W    0.47  0.73    1  120   20  142  123    2    3  468  Q569B4     Ighg protein OS=Rattus norvegicus GN=Ighg PE=1 SV=1
  811 : Q66K04_MOUSE        0.47  0.72    1  120   20  141  126    6   10  471  Q66K04     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  812 : Q683Y7_MOUSE        0.47  0.74    1  120    1  116  121    2    6  116  Q683Y7     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHV PE=2 SV=1
  813 : Q68CN4_HUMAN        0.47  0.70    1  120   20  144  128    4   11  470  Q68CN4     Putative uncharacterized protein DKFZp686E23209 OS=Homo sapiens GN=DKFZp686E23209 PE=1 SV=2
  814 : Q6DDQ7_XENLA        0.47  0.75    1  120   18  135  122    5    6  614  Q6DDQ7     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  815 : Q6INM5_XENLA        0.47  0.73    1  120   18  140  125    4    7  593  Q6INM5     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  816 : Q6MZV7_HUMAN        0.47  0.74    1  120   20  143  124    1    4  473  Q6MZV7     Putative uncharacterized protein DKFZp686C11235 OS=Homo sapiens GN=DKFZp686C11235 PE=1 SV=1
  817 : Q6MZX9_HUMAN        0.47  0.70    1  120   20  143  124    2    4  483  Q6MZX9     Putative uncharacterized protein DKFZp686M08189 OS=Homo sapiens GN=DKFZp686M08189 PE=2 SV=1
  818 : Q8IZD8_HUMAN        0.47  0.71  132  231    1  101  102    3    3  101  Q8IZD8     Anti-thyroglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  819 : Q96JD0_HUMAN        0.47  0.71  124  231    3  113  112    3    5  116  Q96JD0     Amyloid lambda 6 light chain variable region SAR (Fragment) OS=Homo sapiens PE=1 SV=1
  820 : Q96K68_HUMAN        0.47  0.72    1  120   20  141  124    4    6  494  Q96K68     cDNA FLJ14473 fis, clone MAMMA1001080, highly similar to Homo sapiens SNC73 protein (SNC73) mRNA OS=Homo sapiens PE=2 SV=1
  821 : Q9JL76_MOUSE        0.47  0.67  131  229    1   96  100    2    5   97  Q9JL76     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  822 : A0N577_9MURI        0.46  0.71    1  120    2  120  122    4    5  248  A0N577     Immunotoxin Mik-beta 1(Fv)-PE40 (Fragment) OS=Mus sp. PE=4 SV=1
  823 : A0N5G2_HUMAN        0.46  0.72    8  120    1  114  116    3    5  119  A0N5G2     Rheumatoid factor C6 heavy chain (Fragment) OS=Homo sapiens GN=VH3 PE=2 SV=1
  824 : A0N5G4_HUMAN        0.46  0.65    8  120    1  114  118    5    9  119  A0N5G4     Rheumatoid factor G9 heavy chain (Fragment) OS=Homo sapiens GN=VH4 PE=2 SV=1
  825 : A0N7D2_9MURI        0.46  0.66    1  120    1  120  123    3    6  123  A0N7D2     SD6 Fab heavy chain variable region (Fragment) OS=Mus sp. GN=Ig1 PE=4 SV=1
  826 : A2IPH7_HUMAN        0.46  0.74    4  120    1  121  121    2    4  121  A2IPH7     HRV Fab 025-VH (Fragment) OS=Homo sapiens PE=2 SV=1
  827 : A2JA18_HUMAN        0.46  0.70    1  120    1  117  121    3    5  117  A2JA18     Anti-mucin1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  828 : A2N2F5_HUMAN        0.46  0.72  127  226    2  100  102    2    5  100  A2N2F5     VL4 protein (Fragment) OS=Homo sapiens GN=VL4 PE=2 SV=1
  829 : A2NMA2_MOUSE        0.46  0.70    1  120    1  117  122    2    7  117  A2NMA2     Anti-carcinoma embryonic antigen heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  830 : A2NVF0_MOUSE        0.46  0.62  129  229    9  106  101    1    3  108  A2NVF0     Immnuoglobulin kappa light chain (Fragment) OS=Mus musculus PE=4 SV=1
  831 : A2NXP8_HUMAN        0.46  0.73    1  120    1  123  124    2    5  123  A2NXP8     Heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  832 : A2NYQ9_HUMAN        0.46  0.74    1  120    1  120  121    2    2  120  A2NYQ9     Anti-folate binding protein (Fragment) OS=Homo sapiens GN=HuVH8B VH PE=2 SV=1
  833 : A2NYU9_HUMAN        0.46  0.68    1  120    1  122  125    6    8  122  A2NYU9     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
  834 : A2P2G4_SHEEP        0.46  0.66    1  120   20  141  125    6    8  141  A2P2G4     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  835 : A2P2G8_SHEEP        0.46  0.67    1  120   20  139  123    4    6  139  A2P2G8     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  836 : F1M0H4_RAT          0.46  0.71    1  111    2  109  112    3    5  118  F1M0H4     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  837 : F7HL06_MACMU        0.46  0.72    1  120   20  143  125    4    6  476  F7HL06     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  838 : F7HQW4_MACMU        0.46  0.65    1  120   20  148  129    3    9  481  F7HQW4     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  839 : G1PYT3_MYOLU        0.46  0.72    1  110    1  108  111    2    4  118  G1PYT3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  840 : G1Q8U3_MYOLU        0.46  0.71    1  111   20  133  117    3    9  142  G1Q8U3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  841 : H2RWF3_TAKRU        0.46  0.68    4  120   22  138  119    4    4  279  H2RWF3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  842 : H9H6Z8_MONDO        0.46  0.67  122  225   16  120  107    3    5  126  H9H6Z8     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
  843 : H9KXH8_CALJA        0.46  0.73    1  120    1  112  120    1    8  113  H9KXH8     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  844 : H9KYK3_CALJA        0.46  0.71    1  111    1  109  114    3    8  123  H9KYK3     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  845 : HV106_HUMAN         0.46  0.66    1  120    1  122  125    4    8  124  P01761     Ig heavy chain V-I region SIE OS=Homo sapiens PE=1 SV=1
  846 : HVM19_MOUSE         0.46  0.72    1  120    1  123  123    2    3  123  P01788     Ig heavy chain V region H8 OS=Mus musculus PE=1 SV=1
  847 : HVM22_MOUSE         0.46  0.71    1  120    1  123  123    2    3  123  P01791     Ig heavy chain V region HPCM6 OS=Mus musculus PE=1 SV=1
  848 : HVM24_MOUSE         0.46  0.72    1  120    1  123  123    2    3  123  P01793     Ig heavy chain V region HPCG13 OS=Mus musculus PE=1 SV=1
  849 : HVM30_MOUSE         0.46  0.73    1  118    1  113  120    2    9  113  P01799     Ig heavy chain V-III region ABE-47N OS=Mus musculus PE=1 SV=1
  850 : HVM43_MOUSE         0.46  0.75    1  120   20  144  126    4    7  144  P01819     Ig heavy chain V region MOPC 141 OS=Mus musculus PE=4 SV=1
  851 : HVR01_RAT           0.46  0.71    1  120   20  142  126    3    9  142  P01805     Ig heavy chain V region IR2 OS=Rattus norvegicus PE=4 SV=1
  852 : I7G9T4_MACFA        0.46  0.71    1  120   20  141  123    4    4  474  I7G9T4     Macaca fascicularis brain cDNA clone: QtrA-18020, similar to human similar to FLJ27099 protein (LOC388078), mRNA, RefSeq: XM_370835.1 OS=Macaca fascicularis PE=2 SV=1
  853 : K7T926_MOUSE        0.46  0.73    9  120    1  111  114    4    5  111  K7T926     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  854 : K7T9I0_MOUSE        0.46  0.73    9  120    1  109  113    3    5  109  K7T9I0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  855 : K7T9V0_MOUSE        0.46  0.74   11  120    1  109  112    4    5  109  K7T9V0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  856 : K7TD91_MOUSE        0.46  0.76    9  120    1  115  116    4    5  115  K7TD91     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  857 : K7TDB7_MOUSE        0.46  0.70    9  120    1  110  114    5    6  110  K7TDB7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  858 : K7TDI6_MOUSE        0.46  0.74    9  120    1  111  114    4    5  111  K7TDI6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  859 : K7TDL3_MOUSE        0.46  0.71    9  120    1  115  119    5   11  115  K7TDL3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  860 : K7TGZ8_MOUSE        0.46  0.71    9  120    1  110  115    4    8  110  K7TGZ8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  861 : K7THI4_MOUSE        0.46  0.73   11  120    1  109  112    4    5  109  K7THI4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  862 : K7TRB5_MOUSE        0.46  0.73    9  120    1  111  114    4    5  111  K7TRB5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  863 : K7TRC9_MOUSE        0.46  0.72    9  120    1  109  114    4    7  109  K7TRC9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  864 : K7U643_MOUSE        0.46  0.69    9  120    1  109  114    3    7  109  K7U643     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  865 : K7U6G2_MOUSE        0.46  0.73    9  120    1  110  113    3    4  110  K7U6G2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  866 : KV5AB_MOUSE 2ZJS    0.46  0.63  129  229    9  106  102    3    5  108  P01644     Ig kappa chain V-V region HP R16.7 OS=Mus musculus PE=1 SV=1
  867 : KV5AD_MOUSE 1DVF    0.46  0.63  129  229    9  106  102    3    5  108  P01646     Ig kappa chain V-V region HP 123E6 OS=Mus musculus PE=1 SV=1
  868 : KV5AM_MOUSE         0.46  0.60  129  229    9  106  101    1    3  108  P04946     Ig kappa chain V-V region NQ5-89.4 OS=Mus musculus PE=4 SV=1
  869 : L5MLR7_MYODS        0.46  0.69  122  227   21  126  108    4    4  154  L5MLR7     Ig lambda chain V region 4A OS=Myotis davidii GN=MDA_GLEAN10000168 PE=4 SV=1
  870 : L8AXL3_PIG          0.46  0.75    1  120   20  138  123    5    7  466  L8AXL3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  871 : L8B180_PIG          0.46  0.69    1  120   20  140  123    4    5  464  L8B180     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  872 : L8HP27_BOSMU        0.46  0.67  122  230   20  122  109    1    6  132  L8HP27     Uncharacterized protein (Fragment) OS=Bos grunniens mutus GN=M91_14552 PE=4 SV=1
  873 : LV107_HUMAN         0.46  0.71  122  231   20  130  112    3    3  130  P06316     Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1
  874 : Q0ZCI1_HUMAN        0.46  0.74    2  120    2  118  121    2    6  118  Q0ZCI1     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  875 : Q0ZCI2_HUMAN        0.46  0.68    2  120    3  122  124    4    9  122  Q0ZCI2     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  876 : Q0ZCI5_HUMAN        0.46  0.70    2  120    3  121  123    3    8  121  Q0ZCI5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  877 : Q2VR03_MOUSE        0.46  0.71    1  120    1  123  126    4    9  123  Q2VR03     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  878 : Q2VT24_MOUSE        0.46  0.72    1  120    1  124  127    4   10  124  Q2VT24     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  879 : Q569B8_RAT          0.46  0.72    1  120   17  135  123    4    7  590  Q569B8     Igh-6 protein OS=Rattus norvegicus GN=Rwdd4 PE=2 SV=1
  880 : Q5EFE5_HUMAN        0.46  0.69    1  120   20  145  127    3    8  475  Q5EFE5     Anti-RhD monoclonal T125 gamma1 heavy chain (Precursor) OS=Homo sapiens PE=2 SV=1
  881 : Q5M842_RAT  1ZAN    0.46  0.73    1  120   20  136  120    2    3  458  Q5M842     IgG-2a protein OS=Rattus norvegicus GN=IgG-2a PE=1 SV=1
  882 : Q5M8X4_XENTR        0.46  0.73    1  120   20  137  123    6    8  367  Q5M8X4     Uncharacterized protein OS=Xenopus tropicalis GN=MGC108125 PE=2 SV=1
  883 : Q6INK3_XENLA        0.46  0.72    1  120   20  136  121    3    5  584  Q6INK3     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  884 : Q6MZQ6_HUMAN        0.46  0.71    1  120   20  145  128    3   10  475  Q6MZQ6     Putative uncharacterized protein DKFZp686G11190 OS=Homo sapiens GN=DKFZp686G11190 PE=1 SV=1
  885 : Q6PIP8_MOUSE4KVC    0.46  0.74    1  120   20  134  123    4   11  464  Q6PIP8     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
  886 : Q6ZVX0_HUMAN        0.46  0.73    1  120   20  147  128    2    8  487  Q6ZVX0     cDNA FLJ41981 fis, clone SMINT2011888, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=1 SV=1
  887 : Q6ZW64_HUMAN        0.46  0.70    1  120   20  141  125    4    8  494  Q6ZW64     cDNA FLJ41552 fis, clone COLON2004478, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=1 SV=1
  888 : Q80ZI7_MOUSE        0.46  0.74    1  120   20  142  125    3    7  487  Q80ZI7     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  889 : Q99NG4_MOUSE        0.46  0.71    1  120    1  120  122    4    4  121  Q99NG4     Single chain Fv (Fragment) OS=Mus musculus PE=2 SV=1
  890 : Q9N0W4_RABIT        0.46  0.71    1  120    1  124  124    2    4  124  Q9N0W4     Anti-human A33 heavy chain domain (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
  891 : Q9N0W6_RABIT        0.46  0.71    1  120    1  124  124    2    4  124  Q9N0W6     Anti-human A33 heavy chain domain (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
  892 : Q9UL82_HUMAN        0.46  0.64  126  230    5  107  106    2    4  107  Q9UL82     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  893 : Q9Y509_HUMAN        0.46  0.71    1  120    1  126  126    2    6  147  Q9Y509     VH3 protein (Fragment) OS=Homo sapiens GN=VH3 PE=1 SV=1
  894 : S6C4S4_HUMAN        0.46  0.70    1  120   20  146  128    5    9  239  S6C4S4     IgG H chain OS=Homo sapiens PE=2 SV=1
  895 : A0N3V1_MOUSE        0.45  0.68    1  120    1  117  123    4    9  117  A0N3V1     C72-3A1 protein (Fragment) OS=Mus musculus GN=Ighv3-5 PE=2 SV=1
  896 : A2JA17_HUMAN        0.45  0.68    1  120    1  117  121    3    5  117  A2JA17     Anti-mucin1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  897 : A2KD65_LAMGL        0.45  0.68    1  120    1  128  128    4    8  128  A2KD65     R8 protein (Fragment) OS=Lama glama GN=r8 PE=4 SV=1
  898 : A2NB82_RAT          0.45  0.64  122  227    6  111  108    3    4  111  A2NB82     Productively rearranged V-lambda-2 (Precursor) OS=Rattus norvegicus PE=2 SV=1
  899 : A2NKM7_HUMAN        0.45  0.66    5  120    1  131  131    4   15  133  A2NKM7     NANUC-2 heavy chain (Fragment) OS=Homo sapiens PE=2 SV=1
  900 : A2NV54_HUMAN        0.45  0.72  122  231   20  130  112    3    3  130  A2NV54     Precursor (AA -19 to 108) (Precursor) OS=Homo sapiens PE=2 SV=1
  901 : A2NYV2_HUMAN        0.45  0.70  124  231    1  109  110    2    3  111  A2NYV2     Light chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
  902 : A2NYV4_HUMAN        0.45  0.69  124  231    1  110  110    1    2  112  A2NYV4     Light chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
  903 : A2P2G0_SHEEP        0.45  0.72    1  120   20  132  121    4    9  132  A2P2G0     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  904 : D3ZE07_RAT          0.45  0.62  122  226   20  128  110    4    6  129  D3ZE07     Protein LOC682352 OS=Rattus norvegicus GN=LOC682352 PE=4 SV=2
  905 : E2R8C5_CANFA        0.45  0.73  122  225   20  122  104    1    1  124  E2R8C5     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
  906 : F7B7J7_ORNAN        0.45  0.74    1  119    1  121  124    3    8  122  F7B7J7     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  907 : F7EQ27_ORNAN        0.45  0.74    1  114    1  111  115    3    5  122  F7EQ27     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100681637 PE=4 SV=1
  908 : G1FM86_HUMAN        0.45  0.71    1  120    1  129  129    3    9  129  G1FM86     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  909 : G1FM91_HUMAN        0.45  0.69    1  120    1  129  129    2    9  129  G1FM91     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  910 : G1Q696_MYOLU        0.45  0.75    1  117    1  114  119    3    7  117  G1Q696     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  911 : G1Q6G1_MYOLU        0.45  0.71    1  119    1  117  121    3    6  118  G1Q6G1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  912 : G1Q9P5_MYOLU        0.45  0.72  122  228   21  123  107    2    4  129  G1Q9P5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  913 : G1QC73_MYOLU        0.45  0.68    1  111    1  117  119    4   10  127  G1QC73     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  914 : G1QCV9_MYOLU        0.45  0.71    1  116    1  114  119    4    8  119  G1QCV9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  915 : G3URI1_MELGA        0.45  0.70  124  231    1  105  110    3    7  120  G3URI1     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
  916 : G3VPR0_SARHA        0.45  0.66  123  228   22  125  108    4    6  128  G3VPR0     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  917 : G5E5V1_BOVIN        0.45  0.65  122  231   20  125  110    2    4  140  G5E5V1     Uncharacterized protein OS=Bos taurus PE=4 SV=1
  918 : G8F154_MACMU        0.45  0.66    1  114   20  138  121    5    9  139  G8F154     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21347 PE=4 SV=1
  919 : H2RWF5_TAKRU        0.45  0.67    4  120   24  146  123    3    6  363  H2RWF5     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  920 : H2ZTD8_LATCH        0.45  0.68    2  120   18  137  122    4    5  154  H2ZTD8     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  921 : H3AB65_LATCH        0.45  0.69    2  120   17  139  125    4    8  597  H3AB65     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  922 : H9G6Q7_ANOCA        0.45  0.72    2  120    2  116  119    2    4  261  H9G6Q7     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=2
  923 : H9KXI1_CALJA        0.45  0.69    1  113   20  136  121    5   12  136  H9KXI1     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  924 : H9KXR6_CALJA        0.45  0.71  122  228    1  110  110    2    3  116  H9KXR6     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  925 : HV02_CANFA          0.45  0.68    1  120    1  117  124    6   11  117  P01785     Ig heavy chain V region MOO OS=Canis familiaris PE=1 SV=1
  926 : HV02_XENLA          0.45  0.68    4  120   21  135  120    5    8  135  P20957     Ig heavy chain V region XIG14 (Fragment) OS=Xenopus laevis PE=2 SV=1
  927 : HV305_HUMAN         0.45  0.69    1  115    1  120  121    4    7  120  P01766     Ig heavy chain V-III region BRO OS=Homo sapiens PE=1 SV=1
  928 : HV309_HUMAN         0.45  0.75    1  120    1  119  122    2    5  119  P01770     Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1
  929 : HVM17_MOUSE         0.45  0.69    1  120    1  117  122    3    7  117  P01786     Ig heavy chain V region MOPC 47A OS=Mus musculus PE=1 SV=1
  930 : HVM20_MOUSE 1MCP    0.45  0.69    1  120    1  122  124    3    6  122  P01789     Ig heavy chain V region M603 OS=Mus musculus PE=1 SV=1
  931 : HVM21_MOUSE         0.45  0.71    1  120    1  122  122    1    2  122  P01790     Ig heavy chain V region M511 OS=Mus musculus PE=1 SV=1
  932 : HVM27_MOUSE         0.45  0.73    1  118    1  113  120    2    9  113  P01796     Ig heavy chain V-III region A4 OS=Mus musculus PE=1 SV=1
  933 : HVM31_MOUSE         0.45  0.72    1  118    1  113  120    2    9  113  P01800     Ig heavy chain V-III region T957 OS=Mus musculus PE=1 SV=2
  934 : HVM32_MOUSE 1PZ5    0.45  0.74    1  120    1  115  122    2    9  115  P01801     Ig heavy chain V-III region J606 OS=Mus musculus PE=1 SV=1
  935 : HVM47_MOUSE 1J1O    0.45  0.70    1  120    1  113  121    4    9  113  P01823     Ig heavy chain V region 36-60 OS=Mus musculus PE=1 SV=1
  936 : I3IT76_DANRE        0.45  0.69    4  120   20  130  117    4    6  568  I3IT76     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  937 : I6U3W1_STRCA        0.45  0.72    2  120    2  122  121    1    2  122  I6U3W1     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  938 : K7FAV4_PELSI        0.45  0.64    1  111   20  138  121    6   12  142  K7FAV4     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  939 : K7TD32_MOUSE        0.45  0.74    9  120    1  109  112    2    3  120  K7TD32     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  940 : K7TDR2_MOUSE        0.45  0.70    8  120    1  111  116    4    8  111  K7TDR2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  941 : K7TGT1_MOUSE        0.45  0.73    9  120    1  114  115    3    4  114  K7TGT1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  942 : K7TH59_MOUSE        0.45  0.72    1  120    2  122  125    4    9  122  K7TH59     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  943 : K7TR13_MOUSE        0.45  0.73    9  120    1  114  115    3    4  114  K7TR13     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  944 : K7TR64_MOUSE        0.45  0.74    9  120    1  112  114    3    4  112  K7TR64     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  945 : K7U5M3_MOUSE        0.45  0.71    9  120    1  112  115    4    6  112  K7U5M3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  946 : K7U5N1_MOUSE        0.45  0.74    9  120    1  109  112    2    3  109  K7U5N1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  947 : K7U5T0_MOUSE        0.45  0.74    9  120    1  113  114    3    3  113  K7U5T0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  948 : K7U6F1_MOUSE        0.45  0.74   14  120    2  108  110    4    6  108  K7U6F1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  949 : K9IV88_DESRO        0.45  0.71  122  230   20  129  112    3    5  155  K9IV88     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  950 : K9J492_DESRO        0.45  0.70    1  120   14  134  124    3    7  148  K9J492     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  951 : KV5AC_MOUSE 1A14    0.45  0.62  129  229    9  106  102    3    5  108  P01645     Ig kappa chain V-V region HP 93G7 OS=Mus musculus PE=1 SV=1
  952 : L5KCQ8_PTEAL        0.45  0.67    1  119   20  135  121    3    7  160  L5KCQ8     Ig heavy chain V-I region V35 OS=Pteropus alecto GN=PAL_GLEAN10000107 PE=4 SV=1
  953 : L8AXL9_PIG          0.45  0.66    1  120   20  144  127    5    9  472  L8AXL9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  954 : L8B0U1_PIG          0.45  0.70    1  120   20  139  122    4    4  467  L8B0U1     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  955 : LV101_HUMAN         0.45  0.68  122  231    1  111  112    3    3  111  P01699     Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1
  956 : LV109_HUMAN         0.45  0.72  122  231    1  109  110    1    1  109  P06888     Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1
  957 : LV203_HUMAN         0.45  0.71  122  231    1  111  111    1    1  111  P01706     Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1
  958 : LV212_HUMAN         0.45  0.67  123  231    2  111  110    1    1  111  P80422     Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1
  959 : LV302_HUMAN         0.45  0.69  124  231    2  108  110    2    5  111  P80748     Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1
  960 : LV602_HUMAN         0.45  0.69  124  231    3  112  111    3    4  112  P01722     Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1
  961 : LV604_HUMAN         0.45  0.68  124  231    3  111  110    2    3  111  P06318     Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1
  962 : M0R709_RAT          0.45  0.73    1  118    1  111  118    2    7  118  M0R709     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  963 : Q0ZCF6_HUMAN        0.45  0.67    2  120    3  129  128    3   10  129  Q0ZCF6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  964 : Q2VR04_MOUSE        0.45  0.66  122  229    1  105  109    2    5  106  Q2VR04     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  965 : Q2VT25_MOUSE        0.45  0.67  122  229    1  105  109    2    5  106  Q2VT25     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  966 : Q2VT27_MOUSE        0.45  0.67  122  229    1  105  109    2    5  106  Q2VT27     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  967 : Q2VT29_MOUSE        0.45  0.67  122  229    1  105  109    2    5  106  Q2VT29     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  968 : Q5NV73_HUMAN        0.45  0.68  125  227    4   97  103    2    9   97  Q5NV73     V2-13 protein (Fragment) OS=Homo sapiens GN=V2-13 PE=4 SV=1
  969 : Q65ZL8_MOUSE1H3P    0.45  0.68    1  111   20  132  117    4   10  196  Q65ZL8     VH7183-DSP2-JH3-CH1 protein (Fragment) OS=Mus musculus GN=VH7183-DSP2-JH3-CH1 PE=1 SV=1
  970 : Q683Y8_MOUSE        0.45  0.71    1  120    1  116  121    3    6  116  Q683Y8     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHV PE=2 SV=1
  971 : Q6N094_HUMAN        0.45  0.67    1  120   20  150  131    3   11  480  Q6N094     Putative uncharacterized protein DKFZp686O01196 OS=Homo sapiens GN=DKFZp686O01196 PE=1 SV=1
  972 : Q811C3_MOUSE        0.45  0.68  122  229   23  130  110    4    4  131  Q811C3     Imunoglobulin gamma-3 kappa chain (Precursor) OS=Mus musculus PE=2 SV=1
  973 : Q9UL75_HUMAN        0.45  0.64    1  120    1  122  125    4    8  122  Q9UL75     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  974 : R9W154_LAMGL        0.45  0.67    1  120    1  121  125    4    9  121  R9W154     Anti-F4+ETEC bacteria VHH variable region (Fragment) OS=Lama glama PE=2 SV=1
  975 : R9W3F6_LAMGL        0.45  0.66    1  120    1  121  125    4    9  121  R9W3F6     Anti-F4+ETEC bacteria VHH variable region (Fragment) OS=Lama glama PE=2 SV=1
  976 : S6B2B6_HUMAN        0.45  0.66    1  120   20  145  128    5   10  275  S6B2B6     IgG H chain OS=Homo sapiens PE=2 SV=1
  977 : S7N9M0_MYOBR        0.45  0.67  122  230   20  122  110    2    8  125  S7N9M0     Ig lambda chain V-I region BL2 OS=Myotis brandtii GN=D623_10001168 PE=4 SV=1
  978 : S9XLM0_9CETA        0.45  0.70    1  120   46  157  120    1    8  483  S9XLM0     Ig heavy chain V-III region VH26-like protein (Fragment) OS=Camelus ferus GN=CB1_001527001 PE=4 SV=1
  979 : A0N6Y4_9MURI        0.44  0.74    1  120    1  116  121    4    6  116  A0N6Y4     F30C7 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  980 : A2IPH2_HUMAN        0.44  0.66    4  120    1  123  124    4    8  123  A2IPH2     HRV Fab N6-VH (Fragment) OS=Homo sapiens PE=2 SV=1
  981 : A2IPH3_HUMAN        0.44  0.65    4  120    1  123  124    4    8  123  A2IPH3     HRV Fab N27-VH (Fragment) OS=Homo sapiens PE=2 SV=1
  982 : A2IPH5_HUMAN        0.44  0.65    4  120    1  123  124    4    8  123  A2IPH5     HRV Fab N28-VH (Fragment) OS=Homo sapiens PE=2 SV=1
  983 : A2N2G5_HUMAN        0.44  0.64    1  120    1  135  135    5   15  135  A2N2G5     VH87-2 protein (Fragment) OS=Homo sapiens GN=VH87-2 PE=2 SV=1
  984 : A2NB44_HUMAN        0.44  0.68    1  115    1  114  118    3    7  114  A2NB44     Cold agglutinin FS-2 H-chain (Fragment) OS=Homo sapiens GN=IGH@ PE=2 SV=1
  985 : A2NV55_HUMAN        0.44  0.64    1  120   20  146  131    7   15  146  A2NV55     Precursor (AA -19 to 113) (Precursor) OS=Homo sapiens PE=2 SV=1
  986 : A2P2G9_SHEEP        0.44  0.70    1  120   20  137  121    3    4  137  A2P2G9     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  987 : A2P2H9_SHEEP        0.44  0.69    1  120   20  140  125    6    9  140  A2P2H9     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  988 : A2P2I1_SHEEP        0.44  0.63    1  120   20  145  128    6   10  145  A2P2I1     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  989 : A5D7Q2_BOVIN        0.44  0.68    1  120   20  144  126    3    7  487  A5D7Q2     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  990 : B1N7B9_HUMAN        0.44  0.68  122  230    1  110  111    2    3  110  B1N7B9     Cryocrystalglobulin CC2 lambda light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  991 : B5UB68_MOUSE        0.44  0.69    1  120    1  117  122    4    7  117  B5UB68     EP3-6 heavy chain variable region (Fragment) OS=Mus musculus GN=EP3-6VH PE=2 SV=1
  992 : F1D885_MACMU        0.44  0.66    1  120   12  143  133    6   14  162  F1D885     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
  993 : F1D891_MACMU        0.44  0.71  122  231    7  117  112    2    3  141  F1D891     Anti-quaternary epitope monoclonal antibody light chain (Fragment) OS=Macaca mulatta PE=2 SV=1
  994 : F6QBE4_HORSE        0.44  0.68  125  218    3   99   97    2    3  100  F6QBE4     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  995 : F6QU61_ORNAN        0.44  0.71    1  120    1  124  124    2    4  124  F6QU61     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  996 : F6UM84_ORNAN        0.44  0.74    1  118    1  120  121    2    4  257  F6UM84     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  997 : G1FM94_HUMAN        0.44  0.71    1  120    1  129  129    2    9  129  G1FM94     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  998 : G1PPD7_MYOLU        0.44  0.71    1  118    1  115  118    2    3  217  G1PPD7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  999 : G1Q286_MYOLU        0.44  0.69    1  120    1  117  121    2    5  245  G1Q286     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1000 : G1Q2K8_MYOLU        0.44  0.69    1  112    1  109  115    4    9  249  G1Q2K8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1001 : G1Q3T5_MYOLU        0.44  0.72    1  119    1  117  125    5   14  118  G1Q3T5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1002 : G1Q4P7_MYOLU        0.44  0.68    4  114    1  116  117    3    7  121  G1Q4P7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1003 : G1Q676_MYOLU        0.44  0.69    4  120    4  122  122    4    8  122  G1Q676     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1004 : G1Q768_MYOLU        0.44  0.65  122  227    1  102  106    2    4  105  G1Q768     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1005 : G1Q7D0_MYOLU        0.44  0.67  124  227    1  101  104    1    3  107  G1Q7D0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1006 : G1Q914_MYOLU        0.44  0.67    1  110   20  130  116    4   11  139  G1Q914     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1007 : G1QE02_MYOLU        0.44  0.67    1  110   20  130  114    3    7  139  G1QE02     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1008 : G3UDL9_LOXAF        0.44  0.70    1  113   20  128  113    2    4  137  G3UDL9     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1009 : G3UES9_LOXAF        0.44  0.64    1  110    3  102  110    2   10  115  G3UES9     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1010 : G3UJP8_LOXAF        0.44  0.68    1  112    3  113  116    4    9  113  G3UJP8     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1011 : G3V8Z5_RAT          0.44  0.62  122  226   20  128  110    4    6  129  G3V8Z5     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=2
 1012 : G5E7M9_MELGA        0.44  0.70  124  231    1  104  110    4    8  119  G5E7M9     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
 1013 : G7P8Z5_MACFA        0.44  0.67    1  116   20  140  123    5    9  144  G7P8Z5     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_17028 PE=4 SV=1
 1014 : G8F425_MACFA        0.44  0.69  122  212    1   92   93    2    3  108  G8F425     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_20220 PE=4 SV=1
 1015 : H2M8T0_ORYLA        0.44  0.70    1  120   29  153  126    4    7  617  H2M8T0     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1016 : HV207_HUMAN 7FAB    0.44  0.67    1  120    1  117  123    6    9  117  P01825     Ig heavy chain V-II region NEWM OS=Homo sapiens PE=1 SV=1
 1017 : HV306_HUMAN         0.44  0.68    1  120    1  115  121    4    7  115  P01767     Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1
 1018 : HV311_HUMAN 2RCJ    0.44  0.71    1  120    1  126  126    3    6  126  P01772     Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1
 1019 : HVM18_MOUSE         0.44  0.69    1  120    1  123  125    3    7  123  P01787     Ig heavy chain V regions TEPC 15/S107/HPCM1/HPCM2/HPCM3 OS=Mus musculus PE=1 SV=1
 1020 : HVM23_MOUSE         0.44  0.69    1  120    1  123  125    3    7  123  P01792     Ig heavy chain V region HPCG8 OS=Mus musculus PE=1 SV=1
 1021 : HVM28_MOUSE         0.44  0.73    1  118    1  113  120    3    9  113  P01797     Ig heavy chain V-III region U61 OS=Mus musculus PE=1 SV=1
 1022 : HVM29_MOUSE         0.44  0.73    1  118    1  113  120    3    9  113  P01798     Ig heavy chain V-III region E109 OS=Mus musculus PE=1 SV=1
 1023 : HVM33_MOUSE         0.44  0.74    1  120    1  115  122    2    9  115  P01802     Ig heavy chain V-III region W3082 OS=Mus musculus PE=1 SV=1
 1024 : K7GG21_PELSI        0.44  0.70    4  120    4  114  117    4    6  230  K7GG21     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
 1025 : K7T921_MOUSE        0.44  0.73    9  120    1  112  114    3    4  112  K7T921     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1026 : K7T9F6_MOUSE        0.44  0.65    9  120    1  116  118    3    8  116  K7T9F6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1027 : K7T9I8_MOUSE        0.44  0.70    9  120    1  112  115    4    6  112  K7T9I8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1028 : K7T9J0_MOUSE        0.44  0.72    9  120    1  112  116    4    8  112  K7T9J0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1029 : K7T9K2_MOUSE        0.44  0.73    9  120    1  105  112    3    7  105  K7T9K2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1030 : K7TDA8_MOUSE        0.44  0.69    9  120    1  110  115    6    8  110  K7TDA8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1031 : K7TDP3_MOUSE        0.44  0.68    9  120    1  111  116    4    9  111  K7TDP3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1032 : K7TDT3_MOUSE        0.44  0.66   10  120    1  109  112    2    4  109  K7TDT3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1033 : K7TH54_MOUSE        0.44  0.73    9  120    1  112  114    4    4  112  K7TH54     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1034 : K7TH64_MOUSE        0.44  0.71   10  120    1  114  115    4    5  114  K7TH64     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1035 : K7TR97_MOUSE        0.44  0.72    9  120    1  113  116    4    7  113  K7TR97     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1036 : K7TRE2_MOUSE        0.44  0.67    9  120    1  113  117    4    9  113  K7TRE2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1037 : K7U690_MOUSE        0.44  0.72    9  120    1  113  116    4    7  113  K7U690     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1038 : K7U6C3_MOUSE        0.44  0.70    9  120    1  114  115    3    4  114  K7U6C3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1039 : K7U6K6_MOUSE        0.44  0.74    9  120    1  108  113    4    6  108  K7U6K6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1040 : K9IV76_DESRO        0.44  0.67  125  231   23  128  110    4    7  138  K9IV76     Uncharacterized protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1041 : K9IW37_DESRO        0.44  0.67  122  231   20  130  113    4    5  145  K9IW37     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1042 : K9J4H2_DESRO        0.44  0.71  122  231   24  135  112    2    2  147  K9J4H2     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1043 : KV6A6_MOUSE         0.44  0.68  122  229    1  105  109    2    5  107  P04940     Ig kappa chain V-VI region NQ2-17.4.1 OS=Mus musculus PE=4 SV=1
 1044 : L8B0R9_PIG          0.44  0.71    1  120   20  131  120    2    8  455  L8B0R9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1045 : L8B0V2_PIG          0.44  0.70    1  120   20  145  128    6   10  478  L8B0V2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1046 : L8B0V9_PIG          0.44  0.70    1  120   20  145  126    3    6  478  L8B0V9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1047 : L8B130_PIG          0.44  0.70    1  120   20  145  126    3    6  478  L8B130     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1048 : LV102_HUMAN         0.44  0.69  122  230    1  111  111    2    2  112  P01700     Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1
 1049 : LV103_HUMAN         0.44  0.71  122  231    1  111  112    3    3  111  P01701     Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1
 1050 : LV104_HUMAN         0.44  0.71  122  231    1  111  112    3    3  111  P01702     Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1
 1051 : LV106_HUMAN 1ZVO    0.44  0.67  122  231    1  109  111    3    3  109  P04208     Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1
 1052 : LV108_HUMAN         0.44  0.69  122  230    1  111  111    2    2  112  P06887     Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1
 1053 : LV209_HUMAN         0.44  0.72  122  231    1  111  111    1    1  111  P01712     Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1
 1054 : LV401_HUMAN         0.44  0.68  125  231    3  106  108    3    5  106  P01715     Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1
 1055 : M7BXY4_CHEMY        0.44  0.70  123  224   25  112  102    2   14  112  M7BXY4     Ig lambda chain V region 4A (Fragment) OS=Chelonia mydas GN=UY3_00009 PE=4 SV=1
 1056 : O95973_HUMAN        0.44  0.70    1  120   20  137  124    6   10  150  O95973     VH4 heavy chain variable region (Precursor) OS=Homo sapiens GN=IGM PE=1 SV=1
 1057 : Q53VQ5_MOUSE        0.44  0.68    1  114    1  119  121    6    9  119  Q53VQ5     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1058 : Q65ZI1_MOUSE2DQC    0.44  0.70    1  120  148  262  122    6    9  262  Q65ZI1     Anti-HIV-1 reverse transcriptase single-chain variable OS=Mus musculus GN=Igkv5-39 PE=1 SV=1
 1059 : Q6MZV6_HUMAN        0.44  0.68    1  120   20  139  123    3    6  479  Q6MZV6     Putative uncharacterized protein DKFZp686L19235 OS=Homo sapiens GN=DKFZp686L19235 PE=2 SV=1
 1060 : Q7Z374_HUMAN        0.44  0.66    1  120   32  152  123    4    5  492  Q7Z374     Putative uncharacterized protein DKFZp686C02218 (Fragment) OS=Homo sapiens GN=DKFZp686C02218 PE=1 SV=1
 1061 : Q7Z379_HUMAN        0.44  0.68    1  120   19  138  124    4    8  478  Q7Z379     Putative uncharacterized protein DKFZp686K04218 (Fragment) OS=Homo sapiens GN=DKFZp686K04218 PE=1 SV=1
 1062 : Q7Z3Y6_HUMAN        0.44  0.68    1  110    1  116  117    4    8  116  Q7Z3Y6     Rearranged VH4-34 V gene segment (Fragment) OS=Homo sapiens GN=VH4-34 PE=4 SV=1
 1063 : Q8K1F0_MOUSE        0.44  0.68  122  229    1  105  109    2    5  112  Q8K1F0     Anti-VIPase light chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
 1064 : Q8K1F1_MOUSE        0.44  0.68  122  229    1  107  110    4    5  114  Q8K1F1     Anti-VIPase light chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
 1065 : Q8TE63_HUMAN        0.44  0.69  122  230    1  110  111    2    3  110  Q8TE63     Immunglobulin light chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
 1066 : Q91X92_MOUSE        0.44  0.72    1  120   20  137  122    5    6  482  Q91X92     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
 1067 : Q9JL74_MOUSE        0.44  0.64  131  229    3   98  100    3    5   99  Q9JL74     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1068 : Q9JL78_MOUSE        0.44  0.67  129  229    1  100  102    2    3  101  Q9JL78     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-91 PE=2 SV=1
 1069 : Q9UL85_HUMAN        0.44  0.63  122  229    1  107  110    3    5  109  Q9UL85     Myosin-reactive immunoglobulin kappa chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
 1070 : S6BGD4_HUMAN        0.44  0.69    1  120   20  141  123    3    4  234  S6BGD4     IgG H chain OS=Homo sapiens PE=2 SV=1
 1071 : S9YAP8_9CETA        0.44  0.65  123  230   83  185  113    5   15  185  S9YAP8     Ig lambda chain V region 4A-like protein OS=Camelus ferus GN=CB1_000760042 PE=4 SV=1
 1072 : A0N275_MOUSE        0.43  0.65  122  229   20  124  110    5    7  127  A0N275     Antigen, B-cell receptor (Precursor) OS=Mus musculus PE=4 SV=1
 1073 : A2KD54_LAMGL        0.43  0.66    1  120    1  120  124    6    8  120  A2KD54     Hi6 protein (Fragment) OS=Lama glama GN=hi6 PE=4 SV=1
 1074 : A2KD66_LAMGL        0.43  0.69    1  120    1  114  122    6   10  114  A2KD66     R9 protein (Fragment) OS=Lama glama GN=r9 PE=4 SV=1
 1075 : A2KD67_LAMGL        0.43  0.65    1  120    1  128  131    5   14  128  A2KD67     R10 protein (Fragment) OS=Lama glama GN=r10 PE=4 SV=1
 1076 : A2NYQ7_HUMAN        0.43  0.71  122  230    1  110  111    2    3  110  A2NYQ7     Anti-folate binding protein (Fragment) OS=Homo sapiens GN=HuC4lambda Vlambda PE=2 SV=1
 1077 : A2NYV0_HUMAN        0.43  0.67    1  120    1  122  123    3    4  122  A2NYV0     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1078 : A2P2G1_SHEEP        0.43  0.67    1  120   20  141  126    7   10  141  A2P2G1     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1079 : A2P2G6_SHEEP        0.43  0.67    1  120   20  139  122    4    4  139  A2P2G6     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1080 : A2P2H0_SHEEP        0.43  0.69    1  120   20  139  125    7   10  139  A2P2H0     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1081 : A2P2H1_SHEEP        0.43  0.67    1  120   20  138  124    6    9  138  A2P2H1     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1082 : A2P2H2_SHEEP        0.43  0.67    1  120   20  144  126    4    7  144  A2P2H2     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1083 : A2P2H4_SHEEP        0.43  0.69    1  120   20  138  123    4    7  138  A2P2H4     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1084 : A2P2I0_SHEEP        0.43  0.67    1  120   20  142  125    5    7  142  A2P2I0     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1085 : B5UB60_MOUSE        0.43  0.70    1  120    1  119  122    3    5  119  B5UB60     CP1-5 heavy chain variable region (Fragment) OS=Mus musculus GN=CP1-5VH PE=2 SV=1
 1086 : B5UB62_MOUSE        0.43  0.70    1  120    1  119  122    3    5  119  B5UB62     CP1-10 heavy chain variable region (Fragment) OS=Mus musculus GN=CP1-10VH PE=2 SV=1
 1087 : F1D888_MACMU        0.43  0.66  125  231   10  115  110    3    7  139  F1D888     Anti-quaternary epitope monoclonal antibody light chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1088 : F1D889_MACMU        0.43  0.65  125  231   10  115  110    3    7  139  F1D889     Anti-quaternary epitope monoclonal antibody light chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1089 : F1D892_MACMU        0.43  0.68  122  231    7  117  112    3    3  141  F1D892     Anti-quaternary epitope monoclonal antibody light chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1090 : F6QNX1_ORNAN        0.43  0.70    3  111   21  126  111    3    7  139  F6QNX1     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=2
 1091 : F7EPX5_ORNAN        0.43  0.71    1  113   20  139  120    2    7  153  F7EPX5     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100681918 PE=4 SV=1
 1092 : F7IMW5_CALJA        0.43  0.67    1  120   20  140  126    5   11  487  F7IMW5     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
 1093 : G1PYP0_MYOLU        0.43  0.67    1  111   20  129  116    7   11  142  G1PYP0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1094 : G1Q071_MYOLU        0.43  0.69    1  111   20  127  114    5    9  140  G1Q071     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1095 : G1Q136_MYOLU        0.43  0.68    1  112    3  114  118    5   12  114  G1Q136     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1096 : G1Q274_MYOLU        0.43  0.66    1  113    1  113  119    5   12  120  G1Q274     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1097 : G1Q2Y4_MYOLU        0.43  0.66    1  110   20  134  120    6   15  144  G1Q2Y4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1098 : G1Q5X1_MYOLU        0.43  0.68    1  116    1  114  120    2   10  118  G1Q5X1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1099 : G1Q803_MYOLU        0.43  0.70    1  120    1  117  122    4    7  117  G1Q803     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1100 : G1Q853_MYOLU        0.43  0.69    1  110   15  128  116    5    8  139  G1Q853     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1101 : G1QAT1_MYOLU        0.43  0.67  122  228   20  123  107    1    3  136  G1QAT1     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1102 : G1QC76_MYOLU        0.43  0.66    1  112    1  125  125    4   13  136  G1QC76     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1103 : G1QCW0_MYOLU        0.43  0.67    1  120   23  147  129    5   13  157  G1QCW0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1104 : G1QDI2_MYOLU        0.43  0.66    1  120    1  121  125    4    9  121  G1QDI2     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1105 : G1QEQ7_MYOLU        0.43  0.67    1  110   20  133  116    6    8  141  G1QEQ7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1106 : G1QET4_MYOLU        0.43  0.69  122  228   20  122  107    2    4  125  G1QET4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1107 : G3MWT1_BOVIN        0.43  0.69    1  113   20  127  115    4    9  137  G3MWT1     Uncharacterized protein OS=Bos taurus GN=LOC100300028 PE=4 SV=1
 1108 : G3S323_GORGO        0.43  0.73    1  119    1  116  120    3    5  226  G3S323     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1109 : H2RJA2_TAKRU        0.43  0.66    4  111    4  112  113    4    9  254  H2RJA2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=IGHV3-15 PE=4 SV=1
 1110 : H9H2S9_MACMU        0.43  0.67    1  116   20  140  123    5    9  144  H9H2S9     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
 1111 : H9H302_MACMU        0.43  0.66  125  226    4   96  103    3   11   97  H9H302     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1112 : H9KW43_CALJA        0.43  0.69    1  119   20  144  128    4   12  165  H9KW43     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
 1113 : H9KWV4_CALJA        0.43  0.71    1  113    1  116  120    4   11  123  H9KWV4     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
 1114 : HVM26_MOUSE         0.43  0.69    1  120   20  144  126    3    7  144  P01795     Ig heavy chain V region M167 OS=Mus musculus PE=1 SV=1
 1115 : HVM34_MOUSE         0.43  0.70    1  118    1  113  120    3    9  113  P01803     Ig heavy chain V region AMPC1 OS=Mus musculus PE=1 SV=1
 1116 : I3NCK3_SPETR        0.43  0.65  122  214    1   91   94    2    4  108  I3NCK3     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1117 : I6TTA4_STRCA        0.43  0.68    2  120    2  121  124    5    9  121  I6TTA4     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1118 : I6U3W4_STRCA        0.43  0.69    2  120    2  122  124    3    8  122  I6U3W4     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1119 : I6UXR3_STRCA        0.43  0.69    2  120    2  120  122    5    6  120  I6UXR3     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1120 : I6UXR8_STRCA        0.43  0.70    2  120    2  123  125    4    9  123  I6UXR8     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1121 : K7DYQ1_MONDO        0.43  0.69    1  110   20  137  119    4   10  141  K7DYQ1     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=1
 1122 : K7EEU0_ORNAN        0.43  0.70    1  111   20  127  113    3    7  155  K7EEU0     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=1
 1123 : K7ETY0_PONAB        0.43  0.66    1  112   27  134  115    5   10  139  K7ETY0     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1124 : K7T9D7_MOUSE        0.43  0.73    9  120    1  106  112    3    6  106  K7T9D7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1125 : K7T9E3_MOUSE        0.43  0.73    9  120    1  110  113    3    4  110  K7T9E3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1126 : K7T9M3_MOUSE        0.43  0.72    9  120    1  108  113    4    6  108  K7T9M3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1127 : K7TD27_MOUSE        0.43  0.73    9  120    1  109  114    4    7  109  K7TD27     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1128 : K7TDF6_MOUSE        0.43  0.72    9  120    1  111  115    4    7  111  K7TDF6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1129 : K7TGP2_MOUSE        0.43  0.69    9  120    1  117  119    5    9  117  K7TGP2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1130 : K7TGP7_MOUSE        0.43  0.71   11  120    1  109  112    4    5  109  K7TGP7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1131 : K7TGR5_MOUSE        0.43  0.66    9  120    1  112  117    4   10  112  K7TGR5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1132 : K7TGT6_MOUSE        0.43  0.71    9  120    1  109  113    3    5  109  K7TGT6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1133 : K7TGU3_MOUSE        0.43  0.73    9  120    1  109  113    3    5  109  K7TGU3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1134 : K7TGY2_MOUSE        0.43  0.71    9  120    1  105  112    2    7  105  K7TGY2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1135 : K7TH68_MOUSE        0.43  0.72   14  120    1  110  111    4    5  110  K7TH68     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1136 : K7TR19_MOUSE        0.43  0.71    9  120    1  110  112    2    2  110  K7TR19     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1137 : K7TRD7_MOUSE        0.43  0.72    9  120    1  109  114    5    7  109  K7TRD7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1138 : K7U669_MOUSE        0.43  0.68    9  120    1  114  117    4    8  114  K7U669     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1139 : K7U6K0_MOUSE        0.43  0.65    9  120    1  110  113    2    4  110  K7U6K0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1140 : K9IR26_DESRO        0.43  0.62  122  231   22  139  122    9   16  244  K9IR26     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1141 : K9J517_DESRO        0.43  0.60  122  231   22  139  122   10   16  244  K9J517     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1142 : KV5AK_MOUSE         0.43  0.61  124  229    4  106  106    1    3  108  P01652     Ig kappa chain V-V region J606 OS=Mus musculus PE=1 SV=1
 1143 : KV6A7_MOUSE         0.43  0.68  122  229    1  105  109    2    5  107  P04941     Ig kappa chain V-VI region NQ2-48.2.2 OS=Mus musculus PE=4 SV=1
 1144 : KV6A8_MOUSE         0.43  0.67  122  229    1  105  109    2    5  107  P04942     Ig kappa chain V-VI region NQ5-61.1.2 OS=Mus musculus PE=4 SV=1
 1145 : KV6A9_MOUSE         0.43  0.67  122  229    1  105  109    2    5  107  P04943     Ig kappa chain V-VI region NQ6-8.3.1 OS=Mus musculus PE=4 SV=1
 1146 : KV6AA_MOUSE         0.43  0.67  122  228    1  104  108    2    5  107  P04944     Ig kappa chain V-VI region NQ5-78.2.6 OS=Mus musculus PE=4 SV=1
 1147 : KV6AB_MOUSE         0.43  0.64  122  229    1  107  111    4    7  108  P04945     Ig kappa chain V-VI region NQ2-6.1 OS=Mus musculus PE=2 SV=1
 1148 : L7N0L4_CANFA        0.43  0.69    1  119    1  133  133    3   14  134  L7N0L4     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=1
 1149 : L7N2R7_XENTR        0.43  0.71    1  117    1  117  120    2    6  120  L7N2R7     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1150 : L8AXK8_PIG          0.43  0.69    1  120   20  140  122    3    3  473  L8AXK8     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1151 : L8B0T2_PIG          0.43  0.69    1  120   20  143  124    2    4  471  L8B0T2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1152 : L8B0U3_PIG          0.43  0.70    1  120   20  141  125    3    8  469  L8B0U3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1153 : L8B0W0_PIG          0.43  0.71    1  120   20  132  121    3    9  460  L8B0W0     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1154 : L8B0W5_PIG          0.43  0.69    1  120   20  142  127    4   11  470  L8B0W5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1155 : L8B149_PIG          0.43  0.68    1  120   20  146  127    4    7  474  L8B149     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1156 : L8HRP6_BOSMU        0.43  0.67  122  231   20  125  110    2    4  134  L8HRP6     Uncharacterized protein (Fragment) OS=Bos grunniens mutus GN=M91_02607 PE=4 SV=1
 1157 : L9JMC3_TUPCH        0.43  0.59  122  230   21  119  111    5   14  141  L9JMC3     Ig kappa chain V-III region HIC OS=Tupaia chinensis GN=TREES_T100021708 PE=4 SV=1
 1158 : L9KLT7_TUPCH        0.43  0.62  124  230   22  122  111    5   14  141  L9KLT7     Ig lambda chain V-VI region SUT OS=Tupaia chinensis GN=TREES_T100009970 PE=4 SV=1
 1159 : L9L1F2_TUPCH        0.43  0.65  123  231   21  120  109    2    9  121  L9L1F2     Ig lambda chain V-III region SH OS=Tupaia chinensis GN=TREES_T100016834 PE=4 SV=1
 1160 : LV201_HUMAN         0.43  0.74  122  230    1  110  110    1    1  111  P01704     Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1
 1161 : LV205_HUMAN         0.43  0.69  122  231    1  109  110    1    1  109  P01708     Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1
 1162 : LV207_HUMAN         0.43  0.74  122  230    1  110  110    1    1  111  P01710     Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1
 1163 : LV208_HUMAN         0.43  0.73  122  231    1  111  111    1    1  111  P01711     Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1
 1164 : LV211_HUMAN         0.43  0.72  122  231    1  112  112    1    2  112  P04209     Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1
 1165 : LV402_HUMAN         0.43  0.68  125  231    3  106  108    3    5  106  P01716     Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1
 1166 : LV403_HUMAN         0.43  0.68  126  231    5  107  107    3    5  107  P01717     Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1
 1167 : LV405_HUMAN         0.43  0.69  125  231    3  106  108    3    5  106  P06889     Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1
 1168 : M0R4Z4_RAT          0.43  0.62  122  226   20  128  110    4    6  129  M0R4Z4     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
 1169 : Q4V801_XENLA        0.43  0.68    4  120   22  138  121    4    8  560  Q4V801     LOC398774 protein OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
 1170 : Q53VQ1_MOUSE        0.43  0.69    1  114    1  115  118    5    7  115  Q53VQ1     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1171 : Q53VR3_MOUSE        0.43  0.65    1  114    1  119  121    6    9  119  Q53VR3     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1172 : Q6GPX4_XENLA        0.43  0.71    1  120   20  137  122    3    6  585  Q6GPX4     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
 1173 : Q6LBQ5_MOUSE        0.43  0.71    2  120   20  136  120    4    4  136  Q6LBQ5     VH gene product (Fragment) OS=Mus musculus PE=4 SV=1
 1174 : Q6N092_HUMAN        0.43  0.65    1  120   44  166  126    2    9  519  Q6N092     Putative uncharacterized protein DKFZp686K18196 (Fragment) OS=Homo sapiens GN=DKFZp686K18196 PE=1 SV=1
 1175 : Q6PAF5_XENLA        0.43  0.66    1  120   30  142  120    4    7  225  Q6PAF5     LOC398774 protein (Fragment) OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
 1176 : Q7TMK4_MOUSE        0.43  0.70    1  120   20  135  122    2    8  479  Q7TMK4     Immunoglobulin heavy chain complex OS=Mus musculus GN=Igh PE=2 SV=1
 1177 : Q8K1F2_MOUSE1QOK    0.43  0.66  122  229    1  105  109    2    5  112  Q8K1F2     Anti-VIPase light chain variable region (Fragment) OS=Mus musculus PE=1 SV=1
 1178 : Q8VDD0_MOUSE        0.43  0.65  122  229   23  127  110    3    7  134  Q8VDD0     Anti-MOG Z12 variable light chain (Fragment) OS=Mus musculus GN=Igkv4-70 PE=2 SV=1
 1179 : Q96JD2_HUMAN        0.43  0.68  124  230    3  112  111    3    5  112  Q96JD2     Amyloid lambda 6 light chain variable region NEG (Fragment) OS=Homo sapiens PE=2 SV=1
 1180 : Q99M22_MOUSE        0.43  0.71    1  120   19  135  121    4    5  479  Q99M22     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
 1181 : Q9UL81_HUMAN        0.43  0.65  125  229    4  105  106    3    5  107  Q9UL81     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1182 : S6BAQ4_HUMAN        0.43  0.66    1  120   20  143  127    3   10  236  S6BAQ4     IgG H chain OS=Homo sapiens PE=2 SV=1
 1183 : A0N5G3_HUMAN        0.42  0.68  124  231    3  110  112    4    8  121  A0N5G3     Rheumatoid factor G9 light chain (Fragment) OS=Homo sapiens GN=V3 PE=2 SV=1
 1184 : A0N6Q7_9MURI        0.42  0.69    1  114    1  120  121    5    8  120  A0N6Q7     Rheumatoid factor RF3-2CR2A (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
 1185 : A0N7G5_9MURI        0.42  0.72    1  112    3  113  114    4    5  113  A0N7G5     H2 (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
 1186 : A0N7I9_HUMAN        0.42  0.65    4  120    5  119  120    6    8  123  A0N7I9     F5-20 (Fragment) OS=Homo sapiens GN=F5-20 PE=1 SV=1
 1187 : A2JA15_HUMAN        0.42  0.65  126  228    5  104  104    3    5  105  A2JA15     Anti-mucin1 light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1188 : A2KD57_LAMGL2P49    0.42  0.67    1  120    1  132  132    4   12  132  A2KD57     Hi113 protein (Fragment) OS=Lama glama GN=hi113 PE=1 SV=1
 1189 : A2KD59_LAMGL1QD0    0.42  0.66    1  120    1  128  131    5   14  128  A2KD59     R2 protein (Fragment) OS=Lama glama GN=r2 PE=1 SV=1
 1190 : A2KD63_LAMGL        0.42  0.61    1  120    1  128  131    5   14  128  A2KD63     R6 protein (Fragment) OS=Lama glama GN=r6 PE=4 SV=1
 1191 : A2N2F1_HUMAN        0.42  0.68  127  229    2  105  107    3    7  105  A2N2F1     VL4 protein (Fragment) OS=Homo sapiens GN=VL4 PE=2 SV=1
 1192 : A2NW25_MOUSE        0.42  0.72    7  120    1  107  114    2    7  107  A2NW25     Rearranged heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1193 : A2NW56_MOUSE        0.42  0.58  125  229    4  106  106    2    4  107  A2NW56     E8 variable light chain (Fragment) OS=Mus musculus PE=2 SV=1
 1194 : A2NYU8_HUMAN        0.42  0.68    1  120    1  116  120    2    4  116  A2NYU8     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1195 : A2NYV1_HUMAN        0.42  0.68    1  120    1  128  128    4    8  128  A2NYV1     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1196 : A2P2G7_SHEEP        0.42  0.66    1  120   20  140  125    5    9  140  A2P2G7     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1197 : A2P2H6_SHEEP        0.42  0.67    1  120   20  144  127    5    9  144  A2P2H6     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1198 : A2P2H8_SHEEP        0.42  0.67    1  120   20  140  125    6    9  140  A2P2H8     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1199 : A2P2I4_SHEEP        0.42  0.64    1  120   20  143  128    6   12  143  A2P2I4     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1200 : B1N7B8_HUMAN        0.42  0.64  122  229    1  106  109    2    4  107  B1N7B8     Cryocrystalglobulin CC1 kappa light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1201 : F1D882_MACMU        0.42  0.66    1  120   12  145  135    7   16  164  F1D882     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1202 : F1D890_MACMU        0.42  0.67  125  231   10  115  113    6   13  139  F1D890     Anti-quaternary epitope monoclonal antibody light chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1203 : F6Z4A7_HORSE        0.42  0.68  123  227    1  102  105    1    3  106  F6Z4A7     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
 1204 : F7ASQ3_MONDO        0.42  0.68    1  110   20  137  119    4   10  158  F7ASQ3     Uncharacterized protein OS=Monodelphis domestica GN=LOC100619427 PE=4 SV=2
 1205 : F7DQ70_MONDO        0.42  0.69    1  110   20  136  119    5   11  139  F7DQ70     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
 1206 : F7DS76_HORSE        0.42  0.70  125  231   22  123  107    2    5  128  F7DS76     Uncharacterized protein OS=Equus caballus GN=LOC100147544 PE=4 SV=1
 1207 : F7DY90_MONDO        0.42  0.61  125  228   16  109  105    3   12  109  F7DY90     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=LOC100618687 PE=4 SV=1
 1208 : F8SQR5_RAT          0.42  0.65  122  229    2  106  108    2    3  107  F8SQR5     Immunglobulin light chain variable region (Fragment) OS=Rattus norvegicus PE=2 SV=1
 1209 : G1L2W3_AILME        0.42  0.63  122  230   26  126  109    4    8  128  G1L2W3     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1210 : G1NYH9_MYOLU        0.42  0.72  122  227   20  122  106    1    3  122  G1NYH9     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1211 : G1PYA7_MYOLU        0.42  0.65    1  116   20  140  125    5   13  145  G1PYA7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1212 : G1PZL3_MYOLU        0.42  0.66    1  112    1  110  117    4   12  118  G1PZL3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1213 : G1PZY6_MYOLU        0.42  0.67    1  112    1  115  118    3    9  122  G1PZY6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1214 : G1Q4L0_MYOLU        0.42  0.70  122  224    1  101  103    1    2  107  G1Q4L0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1215 : G1Q615_MYOLU        0.42  0.66  122  230    1  104  109    1    5  105  G1Q615     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1216 : G1Q951_MYOLU        0.42  0.71    1  110   20  131  113    4    4  140  G1Q951     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1217 : G1Q9G1_MYOLU        0.42  0.64  122  227    1  102  106    2    4  108  G1Q9G1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1218 : G1QB32_MYOLU        0.42  0.66    1  111   20  127  114    5    9  136  G1QB32     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1219 : G1TUC3_RABIT        0.42  0.67  122  225   23  122  105    3    6  123  G1TUC3     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
 1220 : G3IG94_CRIGR        0.42  0.66    1  110  197  311  119    7   13  430  G3IG94     Zinc finger BED domain-containing protein 4 OS=Cricetulus griseus GN=I79_022775 PE=4 SV=1
 1221 : G3MZE0_BOVIN        0.42  0.65  122  231   20  126  110    2    3  126  G3MZE0     Uncharacterized protein OS=Bos taurus GN=LOC511353 PE=4 SV=1
 1222 : G3N608_GASAC        0.42  0.68    1  120    1  121  123    5    5  231  G3N608     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1223 : G3SEY9_GORGO        0.42  0.66  122  230   20  121  112    4   13  148  G3SEY9     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
 1224 : G3TZY3_LOXAF        0.42  0.67    1  116   20  141  122    2    6  145  G3TZY3     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1225 : G3UDY8_LOXAF        0.42  0.68    1  116   20  138  120    3    5  142  G3UDY8     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1226 : G3UKB2_LOXAF        0.42  0.67  122  212    1   97   97    3    6  116  G3UKB2     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=LOC100667242 PE=4 SV=1
 1227 : G3USY8_MELGA        0.42  0.65  124  231    1  104  111    4   10  119  G3USY8     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
 1228 : G3VGN7_SARHA        0.42  0.63  123  224   22  127  107    4    6  138  G3VGN7     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1229 : G8F145_MACMU        0.42  0.68    1  112    1  111  117    5   11  119  G8F145     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_20223 PE=4 SV=1
 1230 : H0ZF62_TAEGU        0.42  0.65  122  217    1   96   98    3    4   96  H0ZF62     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=4 SV=1
 1231 : H2TML4_TAKRU        0.42  0.62    4  120    4  119  122    4   11  248  H2TML4     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1232 : H3AN87_LATCH        0.42  0.71    1  120   20  135  121    3    6  135  H3AN87     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
 1233 : H9H3X7_MACMU        0.42  0.71    1  112    1  113  116    4    7  121  H9H3X7     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=IGHV4-28 PE=4 SV=1
 1234 : H9H465_MACMU        0.42  0.72    1  120    1  120  123    3    6  120  H9H465     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1235 : H9H6T9_MONDO        0.42  0.67    1  110   20  137  119    4   10  156  H9H6T9     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618912 PE=4 SV=2
 1236 : H9KWZ0_CALJA        0.42  0.68    1  113    1  114  119    6   11  121  H9KWZ0     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
 1237 : H9KXI7_CALJA        0.42  0.70    1  113    1  116  120    4   11  123  H9KXI7     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
 1238 : HV322_HUMAN 2FL5    0.42  0.64    1  120    1  118  121    3    4  118  P80419     Ig heavy chain V-III region GAR OS=Homo sapiens PE=1 SV=1
 1239 : I3JA11_ORENI        0.42  0.68    1  118    1  121  125    3   11  123  I3JA11     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1240 : I3NG77_SPETR        0.42  0.65  122  230    1  103  110    2    8  104  I3NG77     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1241 : I6ULB2_STRCA        0.42  0.69    2  120    2  119  123    4    9  119  I6ULB2     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1242 : I6UVI9_STRCA        0.42  0.67    2  120    2  123  126    5   11  123  I6UVI9     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1243 : I6UVJ4_STRCA        0.42  0.70    2  120    2  124  125    4    8  124  I6UVJ4     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1244 : J3QMZ0_MOUSE        0.42  0.64  122  216    1   92   97    3    7   96  J3QMZ0     Protein Igkv4-54 OS=Mus musculus GN=Igkv4-54 PE=4 SV=1
 1245 : K7T9K9_MOUSE        0.42  0.68    9  120    1  113  118    4   11  113  K7T9K9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1246 : K7T9U2_MOUSE        0.42  0.67    9  120    1  112  118    5   12  112  K7T9U2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1247 : K7TDC3_MOUSE        0.42  0.66    9  120    1  108  115    6   10  108  K7TDC3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1248 : K7TDD9_MOUSE        0.42  0.70    9  120    1  114  118    5   10  114  K7TDD9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1249 : K7TH26_MOUSE        0.42  0.70    9  120    1  112  116    4    8  112  K7TH26     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1250 : K7TH39_MOUSE        0.42  0.71    9  120    1  106  112    3    6  106  K7TH39     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1251 : K7TH41_MOUSE        0.42  0.70    9  120    1  112  116    4    8  112  K7TH41     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1252 : K7THG4_MOUSE        0.42  0.71   11  120    1  106  111    4    6  106  K7THG4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1253 : K7TR05_MOUSE        0.42  0.70    9  120    1  111  114    4    5  111  K7TR05     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1254 : K7TR35_MOUSE        0.42  0.73    9  120    1  109  113    4    5  109  K7TR35     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1255 : K7TRI2_MOUSE        0.42  0.66    9  120    1  113  118    4   11  113  K7TRI2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1256 : K7U5Y8_MOUSE        0.42  0.71    9  120    1  111  115    4    7  111  K7U5Y8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1257 : K7U624_MOUSE        0.42  0.69    9  120    1  113  118    4   11  113  K7U624     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1258 : K7U646_MOUSE        0.42  0.67   16  120    1  106  111    4   11  106  K7U646     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1259 : K7U676_MOUSE        0.42  0.67    9  120    1  113  118    4   11  113  K7U676     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1260 : K7U6E5_MOUSE        0.42  0.70    9  120    1  113  116    5    7  113  K7U6E5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1261 : K9J6E8_DESRO        0.42  0.66  122  231   20  131  114    4    6  146  K9J6E8     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1262 : KV4A1_MOUSE         0.42  0.69  122  229   23  127  109    4    5  129  P01680     Ig kappa chain V-IV region S107B OS=Mus musculus PE=4 SV=1
 1263 : KV5A2_MOUSE 1UYW    0.42  0.61  122  229   30  135  109    3    4  136  P01634     Ig kappa chain V-V region MOPC 21 OS=Mus musculus PE=1 SV=1
 1264 : KV5AH_MOUSE         0.42  0.60  124  229    4  106  106    1    3  108  P01650     Ig kappa chain V-V region UPC 61 OS=Mus musculus PE=1 SV=1
 1265 : KV5AL_MOUSE         0.42  0.60  124  229    4  106  106    1    3  108  P01653     Ig kappa chain V-V region W3082 OS=Mus musculus PE=1 SV=1
 1266 : L7N0K2_CANFA        0.42  0.70    1  120    1  121  125    3    9  121  L7N0K2     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=1
 1267 : L8B0S7_PIG          0.42  0.66    1  120   20  152  134    7   15  480  L8B0S7     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1268 : L8B0T7_PIG          0.42  0.64    1  120   20  148  129    4    9  476  L8B0T7     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1269 : L8B0X5_PIG          0.42  0.65    1  120   20  147  130    4   12  475  L8B0X5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1270 : L8B165_PIG          0.42  0.70    1  120   20  134  121    3    7  462  L8B165     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1271 : LV202_HUMAN         0.42  0.72  122  231    1  111  112    2    3  111  P01705     Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1
 1272 : LV206_HUMAN 2MCG    0.42  0.71  122  231    1  111  111    1    1  111  P01709     Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1
 1273 : LV210_HUMAN         0.42  0.68  122  230    1  109  110    2    2  110  P01713     Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1
 1274 : LV501_HUMAN         0.42  0.67  124  231    2  108  110    2    5  108  P01719     Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1
 1275 : Q5NV65_HUMAN        0.42  0.70  122  221    1   99  100    1    1   99  Q5NV65     V1-5 protein (Fragment) OS=Homo sapiens GN=IGLV2-18 PE=4 SV=1
 1276 : Q9UL78_HUMAN        0.42  0.65  122  229    1  107  109    2    3  109  Q9UL78     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1277 : S6AWF0_HUMAN        0.42  0.70    1  120   20  146  128    4    9  239  S6AWF0     IgG H chain OS=Homo sapiens PE=2 SV=1
 1278 : A0N6Y3_9MURI        0.41  0.61  122  229    1  106  109    2    4  107  A0N6Y3     F30C7 light chain variable region (Fragment) OS=Mus sp. GN=Ig VL PE=2 SV=1
 1279 : A0N7J6_HUMAN        0.41  0.61  122  229   21  127  110    4    5  134  A0N7J6     REV25-2 (Fragment) OS=Homo sapiens PE=2 SV=1
 1280 : A2IPI2_HUMAN        0.41  0.64  122  229    3  110  110    4    4  115  A2IPI2     HRV Fab N27-VL (Fragment) OS=Homo sapiens PE=2 SV=1
 1281 : A2IPI4_HUMAN        0.41  0.63  125  229    6  108  106    3    4  113  A2IPI4     HRV Fab 025-VL (Fragment) OS=Homo sapiens PE=2 SV=1
 1282 : A2IPI6_HUMAN        0.41  0.61  125  229    6  108  107    4    6  113  A2IPI6     HRV Fab 027-VL (Fragment) OS=Homo sapiens PE=2 SV=1
 1283 : A2KD53_LAMGL        0.41  0.68    1  120    1  117  121    3    5  117  A2KD53     H14 protein (Fragment) OS=Lama glama GN=h14 PE=4 SV=1
 1284 : A2KD58_LAMGL        0.41  0.62    1  120    1  128  131    5   14  128  A2KD58     R1 protein (Fragment) OS=Lama glama GN=r1 PE=4 SV=1
 1285 : A2KD61_LAMGL        0.41  0.64    1  120    1  115  121    4    7  115  A2KD61     R4 protein (Fragment) OS=Lama glama GN=r4 PE=4 SV=1
 1286 : A2N0S5_HUMAN        0.41  0.61    9  120    1  111  116    5    9  114  A2N0S5     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1287 : A2N0T9_HUMAN        0.41  0.63    9  120    1  112  116    6    8  115  A2N0T9     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1288 : A2N0U0_HUMAN        0.41  0.61    9  120    1  111  115    4    7  114  A2N0U0     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1289 : A2N0U1_HUMAN        0.41  0.60    9  120    1  111  116    6    9  114  A2N0U1     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1290 : A2N0U6_HUMAN        0.41  0.62    9  120    1  113  116    4    7  116  A2N0U6     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1291 : A2N2G6_HUMAN        0.41  0.64  125  225    3  103  104    3    6  107  A2N2G6     VL87-2 protein (Fragment) OS=Homo sapiens GN=VL87-2 PE=2 SV=1
 1292 : A2NVE9_MOUSE        0.41  0.61  122  229    1  106  109    2    4  108  A2NVE9     Immnuoglobulin kappa light chain (Fragment) OS=Mus musculus PE=4 SV=1
 1293 : A2NYU6_HUMAN        0.41  0.62    1  120    1  127  128    4    9  127  A2NYU6     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1294 : A2NYU7_HUMAN        0.41  0.62    1  120    1  127  128    4    9  127  A2NYU7     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1295 : A2NYV3_HUMAN        0.41  0.64  124  229    1  104  107    2    4  105  A2NYV3     Light chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1296 : A2P2G5_SHEEP        0.41  0.66    1  120   20  141  126    6   10  141  A2P2G5     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1297 : A2P2H3_SHEEP        0.41  0.64    1  120   20  140  126    7   11  140  A2P2H3     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1298 : A2P2H5_SHEEP        0.41  0.66    1  120   20  140  126    7   11  140  A2P2H5     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1299 : F1D883_MACMU        0.41  0.64    1  120   12  145  135    7   16  164  F1D883     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1300 : F1D884_MACMU        0.41  0.65    1  120   12  145  135    6   16  164  F1D884     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1301 : F6XC02_ORNAN        0.41  0.71    1  113    1  108  116    4   11  124  F6XC02     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1302 : F6ZVQ0_ORNAN        0.41  0.69    1  113    1  106  116    5   13  122  F6ZVQ0     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1303 : F7ASP4_MONDO        0.41  0.66    1  110   20  136  119    5   11  161  F7ASP4     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
 1304 : F7DJZ5_HORSE        0.41  0.67  125  226    4   97  102    2    8   97  F7DJZ5     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
 1305 : F7DQ52_MONDO        0.41  0.69    1  110   20  137  119    4   10  158  F7DQ52     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
 1306 : F7DSH4_MONDO        0.41  0.69    1  110   20  137  118    3    8  158  F7DSH4     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
 1307 : F7E8Y0_MONDO        0.41  0.70    1  110   20  137  119    4   10  215  F7E8Y0     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
 1308 : F7E8Z5_MONDO        0.41  0.69    1  110   20  137  119    4   10  138  F7E8Z5     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
 1309 : F7HBI3_CALJA        0.41  0.65    1  120   20  140  127    5   13  487  F7HBI3     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
 1310 : G1LNH6_AILME        0.41  0.62  128  230    6  101  105    3   11  117  G1LNH6     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1311 : G1MK32_AILME        0.41  0.66  122  231    1  106  111    3    6  108  G1MK32     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1312 : G1PNR8_MYOLU        0.41  0.70    1  119    1  121  124    4    8  122  G1PNR8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1313 : G1Q0I1_MYOLU        0.41  0.68    1  119    1  117  121    3    6  118  G1Q0I1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1314 : G1Q1S8_MYOLU        0.41  0.68    1  119    1  118  122    3    7  119  G1Q1S8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1315 : G1Q6A7_MYOLU        0.41  0.68    1  112   20  131  117    4   10  161  G1Q6A7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1316 : G1QAS8_MYOLU        0.41  0.67  122  225    1  105  105    1    1  111  G1QAS8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1317 : G1QDT6_MYOLU        0.41  0.66  122  228    1  103  108    3    6  105  G1QDT6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1318 : G1QE90_MYOLU        0.41  0.68    1  119    1  118  122    3    7  119  G1QE90     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1319 : G3N028_BOVIN        0.41  0.65  122  228    1  104  107    2    3  116  G3N028     Uncharacterized protein (Fragment) OS=Bos taurus PE=4 SV=1
 1320 : G3N8N3_GASAC        0.41  0.69    1  120    1  120  125    5   10  227  G3N8N3     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1321 : G3U4H6_LOXAF        0.41  0.60  122  230   21  119  111    5   14  134  G3U4H6     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1322 : G3UAN7_LOXAF        0.41  0.61  122  230   42  141  111    5   13  145  G3UAN7     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1323 : G3UDF1_LOXAF        0.41  0.59  122  230   30  128  111    4   14  133  G3UDF1     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1324 : G3UJZ7_LOXAF        0.41  0.66    1  116   20  144  125    3    9  148  G3UJZ7     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1325 : G3VBJ5_SARHA        0.41  0.62  123  231   22  132  113    5    6  132  G3VBJ5     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1326 : G3VWT2_SARHA        0.41  0.59  122  230   28  126  111    5   14  153  G3VWT2     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
 1327 : G5E7P2_MELGA        0.41  0.63  124  231    1  105  111    3    9  120  G5E7P2     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
 1328 : H0XH36_OTOGA        0.41  0.61  122  216    1   99   99    2    4  116  H0XH36     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=IGKV4-1 PE=4 SV=1
 1329 : H0XRL1_OTOGA        0.41  0.60  125  231    4  103  109    4   11  103  H0XRL1     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1330 : H0XWR6_OTOGA        0.41  0.60  122  226   20  135  117    9   13  142  H0XWR6     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
 1331 : H0XZ78_OTOGA        0.41  0.66  126  230    5  107  106    2    4  108  H0XZ78     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1332 : H2ZRT4_LATCH        0.41  0.68    2  111   21  122  111    3   10  136  H2ZRT4     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
 1333 : H9H6T6_MONDO        0.41  0.69    1  110   20  137  119    4   10  145  H9H6T6     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618709 PE=4 SV=2
 1334 : HV308_HUMAN         0.41  0.68    1  120    1  122  126    4   10  122  P01769     Ig heavy chain V-III region GA OS=Homo sapiens PE=1 SV=1
 1335 : HV313_HUMAN         0.41  0.67    1  117    1  119  123    4   10  119  P01774     Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1
 1336 : HV314_HUMAN         0.41  0.68    2  117    2  119  122    4   10  119  P01775     Ig heavy chain V-III region LAY OS=Homo sapiens PE=1 SV=1
 1337 : HV316_HUMAN         0.41  0.66    1  117    1  119  126    6   16  119  P01777     Ig heavy chain V-III region TEI OS=Homo sapiens PE=1 SV=1
 1338 : HV319_HUMAN         0.41  0.69    1  117    1  115  121    6   10  115  P01780     Ig heavy chain V-III region JON OS=Homo sapiens PE=1 SV=1
 1339 : I3JA41_ORENI        0.41  0.67    7  117    1  109  113    3    6  112  I3JA41     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=IGHD (3 of 3) PE=4 SV=1
 1340 : I3JIV1_ORENI        0.41  0.65  122  222    1  102  103    2    3  109  I3JIV1     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100701395 PE=4 SV=1
 1341 : I3LX96_SPETR        0.41  0.62  122  229    1   98  108    2   10  108  I3LX96     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1342 : I3MKU1_SPETR        0.41  0.66    4  113    1  105  112    3    9  125  I3MKU1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1343 : I6U3W7_STRCA        0.41  0.67    2  120    2  123  126    4   11  123  I6U3W7     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1344 : I6UXQ7_STRCA        0.41  0.73    2  120    2  124  123    2    4  124  I6UXQ7     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1345 : J9P8P3_CANFA        0.41  0.68  122  228   20  122  107    2    4  129  J9P8P3     Uncharacterized protein OS=Canis familiaris GN=LOC100855788 PE=4 SV=1
 1346 : J9PAD4_CANFA        0.41  0.68  122  228   20  122  107    2    4  125  J9PAD4     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
 1347 : K7FIM2_PELSI        0.41  0.65  122  231   20  131  116    5   10  131  K7FIM2     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
 1348 : K7T9R0_MOUSE        0.41  0.68    9  120    1  108  113    5    6  108  K7T9R0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1349 : K7TD45_MOUSE        0.41  0.71    9  120    1  107  113    4    7  107  K7TD45     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1350 : K7TDG8_MOUSE        0.41  0.70    9  120    1  112  116    4    8  112  K7TDG8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1351 : K7TH73_MOUSE        0.41  0.65    9  120    1  110  115    6    8  110  K7TH73     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1352 : K7U630_MOUSE        0.41  0.71    9  120    1  106  112    3    6  106  K7U630     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1353 : KV308_HUMAN         0.41  0.61  122  229   21  127  110    3    5  129  P04207     Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2
 1354 : KV313_HUMAN         0.41  0.64  122  229   21  127  109    3    3  129  P18136     Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=2
 1355 : L7N1T8_MYOLU        0.41  0.66  122  228   20  122  107    2    4  126  L7N1T8     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1356 : L8AXM5_PIG          0.41  0.66    1  120   20  144  126    3    7  472  L8AXM5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1357 : LV204_HUMAN         0.41  0.70  122  231    1  111  111    1    1  111  P01707     Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1
 1358 : LV404_HUMAN         0.41  0.65  124  231    2  106  109    3    5  106  P01718     Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1
 1359 : M3WXH2_FELCA        0.41  0.68  122  230   20  122  109    2    6  122  M3WXH2     Uncharacterized protein OS=Felis catus GN=LOC101101597 PE=4 SV=1
 1360 : M3X1Y7_FELCA        0.41  0.64  122  227    1  102  106    2    4  106  M3X1Y7     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1361 : M3XPX0_MUSPF        0.41  0.66  122  229   20  124  108    1    3  132  M3XPX0     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 1362 : Q53VQ9_MOUSE        0.41  0.66    1  114    1  119  122    6   11  119  Q53VQ9     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1363 : Q53VR7_MOUSE        0.41  0.70    1  114    1  120  121    5    8  120  Q53VR7     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1364 : Q5NV79_HUMAN        0.41  0.57  122  217    1   98  101    3    8   99  Q5NV79     V5-4 protein (Fragment) OS=Homo sapiens GN=IGLV4-60 PE=4 SV=1
 1365 : Q5U472_MOUSE        0.41  0.72    1  120   20  139  124    5    8  484  Q5U472     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
 1366 : Q6N090_HUMAN        0.41  0.67    1  120   38  153  123    5   10  506  Q6N090     Putative uncharacterized protein DKFZp686G21220 (Fragment) OS=Homo sapiens GN=DKFZp686G21220 PE=1 SV=1
 1367 : Q96SA9_HUMAN        0.41  0.64  122  229    1  105  109    3    5  107  Q96SA9     Anti-streptococcal/anti-myosin immunoglobulin kappa light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1368 : Q9U410_MOUSE        0.41  0.64  122  229    1  105  109    2    5  106  Q9U410     Monoclonal anti-idiotypic Schistosoma japonicum antibody NP30 immunoglobulin light chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
 1369 : Q9UL76_HUMAN        0.41  0.59  122  230    1   93  111    2   20   93  Q9UL76     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1370 : S6BGE0_HUMAN        0.41  0.73    1  120   20  139  124    5    8  300  S6BGE0     IgG H chain OS=Homo sapiens PE=2 SV=1
 1371 : S9WYA3_9CETA        0.41  0.65  123  230   21  122  109    3    8  124  S9WYA3     Ig lambda chain V-I region BL2-like protein OS=Camelus ferus GN=CB1_000760040 PE=4 SV=1
 1372 : S9XLA3_9CETA        0.41  0.64  122  230   20  121  110    4    9  131  S9XLA3     Uncharacterized protein OS=Camelus ferus GN=CB1_008586001 PE=4 SV=1
 1373 : A0N586_9MURI        0.40  0.59  122  229   21  126  109    2    4  127  A0N586     Anti-CD4 mAb M-T151 variable region light chain (Fragment) OS=Mus sp. GN=Ig VL PE=2 SV=1
 1374 : A2IPI0_HUMAN        0.40  0.64  122  229    3  108  109    2    4  113  A2IPI0     HRV Fab N6-VL (Fragment) OS=Homo sapiens PE=2 SV=1
 1375 : A2IPI3_HUMAN        0.40  0.62  122  229    3  109  109    3    3  114  A2IPI3     HRV Fab N28-VL (Fragment) OS=Homo sapiens PE=2 SV=1
 1376 : A2IPI5_HUMAN        0.40  0.62  122  229    3  108  109    2    4  113  A2IPI5     HRV Fab 026-VL (Fragment) OS=Homo sapiens PE=2 SV=1
 1377 : A2JA16_HUMAN        0.40  0.61  122  229    1  106  109    2    4  107  A2JA16     Anti-mucin1 light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1378 : A2KD60_LAMGL        0.40  0.61    1  120    1  128  131    5   14  128  A2KD60     R3 protein (Fragment) OS=Lama glama GN=r3 PE=4 SV=1
 1379 : A2KD62_LAMGL        0.40  0.62    1  120    1  128  131    5   14  128  A2KD62     R5 protein (Fragment) OS=Lama glama GN=r5 PE=4 SV=1
 1380 : A2KD64_LAMGL        0.40  0.60    1  120    1  128  131    5   14  128  A2KD64     R7 protein (Fragment) OS=Lama glama GN=r7 PE=4 SV=1
 1381 : A2MYD1_HUMAN        0.40  0.62  122  217    1  102  103    5    8  105  A2MYD1     V4-4 protein (Fragment) OS=Homo sapiens GN=V4-4 PE=4 SV=1
 1382 : A2MYD2_HUMAN        0.40  0.70  122  224    1   99  103    2    4   99  A2MYD2     V1-19 protein (Fragment) OS=Homo sapiens GN=V1-19 PE=4 SV=1
 1383 : A2N0S9_HUMAN        0.40  0.63    9  120    1  113  116    4    7  116  A2N0S9     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1384 : A2N0T5_HUMAN        0.40  0.62    9  120    1  112  116    4    8  115  A2N0T5     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1385 : A2N0T8_HUMAN        0.40  0.60    9  120    1  113  117    7    9  116  A2N0T8     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1386 : A2N0U2_HUMAN        0.40  0.62    9  120    1  111  115    4    7  114  A2N0U2     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1387 : A2N2F4_HUMAN        0.40  0.60  125  229    1  104  107    4    5  108  A2N2F4     VK3 protein (Fragment) OS=Homo sapiens GN=VK3 PE=2 SV=1
 1388 : A2N2W8_HUMAN        0.40  0.65  134  231    1   87  100    3   15   87  A2N2W8     VL6 protein (Fragment) OS=Homo sapiens GN=VL6 PE=4 SV=1
 1389 : A2NYQ8_HUMAN        0.40  0.67  122  230    1  111  111    2    2  111  A2NYQ8     Anti-folate binding protein (Fragment) OS=Homo sapiens GN=HuD11lambda Vlambda PE=2 SV=1
 1390 : A2P2G3_SHEEP        0.40  0.66    1  120   20  142  125    5    7  142  A2P2G3     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1391 : E2QXJ3_CANFA        0.40  0.60  122  225   21  116  105    4   10  116  E2QXJ3     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
 1392 : F1NSC8_CHICK        0.40  0.66  122  228    5  107  108    3    6  113  F1NSC8     Uncharacterized protein (Fragment) OS=Gallus gallus PE=4 SV=2
 1393 : F6UMN2_ORNAN        0.40  0.62    1  110    1  105  112    4    9  132  F6UMN2     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1394 : F7BF18_XENTR        0.40  0.58  122  231   26  135  121    8   22  240  F7BF18     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=igl@ PE=4 SV=1
 1395 : G1L2W6_AILME        0.40  0.60  122  231   20  115  110    3   14  115  G1L2W6     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
 1396 : G1MLV5_AILME        0.40  0.65  122  230    5  106  110    3    9  108  G1MLV5     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1397 : G1Q425_MYOLU        0.40  0.68    1  110   18  120  111    3    9  126  G1Q425     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1398 : G1QAG0_MYOLU        0.40  0.67    1  115    1  111  118    5   10  133  G1QAG0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1399 : G1QCM4_MYOLU        0.40  0.67  122  228   20  123  107    1    3  128  G1QCM4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1400 : G1QEA3_MYOLU        0.40  0.64    1  120   20  146  131    5   15  146  G1QEA3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1401 : G1QG49_MYOLU        0.40  0.64    1  120   20  146  131    5   15  146  G1QG49     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1402 : G1THZ6_RABIT        0.40  0.66    6  120   24  135  117    5    7  458  G1THZ6     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100009097 PE=4 SV=1
 1403 : G3MZH0_BOVIN        0.40  0.68    1  120   20  132  121    5    9  132  G3MZH0     Uncharacterized protein OS=Bos taurus GN=LOC100300806 PE=4 SV=1
 1404 : G3N1H5_BOVIN        0.40  0.69    1  120   20  132  121    5    9  132  G3N1H5     Uncharacterized protein OS=Bos taurus GN=LOC100300716 PE=4 SV=1
 1405 : G3TXG5_LOXAF        0.40  0.64    1  117    1  122  126    6   13  125  G3TXG5     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1406 : G3U310_LOXAF        0.40  0.62  122  230   30  130  111    5   12  149  G3U310     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1407 : G3U7P7_LOXAF        0.40  0.68    1  110    1  110  113    4    6  119  G3U7P7     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1408 : G3UC44_LOXAF        0.40  0.61  122  230   21  120  110    3   11  123  G3UC44     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1409 : G3URV8_MELGA        0.40  0.67  122  224    4  102  104    3    6  102  G3URV8     Uncharacterized protein (Fragment) OS=Meleagris gallopavo PE=4 SV=1
 1410 : G3UU68_MELGA        0.40  0.66  122  230    4  113  115    5   11  113  G3UU68     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
 1411 : G3VJI1_SARHA        0.40  0.61  122  230   21  119  110    4   12  121  G3VJI1     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1412 : G3X7I5_BOVIN        0.40  0.64  122  231    1  109  112    2    5  109  G3X7I5     Uncharacterized protein (Fragment) OS=Bos taurus PE=4 SV=1
 1413 : G7N3D3_MACMU        0.40  0.64  122  230   20  122  111    4   10  122  G7N3D3     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_02846 PE=4 SV=1
 1414 : G7N3D7_MACMU        0.40  0.66  122  230   20  119  109    4    9  119  G7N3D7     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_02851 PE=4 SV=1
 1415 : G8F1B6_MACMU        0.40  0.57  122  230   23  121  111    4   14  125  G8F1B6     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_21164 PE=4 SV=1
 1416 : G8F210_MACMU        0.40  0.68    1  120    1  121  124    4    7  121  G8F210     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21588 PE=4 SV=1
 1417 : G8F2P8_MACFA        0.40  0.69    1  120    1  120  123    3    6  120  G8F2P8     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_19491 PE=4 SV=1
 1418 : H0XUZ1_OTOGA        0.40  0.66  122  231   20  126  110    1    3  126  H0XUZ1     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
 1419 : H0XX49_OTOGA        0.40  0.59  122  230    1  102  111    4   11  102  H0XX49     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1420 : H9GWR0_CANFA        0.40  0.69  122  228   20  122  107    2    4  125  H9GWR0     Uncharacterized protein OS=Canis familiaris GN=LOC612122 PE=4 SV=2
 1421 : HV301_HUMAN         0.40  0.73    1  120    1  122  122    2    2  122  P01762     Ig heavy chain V-III region TRO OS=Homo sapiens PE=1 SV=1
 1422 : I3KY48_ORENI        0.40  0.60  122  216    1  100  100    3    5  105  I3KY48     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1423 : I3N7U3_SPETR        0.40  0.67  125  225    1   96  104    4   11  106  I3N7U3     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1424 : I6TTD2_STRCA        0.40  0.69    2  120    2  128  127    3    8  128  I6TTD2     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1425 : J3QNZ9_MOUSE        0.40  0.63  122  216    1   92   97    3    7   96  J3QNZ9     Protein Igkv4-62 OS=Mus musculus GN=Igkv4-62 PE=4 SV=1
 1426 : K7DYQ2_MONDO        0.40  0.68    1  110   20  137  119    4   10  153  K7DYQ2     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618872 PE=4 SV=1
 1427 : K7F503_PELSI        0.40  0.70    1  120    1  114  120    2    6  224  K7F503     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
 1428 : K7TH19_MOUSE        0.40  0.67    9  120    1  108  115    7   10  108  K7TH19     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1429 : KV305_HUMAN         0.40  0.62  122  229    1  107  110    4    5  109  P01623     Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1
 1430 : KV312_HUMAN         0.40  0.65  122  229   21  127  110    5    5  129  P18135     Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1
 1431 : KV3AJ_MOUSE         0.40  0.60  122  229    1  110  111    3    4  111  P01671     Ig kappa chain V-III region PC 7175 OS=Mus musculus PE=1 SV=1
 1432 : KV3AL_MOUSE         0.40  0.61  122  229    1  110  111    3    4  111  P01673     Ig kappa chain V-III region PC 2485/PC 4039 OS=Mus musculus PE=1 SV=1
 1433 : KV3AM_MOUSE         0.40  0.61  122  227    1  108  109    3    4  108  P01674     Ig kappa chain V-III region PC 2154 OS=Mus musculus PE=1 SV=1
 1434 : KV5AE_MOUSE 2VWE    0.40  0.60  122  229    1  106  110    4    6  108  P01647     Ig kappa chain V-V region HP 124E1 OS=Mus musculus PE=1 SV=1
 1435 : KV6A1_MOUSE 3BT2    0.40  0.63  122  229    1  105  111    5    9  107  P01675     Ig kappa chain V-VI region XRPC 44 OS=Mus musculus PE=1 SV=1
 1436 : KV6A4_MOUSE         0.40  0.64  122  229    1  105  111    5    9  107  P01678     Ig kappa chain V-VI region SAPC 10 OS=Mus musculus PE=1 SV=1
 1437 : L5KCQ3_PTEAL        0.40  0.65  122  227   20  121  107    3    6  121  L5KCQ3     Ig lambda chain V-I region BL2 OS=Pteropus alecto GN=PAL_GLEAN10000120 PE=4 SV=1
 1438 : L8AXM9_PIG          0.40  0.65    1  120   20  144  125    3    5  472  L8AXM9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1439 : L8B0U8_PIG          0.40  0.66    1  120   20  137  122    4    6  465  L8B0U8     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1440 : L8B0V6_PIG          0.40  0.65    1  120   20  146  130    7   13  474  L8B0V6     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1441 : L8B0W9_PIG          0.40  0.64    1  120   20  146  127    4    7  470  L8B0W9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1442 : L8B0Y6_PIG          0.40  0.67    1  120   20  147  128    2    8  475  L8B0Y6     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1443 : L8B173_PIG          0.40  0.66    1  120   20  141  126    5   10  469  L8B173     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1444 : L8YBW0_TUPCH        0.40  0.61  123  231   21  117  110    3   14  118  L8YBW0     Ig lambda chain V-III region SH OS=Tupaia chinensis GN=TREES_T100017346 PE=4 SV=1
 1445 : M3WUF8_FELCA        0.40  0.67  122  231   20  125  111    3    6  127  M3WUF8     Uncharacterized protein OS=Felis catus PE=4 SV=1
 1446 : M3X2K2_FELCA        0.40  0.65  122  231   20  125  111    3    6  125  M3X2K2     Uncharacterized protein OS=Felis catus PE=4 SV=1
 1447 : M9MMM4_PONAB        0.40  0.62  122  225   21  120  106    4    8  120  M9MMM4     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1448 : Q5F2I7_MOUSE        0.40  0.60  122  229    1  110  111    3    4  111  Q5F2I7     Kappa light chain variable region (Fragment) OS=Mus musculus GN=Igk PE=2 SV=1
 1449 : Q5NV81_HUMAN        0.40  0.67  122  223    1   99  103    3    5   99  Q5NV81     V1-16 protein (Fragment) OS=Homo sapiens GN=IGLV1-44 PE=4 SV=1
 1450 : Q5NV84_HUMAN        0.40  0.68  122  221    1   99  100    1    1   99  Q5NV84     V1-3 protein (Fragment) OS=Homo sapiens GN=IGLV2-11 PE=4 SV=1
 1451 : Q6MZX7_HUMAN        0.40  0.66    1  120   27  149  125    5    7  476  Q6MZX7     Putative uncharacterized protein DKFZp686M24218 OS=Homo sapiens GN=DKFZp686M24218 PE=1 SV=1
 1452 : Q8IZD7_HUMAN        0.40  0.63    1  120    1  130  131    5   12  130  Q8IZD7     Anti-thyroglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1453 : Q9UL70_HUMAN        0.40  0.62  122  229    1  106  110    4    6  108  Q9UL70     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
 1454 : Q9UL79_HUMAN        0.40  0.61  122  229    1  106  110    4    6  108  Q9UL79     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1455 : Q9UL83_HUMAN        0.40  0.61  122  229    1  106  109    2    4  108  Q9UL83     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
 1456 : Q9UL86_HUMAN        0.40  0.63  122  229    1  107  110    4    5  109  Q9UL86     Myosin-reactive immunoglobulin kappa chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
 1457 : R9VYW2_LAMGL        0.40  0.63    1  120    1  121  125    6    9  121  R9VYW2     Anti-F4+ETEC bacteria VHH variable region (Fragment) OS=Lama glama PE=2 SV=1
 1458 : A0N6R0_9MURI        0.39  0.57  122  229    1  106  110    4    6  106  A0N6R0     Rheumatoid factor RF3-2C (Fragment) OS=Mus sp. GN=Ig V PE=2 SV=1
 1459 : A2IPW9_MOUSE        0.39  0.63  122  229   21  126  109    3    4  127  A2IPW9     Immnogloblin light chain variable region (Precursor) OS=Mus musculus GN=Igkv9-124 PE=2 SV=1
 1460 : A2MY60_MOUSE        0.39  0.61  122  229    1  106  109    2    4  107  A2MY60     Kappa (Fragment) OS=Mus musculus GN=kappa PE=2 SV=1
 1461 : A2MYC7_9MURI        0.39  0.61  122  229    1  106  109    2    4  107  A2MYC7     MA-15 light chain (Fragment) OS=Mus sp. PE=2 SV=1
 1462 : A2N0S6_HUMAN        0.39  0.58    9  120    1  117  119    5    9  120  A2N0S6     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1463 : A2N0S8_HUMAN        0.39  0.60   10  120    2  117  119    5   11  120  A2N0S8     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1464 : A2N0T0_HUMAN        0.39  0.60    9  120    1  117  121    5   13  120  A2N0T0     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1465 : A2N0T6_HUMAN        0.39  0.60    9  120    1  116  119    4   10  119  A2N0T6     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1466 : A2N0T7_HUMAN        0.39  0.59    9  120    1  111  116    5    9  114  A2N0T7     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1467 : A2N2G8_HUMAN        0.39  0.59  125  228    3  108  108    2    6  108  A2N2G8     VLC8 protein (Fragment) OS=Homo sapiens GN=VLC8 PE=2 SV=1
 1468 : A2NB46_HUMAN        0.39  0.63  122  229    1  107  110    4    5  109  A2NB46     Cold agglutinin FS-2 L-chain (Fragment) OS=Homo sapiens PE=2 SV=1
 1469 : A2NC20_MOUSE        0.39  0.62  122  229   21  132  112    3    4  133  A2NC20     CC49 Fab (Precursor) OS=Mus musculus GN=Igkv8-30 PE=2 SV=1
 1470 : A2NXP9_HUMAN        0.39  0.61  122  229    1  108  110    3    4  110  A2NXP9     K light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1471 : A2P2I2_SHEEP        0.39  0.64    1  120   20  145  129    4   12  145  A2P2I2     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1472 : A2P2I3_SHEEP        0.39  0.66    1  120   20  142  128    6   13  142  A2P2I3     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1473 : A4F255_HUMAN2QAD    0.39  0.65    4  120    1  127  127    4   10  234  A4F255     Immunoblobulin G1 Fab heavy chain variable region (Fragment) OS=Homo sapiens GN=VHCH1 PE=2 SV=1
 1474 : B5UB69_MOUSE        0.39  0.64  122  229    1  111  112    4    5  114  B5UB69     EP3-6 light chain variable region (Fragment) OS=Mus musculus GN=Igkv8-19 PE=2 SV=1
 1475 : B5UB71_MOUSE        0.39  0.62  122  229    1  106  109    2    4  109  B5UB71     EP3-31 light chain variable region (Fragment) OS=Mus musculus GN=EP3-31VL PE=2 SV=1
 1476 : F1M5X4_RAT          0.39  0.63    1  113    1  116  119    4    9  124  F1M5X4     Uncharacterized protein (Fragment) OS=Rattus norvegicus GN=LOC100362687 PE=4 SV=1
 1477 : F1NBX7_CHICK        0.39  0.69  122  227    1  102  107    3    6  103  F1NBX7     Uncharacterized protein (Fragment) OS=Gallus gallus PE=4 SV=2
 1478 : F1NC22_CHICK        0.39  0.65  122  224   16  110  104    4   10  121  F1NC22     Uncharacterized protein OS=Gallus gallus PE=4 SV=2
 1479 : F6RFN4_MACMU        0.39  0.64  122  231    1  113  114    4    5  113  F6RFN4     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1480 : F6S1J6_MACMU        0.39  0.62  125  229    1  103  107    5    6  104  F6S1J6     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
 1481 : G1L2V8_AILME        0.39  0.63  125  228    2  107  106    2    2  110  G1L2V8     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1482 : G1M4J9_AILME        0.39  0.65  124  224    2   97  101    2    5  105  G1M4J9     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=IGLV3-1 PE=4 SV=1
 1483 : G1N5U6_MELGA        0.39  0.65  122  224   18  111  104    3   11  112  G1N5U6     Uncharacterized protein (Fragment) OS=Meleagris gallopavo PE=4 SV=2
 1484 : G1PYJ6_MYOLU        0.39  0.62    7  120    1  112  120    4   14  112  G1PYJ6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1485 : G1PYV8_MYOLU        0.39  0.64    1  111   20  134  119    5   12  144  G1PYV8     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1486 : G1Q6N0_MYOLU        0.39  0.65    1  112   20  134  122    6   17  141  G1Q6N0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1487 : G1Q8L6_MYOLU        0.39  0.63    1  112    1  115  119    5   11  127  G1Q8L6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1488 : G1Q988_MYOLU        0.39  0.64  122  228   20  122  107    2    4  125  G1Q988     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1489 : G1QCY5_MYOLU        0.39  0.68  122  225    1  103  104    1    1  111  G1QCY5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1490 : G1QFT3_MYOLU        0.39  0.66    1  110   20  133  118    6   12  143  G1QFT3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1491 : G3GAU4_HUMAN        0.39  0.62  122  229    1  104  109    3    6  107  G3GAU4     Anti-H1N1 influenza HA kappa chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1492 : G3MXD9_BOVIN        0.39  0.67    1  112   20  130  116    5    9  140  G3MXD9     Uncharacterized protein OS=Bos taurus GN=LOC100300806 PE=4 SV=1
 1493 : G3RNC3_GORGO        0.39  0.68  122  231   20  125  110    2    4  125  G3RNC3     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
 1494 : G3RY71_GORGO        0.39  0.66  122  228    1  103  107    2    4  103  G3RY71     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1495 : G3S3U5_GORGO        0.39  0.59  122  230   21  119  111    4   14  134  G3S3U5     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
 1496 : G3U4C5_LOXAF        0.39  0.59  122  230    1   99  111    4   14  108  G3U4C5     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1497 : G3ULX6_LOXAF        0.39  0.60  129  230    1   92  103    4   12   95  G3ULX6     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1498 : G3URF8_MELGA        0.39  0.67  122  222   20  124  106    4    6  133  G3URF8     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
 1499 : G3VA62_SARHA        0.39  0.60  123  227   22  129  111    6    9  130  G3VA62     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1500 : G3VAP0_SARHA        0.39  0.62  123  227    1  109  109    3    4  112  G3VAP0     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
 1501 : G3VLN0_SARHA        0.39  0.57  123  231   22  121  112    4   15  130  G3VLN0     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1502 : G7N3D6_MACMU        0.39  0.69  122  224   20  117  103    3    5  117  G7N3D6     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_02850 PE=4 SV=1
 1503 : G7PMP4_MACFA        0.39  0.59  122  230   23  121  111    5   14  125  G7PMP4     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_05004 PE=4 SV=1
 1504 : G8F2X0_MACFA        0.39  0.66  122  230    5  106  109    3    7  106  G8F2X0     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_19668 PE=4 SV=1
 1505 : H0X5X8_OTOGA        0.39  0.57  122  230    3  101  110    3   12  110  H0X5X8     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1506 : H0XHT9_OTOGA        0.39  0.59  125  229    6  108  106    3    4  113  H0XHT9     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1507 : H0XZQ8_OTOGA        0.39  0.64  122  231   21  127  111    2    5  131  H0XZQ8     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1508 : H0Y0H4_OTOGA        0.39  0.63  125  229    4   99  106    4   11  122  H0Y0H4     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1509 : H2UG38_TAKRU        0.39  0.65    4  120    4  122  120    4    4  122  H2UG38     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1510 : H3AL77_LATCH        0.39  0.68    2  118    2  120  120    3    4  240  H3AL77     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
 1511 : H9G6R6_ANOCA        0.39  0.71    1  118    1  117  119    2    3  230  H9G6R6     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1512 : H9G9Y9_ANOCA        0.39  0.60    1  111   22  140  122    6   14  149  H9G9Y9     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=1
 1513 : H9H2J4_MELGA        0.39  0.64    2  110    2  116  117    6   10  126  H9H2J4     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100542723 PE=4 SV=1
 1514 : H9H5B4_MACMU        0.39  0.67  122  224    1  102  103    1    1  102  H9H5B4     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1515 : HV206_HUMAN 1ZVO    0.39  0.63    1  120    1  129  130    6   11  129  P01824     Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1
 1516 : HV312_HUMAN         0.39  0.71    1  119    1  118  123    3    9  119  P01773     Ig heavy chain V-III region BUR OS=Homo sapiens PE=1 SV=1
 1517 : HV318_HUMAN         0.39  0.67    1  117    1  116  122    7   11  116  P01779     Ig heavy chain V-III region TUR OS=Homo sapiens PE=1 SV=1
 1518 : I3JA24_ORENI        0.39  0.68    4  120    2  117  120    4    7  117  I3JA24     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1519 : I3K3L5_ORENI        0.39  0.64    2  112    2  112  114    3    6  124  I3K3L5     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100697487 PE=4 SV=1
 1520 : I3M0G7_SPETR        0.39  0.62  122  230    1   99  109    2   10   99  I3M0G7     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1521 : I3MWW1_SPETR        0.39  0.62  125  230    1  102  109    4   10  106  I3MWW1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1522 : I6ULA6_STRCA        0.39  0.69    2  120    2  128  127    3    8  128  I6ULA6     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
 1523 : K7EVW7_PONAB        0.39  0.61  122  231   20  126  113    4    9  130  K7EVW7     Uncharacterized protein OS=Pongo abelii GN=LOC100936031 PE=4 SV=1
 1524 : K7FJB7_PELSI        0.39  0.66  122  218   20  115  100    3    7  118  K7FJB7     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
 1525 : K7TDL0_MOUSE        0.39  0.67    9  120    1  109  114    6    7  109  K7TDL0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1526 : K7U6A8_MOUSE        0.39  0.65    9  119    1  109  114    6    8  110  K7U6A8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1527 : KV118_HUMAN         0.39  0.57  122  229    1  106  109    2    4  108  P01610     Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1
 1528 : KV123_HUMAN 3UPA    0.39  0.62  122  229   23  128  110    4    6  129  P04431     Ig kappa chain V-I region Walker OS=Homo sapiens PE=1 SV=1
 1529 : KV124_HUMAN         0.39  0.62  122  228   23  127  108    2    4  129  P04432     Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1
 1530 : KV125_HUMAN 1WTL    0.39  0.62  122  229    1  106  109    2    4  108  P80362     Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1
 1531 : KV15_RABIT          0.39  0.65  123  231    1  109  110    2    2  110  P01696     Ig kappa chain V region K29-213 OS=Oryctolagus cuniculus PE=1 SV=1
 1532 : KV302_HUMAN         0.39  0.64  122  229    1  107  110    5    5  109  P01620     Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1
 1533 : KV304_HUMAN         0.39  0.62  122  229    1  107  109    3    3  109  P01622     Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1
 1534 : KV306_HUMAN         0.39  0.61  122  229    1  107  110    4    5  109  P01624     Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1
 1535 : KV3A3_MOUSE         0.39  0.61  122  229    1  110  111    3    4  111  P01656     Ig kappa chain V-III region MOPC 70 OS=Mus musculus PE=1 SV=1
 1536 : KV3A4_MOUSE         0.39  0.60  122  229    1  110  111    3    4  111  P03977     Ig kappa chain V-III region 50S10.1 OS=Mus musculus PE=1 SV=1
 1537 : KV402_HUMAN 1QAC    0.39  0.60  122  229    1  112  112    3    4  114  P01625     Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2
 1538 : KV405_HUMAN         0.39  0.58  122  226    1  109  109    3    4  109  P83593     Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1
 1539 : KV6A2_MOUSE         0.39  0.64  122  229    1  105  111    5    9  107  P01676     Ig kappa chain V-VI region XRPC 24 OS=Mus musculus PE=1 SV=1
 1540 : KV6A3_MOUSE         0.39  0.64  122  229    1  105  111    5    9  107  P01677     Ig kappa chain V-VI region TEPC 601/TEPC 191 OS=Mus musculus PE=1 SV=1
 1541 : L5KR22_PTEAL        0.39  0.64  122  231   20  112  110    2   17  120  L5KR22     Ig lambda chain V-I region BL2 OS=Pteropus alecto GN=PAL_GLEAN10000036 PE=4 SV=1
 1542 : L7N0E7_CANFA        0.39  0.63  122  230   24  125  111    5   11  145  L7N0E7     Uncharacterized protein OS=Canis familiaris GN=LOC612180 PE=4 SV=1
 1543 : L8B0S2_PIG          0.39  0.64    1  120   20  146  128    5    9  469  L8B0S2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1544 : LV105_HUMAN         0.39  0.64  122  230    1  102  110    3    9  103  P01703     Ig lambda chain V-I region NEWM OS=Homo sapiens PE=1 SV=1
 1545 : LV701_HUMAN         0.39  0.61  126  231    7  111  109    4    7  111  P01720     Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1
 1546 : M3X370_FELCA        0.39  0.64  124  231    2  109  111    3    6  109  M3X370     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1547 : M3XQ90_MUSPF        0.39  0.62  125  225   23  120  103    4    7  125  M3XQ90     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 1548 : M3XQD9_MUSPF        0.39  0.62    1  111    3  105  114    5   14  115  M3XQD9     Uncharacterized protein (Fragment) OS=Mustela putorius furo PE=4 SV=1
 1549 : Q7Z351_HUMAN3PGF    0.39  0.65    1  120   20  152  134    5   15  482  Q7Z351     Putative uncharacterized protein DKFZp686N02209 OS=Homo sapiens GN=DKFZp686N02209 PE=2 SV=1
 1550 : Q920E6_MOUSE1JGL    0.39  0.57  122  229    1  106  109    2    4  109  Q920E6     Pterin-mimicking anti-idiotope kappa chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
 1551 : Q9JL80_MOUSE        0.39  0.59  129  229    1  102  103    2    3  103  Q9JL80     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1552 : Q9N0W5_RABIT        0.39  0.61  122  229    1  108  111    5    6  109  Q9N0W5     Anti-human A33 light chain variable region (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
 1553 : Q9UL77_HUMAN2BX5    0.39  0.62  122  229    1  106  110    5    6  108  Q9UL77     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
 1554 : R9W2R6_LAMGL        0.39  0.63    1  120    1  121  125    6    9  121  R9W2R6     Anti-F4+ETEC bacteria VHH variable region (Fragment) OS=Lama glama PE=2 SV=1
 1555 : A0N262_MOUSE        0.38  0.63  122  229    2  111  112    4    6  115  A0N262     Vk protein (Fragment) OS=Mus musculus GN=Vk PE=4 SV=1
 1556 : A0N5G5_HUMAN        0.38  0.62  122  229    1  108  111    4    6  118  A0N5G5     Rheumatoid factor D5 light chain (Fragment) OS=Homo sapiens GN=V3 PE=2 SV=1
 1557 : A0N6Q6_9MURI        0.38  0.59  130  229    1  103  103    2    3  104  A0N6Q6     Rheumatoid factor RF3-5A (Fragment) OS=Mus sp. GN=Ig V PE=2 SV=1
 1558 : A0N6R2_9MURI        0.38  0.58  122  229    1  109  111    4    5  109  A0N6R2     Rheumatoid factor RF1-7 (Fragment) OS=Mus sp. GN=Ig V PE=2 SV=1
 1559 : A2KD55_LAMGL        0.38  0.60    1  120    1  125  128    6   11  125  A2KD55     H13 protein (Fragment) OS=Lama glama GN=h13 PE=4 SV=1
 1560 : A2N0T1_HUMAN        0.38  0.60    9  120    1  116  118    4    8  119  A2N0T1     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1561 : A2N494_MOUSE        0.38  0.64  122  229    1  112  113    5    6  114  A2N494     Aberrantly recombined kappa chain Vk8/J1 region (Fragment) OS=Mus musculus PE=4 SV=1
 1562 : A2NMA3_MOUSE        0.38  0.57  122  229    1  106  111    3    8  107  A2NMA3     Anti-carcinoma embryonic antigen light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1563 : A2NW98_HUMAN        0.38  0.58  122  229   21  132  114    6    8  134  A2NW98     Rheumatoid factor light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1564 : B2RYW6_RAT          0.38  0.61  122  231   20  129  113    5    6  129  B2RYW6     Uncharacterized protein OS=Rattus norvegicus PE=2 SV=1
 1565 : B5UB65_MOUSE        0.38  0.64  122  229    1  112  113    5    6  115  B5UB65     CP3-10 light chain variable region (Fragment) OS=Mus musculus GN=CP3-10VL PE=2 SV=1
 1566 : E9PSU8_RAT          0.38  0.60  122  230   20  128  114    6   10  129  E9PSU8     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=2
 1567 : F1P9M6_CANFA        0.38  0.63  122  230    1   99  109    2   10   99  F1P9M6     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=2
 1568 : F6QPM2_MACMU        0.38  0.63  122  231    1  113  114    4    5  116  F6QPM2     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1569 : F6SWM4_MACMU        0.38  0.63  122  218    1  104  105    6    9  104  F6SWM4     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1570 : F6SWN1_MACMU        0.38  0.67  122  224    1   98  103    3    5   99  F6SWN1     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1571 : F6V8B5_CANFA        0.38  0.64  122  231   20  126  112    3    7  136  F6V8B5     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
 1572 : F7AY53_XENTR        0.38  0.65    1  120   25  141  120    3    3  541  F7AY53     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=ighx PE=4 SV=1
 1573 : F7B5N2_XENTR        0.38  0.59  122  229   22  128  111    4    7  130  F7B5N2     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC734128 PE=4 SV=1
 1574 : F7B7I0_ORNAN        0.38  0.64    1  111   46  146  112    4   12  156  F7B7I0     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100079614 PE=4 SV=2
 1575 : F7C5Q8_ORNAN        0.38  0.66  126  223    4   94   98    2    7  109  F7C5Q8     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100681625 PE=4 SV=1
 1576 : F7E332_ORNAN        0.38  0.60  122  224    1  100  106    3    9  111  F7E332     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100087840 PE=4 SV=1
 1577 : F7H150_MACMU        0.38  0.59  122  230    1   99  111    5   14  104  F7H150     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1578 : F7HVA9_CALJA        0.38  0.66  122  226    1  108  108    2    3  109  F7HVA9     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
 1579 : G1M4J5_AILME        0.38  0.65  122  231   20  126  110    2    3  126  G1M4J5     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
 1580 : G1PZ95_MYOLU        0.38  0.65    1  115   20  139  124    5   13  144  G1PZ95     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1581 : G1Q2B0_MYOLU        0.38  0.63    1  116   20  138  126    6   17  142  G1Q2B0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1582 : G1Q8H3_MYOLU        0.38  0.59  122  226   20  135  117    8   13  143  G1Q8H3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1583 : G1Q8T7_MYOLU        0.38  0.61    1  117   20  139  124    7   11  141  G1Q8T7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1584 : G1Q902_MYOLU        0.38  0.61    1  120   20  147  133    7   18  147  G1Q902     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1585 : G1QA48_MYOLU        0.38  0.61  122  226   20  133  115    7   11  140  G1QA48     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1586 : G1QB60_MYOLU        0.38  0.65    1  112   20  137  122    6   14  137  G1QB60     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1587 : G1QCN1_MYOLU        0.38  0.57  125  226    1  105  109    5   11  117  G1QCN1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1588 : G1QE17_MYOLU        0.38  0.64    1  120   20  144  129    6   13  144  G1QE17     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1589 : G1U3T3_RABIT        0.38  0.64  130  231    1   93  102    2    9  102  G1U3T3     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1590 : G1U9A4_RABIT        0.38  0.63  124  225    7  104  103    3    6  104  G1U9A4     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1591 : G3N2D7_BOVIN        0.38  0.64  124  230    1  100  110    4   13  116  G3N2D7     Uncharacterized protein (Fragment) OS=Bos taurus GN=IGLL1 PE=4 SV=1
 1592 : G3RRY1_GORGO        0.38  0.56  125  230    6  101  108    4   14  112  G3RRY1     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1593 : G3TT51_LOXAF        0.38  0.64  122  230   25  132  112    6    7  132  G3TT51     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1594 : G3U9B2_LOXAF        0.38  0.59  122  230   42  140  112    6   16  150  G3U9B2     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1595 : G3UEY9_LOXAF        0.38  0.59  122  230   21  120  111    5   13  129  G3UEY9     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1596 : G3UL35_LOXAF        0.38  0.57  122  230    1   99  110    3   12  117  G3UL35     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1597 : G3UQP7_MELGA        0.38  0.62  124  229    1  102  109    4   10  102  G3UQP7     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100549434 PE=4 SV=1
 1598 : G3VW69_SARHA        0.38  0.59  123  230   22  127  110    5    6  128  G3VW69     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1599 : G7MWV9_MACMU        0.38  0.60    1  120   21  146  129    5   12  600  G7MWV9     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_18625 PE=4 SV=1
 1600 : G8F1K1_MACMU        0.38  0.57  122  230   23  121  111    5   14  125  G8F1K1     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_21317 PE=4 SV=1
 1601 : G8F2W8_MACFA        0.38  0.61  122  231   20  116  110    2   13  117  G8F2W8     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_19666 PE=4 SV=1
 1602 : H0XW50_OTOGA        0.38  0.70  122  225    1  103  104    1    1  114  H0XW50     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1603 : H0Y1Y6_OTOGA        0.38  0.58  125  230    3   98  107    3   12  107  H0Y1Y6     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1604 : H2M8H7_ORYLA        0.38  0.65    4  115    2  119  119    3    8  119  H2M8H7     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1605 : H2P744_PONAB        0.38  0.59  122  231   21  120  112    4   14  126  H2P744     Uncharacterized protein OS=Pongo abelii PE=4 SV=2
 1606 : H9G6T0_ANOCA        0.38  0.66    1  116    1  112  118    3    8  112  H9G6T0     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1607 : H9GU06_ANOCA        0.38  0.69    1  118    1  109  120    5   13  238  H9GU06     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1608 : H9GU12_ANOCA        0.38  0.66  122  221    5  104  103    4    6  104  H9GU12     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1609 : H9KXP6_CALJA        0.38  0.63  122  229    3  110  111    4    6  115  H9KXP6     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=IGLV1-51 PE=4 SV=1
 1610 : HV01_XENLA          0.38  0.65    4  120   21  136  120    4    7  136  P20956     Ig heavy chain V region XIG8 (Fragment) OS=Xenopus laevis PE=2 SV=1
 1611 : HV1A_RABIT          0.38  0.61    4  119    3  116  121    5   12  116  P01826     Ig heavy chain V-A1 region BS-5 OS=Oryctolagus cuniculus PE=1 SV=1
 1612 : HV2A_RABIT          0.38  0.63    4  119    3  114  117    4    6  114  P01827     Ig heavy chain V-A2 region BS-1 OS=Oryctolagus cuniculus PE=1 SV=1
 1613 : HV315_HUMAN         0.38  0.69    1  117    1  117  123    5   12  117  P01776     Ig heavy chain V-III region WAS OS=Homo sapiens PE=1 SV=1
 1614 : HV317_HUMAN         0.38  0.68    1  117    1  116  123    7   13  116  P01778     Ig heavy chain V-III region ZAP OS=Homo sapiens PE=1 SV=1
 1615 : I3IXP0_ORENI        0.38  0.58  122  226   21  130  111    5    7  135  I3IXP0     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1616 : I3JA29_ORENI        0.38  0.65    4  114    2  121  120    3    9  240  I3JA29     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1617 : I3KHR8_ORENI        0.38  0.67    4  115    2  110  114    3    7  241  I3KHR8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1618 : I3KXF3_ORENI        0.38  0.63  122  221    1  101  102    2    3  101  I3KXF3     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1619 : I3LW75_SPETR        0.38  0.58  122  229    3  108  110    4    6  113  I3LW75     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1620 : I3N5X3_SPETR        0.38  0.62  124  227   22  127  112    5   14  131  I3N5X3     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
 1621 : J9P3L5_CANFA        0.38  0.61  122  230   24  125  111    5   11  147  J9P3L5     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
 1622 : J9P9U5_CANFA        0.38  0.66  123  227    2  103  105    1    3  111  J9P9U5     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=1
 1623 : K7EUZ6_PONAB        0.38  0.59  122  230   21  119  111    4   14  131  K7EUZ6     Uncharacterized protein OS=Pongo abelii GN=LOC100939612 PE=4 SV=1
 1624 : K7F561_PELSI        0.38  0.62    1  114    1  119  125    7   17  125  K7F561     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
 1625 : KV03_RABIT          0.38  0.56  122  231    2  109  112    4    6  109  P01684     Ig kappa chain V region 3374 OS=Oryctolagus cuniculus PE=1 SV=1
 1626 : KV04_RABIT          0.38  0.59  122  231    2  107  111    3    6  107  P01685     Ig kappa chain V region 4135 OS=Oryctolagus cuniculus PE=1 SV=1
 1627 : KV105_HUMAN         0.38  0.62  125  229    4  106  106    2    4  108  P01597     Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1
 1628 : KV10_RABIT          0.38  0.57  126  231   11  117  110    4    7  117  P01691     Ig kappa chain V region 12F2 (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1629 : KV119_HUMAN         0.38  0.60  122  229    1  106  109    2    4  108  P01611     Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1
 1630 : KV120_HUMAN         0.38  0.62  122  229    1  107  111    4    7  109  P01612     Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1
 1631 : KV1A1_MOUSE         0.38  0.62  122  229    1  112  112    3    4  114  P01632     Ig kappa chain V-I region S107A OS=Mus musculus PE=4 SV=1
 1632 : KV307_HUMAN         0.38  0.61  122  229    1  107  111    5    7  109  P04206     Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1
 1633 : KV3A1_MOUSE 2OR9    0.38  0.59  122  229    1  110  111    3    4  111  P01654     Ig kappa chain V-III region PC 2880/PC 1229 OS=Mus musculus PE=1 SV=1
 1634 : KV3A2_MOUSE         0.38  0.59  122  229    1  111  112    4    5  112  P01655     Ig kappa chain V-III region PC 7132 OS=Mus musculus PE=1 SV=1
 1635 : KV403_HUMAN         0.38  0.59  122  229   21  131  113    5    7  133  P06313     Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1
 1636 : KV5AF_MOUSE 1JFQ    0.38  0.60  122  229    1  106  110    4    6  108  P01648     Ig kappa chain V-V region HP 91A3 OS=Mus musculus PE=1 SV=1
 1637 : KV5AI_MOUSE         0.38  0.57  122  228    1  105  108    2    4  108  P01651     Ig kappa chain V-V region EPC 109 OS=Mus musculus PE=1 SV=1
 1638 : KV6A5_MOUSE 2FBJ    0.38  0.61  122  229    1  105  111    5    9  107  P01679     Ig kappa chain V-VI region J539 OS=Mus musculus PE=1 SV=1
 1639 : L7N0J0_CANFA        0.38  0.60  122  230   24  126  113    4   14  141  L7N0J0     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
 1640 : L7N1D1_MYOLU        0.38  0.63  122  218    1  104  105    5    9  104  L7N1D1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1641 : L8AXK3_PIG          0.38  0.67    1  120   20  143  128    6   12  471  L8AXK3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1642 : L8B0W4_PIG          0.38  0.66    1  120   20  153  134    5   14  481  L8B0W4     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1643 : L8B0Y0_PIG          0.38  0.62    1  119   20  142  128    7   14  471  L8B0Y0     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1644 : L8B139_PIG          0.38  0.68    1  120   20  137  122    5    6  465  L8B139     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1645 : M0R845_RAT          0.38  0.61    1  110    1  107  112    3    7  117  M0R845     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 1646 : M3XFS5_FELCA        0.38  0.60  122  230   16  112  110    4   14  116  M3XFS5     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1647 : M3YMK4_MUSPF        0.38  0.62  122  226   20  135  117    8   13  140  M3YMK4     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 1648 : M9MMM3_PONAB        0.38  0.60  122  229   21  123  110    4    9  123  M9MMM3     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1649 : Q5FW04_XENTR        0.38  0.64    1  120   26  140  121    5    7  555  Q5FW04     Ighx protein (Fragment) OS=Xenopus tropicalis GN=ighx PE=2 SV=1
 1650 : Q5FW13_XENTR        0.38  0.59    1  120   29  143  124    6   13  594  Q5FW13     LOC548369 protein (Fragment) OS=Xenopus tropicalis GN=LOC548369 PE=2 SV=1
 1651 : Q9UL74_HUMAN        0.38  0.55   10  120    1  118  120    6   11  118  Q9UL74     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1652 : A0N5U0_9MURI        0.37  0.70    1  120    1  119  123    4    7  119  A0N5U0     Anti-hepatitis B virus core antigen MoAb 14B8 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
 1653 : A1L2N8_XENLA        0.37  0.63    1  120   24  140  124    4   11  588  A1L2N8     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
 1654 : A2JA19_HUMAN        0.37  0.61  122  229    1  106  110    4    6  107  A2JA19     Anti-mucin1 light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1655 : A2N0S7_HUMAN        0.37  0.58    9  120    1  117  121    5   13  120  A2N0S7     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1656 : A2N0T2_HUMAN        0.37  0.58   13  120    1  113  116    6   11  116  A2N0T2     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1657 : A2N1N1_MOUSE        0.37  0.58  122  229   20  131  113    4    6  134  A2N1N1     B cell antigen receptor (Precursor) OS=Mus musculus PE=4 SV=1
 1658 : A2NB45_HUMAN        0.37  0.59  122  229    1  111  111    3    3  113  A2NB45     Cold agglutinin FS-1 L-chain (Fragment) OS=Homo sapiens PE=2 SV=1
 1659 : A2P2H7_SHEEP        0.37  0.66    1  120   20  139  123    5    6  139  A2P2H7     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1660 : B5DC71_MOUSE        0.37  0.71    1  120    1  118  123    5    8  118  B5DC71     Variable domain of Fab 54-5C10-A heavy chain (Fragment) OS=Mus musculus GN=Na PE=2 SV=1
 1661 : B5UB63_MOUSE        0.37  0.64  122  229    1  112  113    5    6  115  B5UB63     CP1-10 light chain variable region (Fragment) OS=Mus musculus GN=CP1-10VL PE=2 SV=1
 1662 : D3ZPL2_RAT          0.37  0.58  122  229   20  122  111    6   11  123  D3ZPL2     Uncharacterized protein OS=Rattus norvegicus PE=2 SV=2
 1663 : D3ZXZ8_RAT          0.37  0.64    7  116    1  102  112    4   12  106  D3ZXZ8     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1664 : F1LWD0_RAT          0.37  0.64    1  116    1  118  121    4    8  123  F1LWD0     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 1665 : F1LYU4_RAT          0.37  0.61  122  227    1  107  108    3    3  107  F1LYU4     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1666 : F1M1Q7_RAT          0.37  0.55  122  230   27  131  115    6   16  140  F1M1Q7     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1667 : F6QQH0_MACMU        0.37  0.64  122  231    1   97  110    2   13   99  F6QQH0     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1668 : F6RAZ5_XENTR        0.37  0.62    1  120   29  140  120    4    8  171  F6RAZ5     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1669 : F6S1P2_MACMU        0.37  0.59  122  230    1   99  111    5   14  108  F6S1P2     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1670 : F6SWN9_MACMU        0.37  0.65  122  231    1   97  110    2   13   99  F6SWN9     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1671 : F6SWP6_MACMU        0.37  0.60  122  218    1  104  105    7    9  104  F6SWP6     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1672 : F6TG26_XENTR        0.37  0.57  122  230    1  106  110    3    5  107  F6TG26     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1673 : F6VC90_HORSE        0.37  0.58  122  230    1   99  111    4   14  100  F6VC90     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
 1674 : F7A8G3_MACMU        0.37  0.58  122  230    1   99  111    4   14  108  F7A8G3     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1675 : F7CV00_XENTR        0.37  0.57    4  120    1  122  125    5   11  185  F7CV00     Uncharacterized protein OS=Xenopus tropicalis PE=4 SV=1
 1676 : F7CW73_XENTR        0.37  0.63    4  111    4  117  116    5   10  125  F7CW73     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1677 : F7F0D6_MACMU        0.37  0.60    1  120    4  133  132    6   14  466  F7F0D6     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=2 SV=1
 1678 : G1MJV9_AILME        0.37  0.63  127  230    1  102  105    3    4  102  G1MJV9     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1679 : G1N5U4_MELGA        0.37  0.59  122  229    4   98  109    3   15   98  G1N5U4     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100549434 PE=4 SV=2
 1680 : G1PYJ5_MYOLU        0.37  0.63    1  120   20  146  131    6   15  146  G1PYJ5     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1681 : G1PYU2_MYOLU        0.37  0.63  125  231    1  102  107    3    5  117  G1PYU2     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1682 : G1Q638_MYOLU        0.37  0.62  125  224    3  102  104    5    8  109  G1Q638     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1683 : G1Q967_MYOLU        0.37  0.55  122  230   20  128  121   12   24  151  G1Q967     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1684 : G1QBE8_MYOLU        0.37  0.61    1  119   20  143  129    6   15  143  G1QBE8     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1685 : G1TGU6_RABIT        0.37  0.65  122  225    5  104  105    3    6  104  G1TGU6     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1686 : G1TJZ2_RABIT        0.37  0.60  122  230    1  103  113    5   14  116  G1TJZ2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1687 : G1U8X8_RABIT        0.37  0.62  122  229    1  110  111    4    4  111  G1U8X8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1688 : G3N3Q3_BOVIN        0.37  0.62    1  112   20  137  123    7   16  146  G3N3Q3     Uncharacterized protein OS=Bos taurus PE=4 SV=1
 1689 : G3RTZ2_GORGO        0.37  0.56  122  230   30  134  115    6   16  136  G3RTZ2     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1690 : G3SC60_GORGO        0.37  0.54  123  230    1  102  114    5   18  109  G3SC60     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101146301 PE=4 SV=1
 1691 : G3TWP2_LOXAF        0.37  0.60  122  230   25  124  112    6   15  133  G3TWP2     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1692 : G3TY39_LOXAF        0.37  0.61  122  230   21  119  111    5   14  129  G3TY39     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1693 : G3U4L9_LOXAF        0.37  0.56  122  230   21  119  111    5   14  128  G3U4L9     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1694 : G3UFY9_LOXAF        0.37  0.59  122  230   25  129  115    6   16  138  G3UFY9     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1695 : G7PHC3_MACFA        0.37  0.62  122  230   20  122  112    5   12  122  G7PHC3     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_02491 PE=4 SV=1
 1696 : H0VCV9_CAVPO        0.37  0.56  122  230    1  105  114    5   14  115  H0VCV9     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
 1697 : H0WLF1_OTOGA        0.37  0.62  122  230    1  103  113    4   14  111  H0WLF1     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=IGLV6-57 PE=4 SV=1
 1698 : H0XS78_OTOGA        0.37  0.60  122  230    1   97  109    1   12  100  H0XS78     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1699 : H2P3Q5_PONAB        0.37  0.59  122  229   20  120  112    5   15  128  H2P3Q5     Uncharacterized protein OS=Pongo abelii GN=IGLV10-54 PE=4 SV=2
 1700 : H2P5H6_PONAB        0.37  0.61  123  225    2   97  104    5    9   97  H2P5H6     Uncharacterized protein (Fragment) OS=Pongo abelii PE=4 SV=1
 1701 : H2SD51_TAKRU        0.37  0.59  122  229   21  133  116    4   11  135  H2SD51     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1702 : H3A7X1_LATCH        0.37  0.61  122  227   21  126  111    6   10  133  H3A7X1     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=2
 1703 : H9G6W5_ANOCA        0.37  0.62    1  111   20  133  117    4    9  147  H9G6W5     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=1
 1704 : I3KCG8_ORENI        0.37  0.61    4  116    4  107  113    2    9  231  I3KCG8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1705 : I3M2D8_SPETR        0.37  0.62  122  226    1   99  107    5   10  111  I3M2D8     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1706 : I3MM99_SPETR        0.37  0.60  122  231   21  128  113    6    8  130  I3MM99     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
 1707 : I3MNL0_SPETR        0.37  0.62  122  231   20  116  110    2   13  117  I3MNL0     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
 1708 : I3MV34_SPETR        0.37  0.61  125  231    4  103  109    4   11  109  I3MV34     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1709 : I3MVU9_SPETR        0.37  0.55  122  231   21  123  112    5   11  129  I3MVU9     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
 1710 : I3N0C1_SPETR        0.37  0.63  122  231    1  116  117    5    8  116  I3N0C1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1711 : I3N2Y3_SPETR        0.37  0.64  124  225    3   99  105    4   11  121  I3N2Y3     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1712 : I3N872_SPETR        0.37  0.56  122  230    1   99  111    4   14  108  I3N872     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1713 : I3NCJ7_SPETR        0.37  0.65  122  230    1  103  111    4   10  116  I3NCJ7     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1714 : I3NFX5_SPETR        0.37  0.55  122  229    1   98  110    4   14  108  I3NFX5     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1715 : J9P5N4_CANFA        0.37  0.60  122  212    1   97   98    4    8  104  J9P5N4     Uncharacterized protein (Fragment) OS=Canis familiaris GN=IGLV11-55 PE=4 SV=1
 1716 : K7ETY1_PONAB        0.37  0.56  122  230   23  121  111    5   14  125  K7ETY1     Uncharacterized protein OS=Pongo abelii GN=IGKV1D-43 PE=4 SV=1
 1717 : KV103_HUMAN         0.37  0.60  122  229    1  106  109    3    4  108  P01595     Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1
 1718 : KV108_HUMAN 1F6L    0.37  0.62  122  229    1  106  109    2    4  108  P01600     Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1
 1719 : KV113_HUMAN         0.37  0.58  122  229    1  106  110    4    6  108  P01605     Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1
 1720 : KV3A5_MOUSE         0.37  0.58  122  229    1  110  110    2    2  111  P01657     Ig kappa chain V-III region PC 2413 OS=Mus musculus PE=1 SV=1
 1721 : KV3AI_MOUSE         0.37  0.59  122  229    1  110  111    4    4  111  P01670     Ig kappa chain V-III region PC 6684 OS=Mus musculus PE=1 SV=1
 1722 : KV3AK_MOUSE         0.37  0.57  122  229    1  110  112    5    6  111  P01672     Ig kappa chain V-III region PC 7940 OS=Mus musculus PE=1 SV=1
 1723 : KV404_HUMAN         0.37  0.59  122  229   21  132  113    4    6  134  P06314     Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1
 1724 : KVM5_MOUSE          0.37  0.60  122  229    1  106  109    3    4  121  P84750     Ig kappa chain V region Mem5 (Fragment) OS=Mus musculus PE=1 SV=1
 1725 : L5M9E9_MYODS        0.37  0.58  125  231   23  124  112    6   15  134  L5M9E9     Ig lambda chain V-I region BL2 OS=Myotis davidii GN=MDA_GLEAN10000944 PE=4 SV=1
 1726 : L5MAA2_MYODS        0.37  0.55  125  231   23  124  112    6   15  134  L5MAA2     Ig lambda chain V-I region BL2 OS=Myotis davidii GN=MDA_GLEAN10000947 PE=4 SV=1
 1727 : L7N1S7_MYOLU        0.37  0.62    1  116    1  108  118    5   12  113  L7N1S7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1728 : L7N2Q3_XENTR        0.37  0.58  122  228   17  118  109    5    9  119  L7N2Q3     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1729 : L7N2R1_XENTR        0.37  0.65    1  120   34  155  124    4    6  634  L7N2R1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=ighx PE=4 SV=1
 1730 : L8B157_PIG          0.37  0.61    1  120   20  146  130    4   13  474  L8B157     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
 1731 : L8HN17_BOSMU        0.37  0.66  122  230   20  121  112    4   13  121  L8HN17     Uncharacterized protein OS=Bos grunniens mutus GN=M91_19951 PE=4 SV=1
 1732 : M3X891_FELCA        0.37  0.62  122  227    1  105  106    1    1  117  M3X891     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1733 : M3XR08_MUSPF        0.37  0.59  122  230   20  120  111    6   12  146  M3XR08     Uncharacterized protein OS=Mustela putorius furo GN=IGLV10-54 PE=4 SV=1
 1734 : M3YD93_MUSPF        0.37  0.57  122  230   21  119  111    5   14  121  M3YD93     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 1735 : M3YDH7_MUSPF        0.37  0.56  122  230   34  138  115    6   16  157  M3YDH7     Uncharacterized protein OS=Mustela putorius furo GN=IGKV4-1 PE=4 SV=1
 1736 : M7B658_CHEMY        0.37  0.58  125  231    1  100  111    5   15  116  M7B658     Ig kappa chain V-I region Walker OS=Chelonia mydas GN=UY3_10239 PE=4 SV=1
 1737 : M7BAM3_CHEMY        0.37  0.58  122  230    1   99  110    3   12  107  M7BAM3     Ig kappa chain V-III region VG (Fragment) OS=Chelonia mydas GN=UY3_10240 PE=4 SV=1
 1738 : Q5NV69_HUMAN        0.37  0.63  122  231    1   98  110    1   12  100  Q5NV69     V1-13 protein (Fragment) OS=Homo sapiens GN=IGLV1-40 PE=4 SV=1
 1739 : Q5NV82_HUMAN        0.37  0.62  122  218    1  104  105    5    9  104  Q5NV82     V4-2 protein (Fragment) OS=Homo sapiens GN=IGLV5-45 PE=1 SV=1
 1740 : Q63ZL4_XENLA        0.37  0.58  122  231   20  135  121    9   16  240  Q63ZL4     LOC594871 protein OS=Xenopus laevis GN=LOC594871 PE=2 SV=1
 1741 : Q65ZN3_MOUSE        0.37  0.58  122  229    1  111  111    3    3  111  Q65ZN3     Rheumatoid factor RF10-2 (Fragment) OS=Mus musculus GN=Ig Vkappa PE=2 SV=1
 1742 : Q6IR66_XENLA        0.37  0.60    1  120   24  135  121    4   10  588  Q6IR66     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
 1743 : Q6N097_HUMAN        0.37  0.66    1  118   20  149  130    3   12  481  Q6N097     Putative uncharacterized protein DKFZp686H20196 OS=Homo sapiens GN=DKFZp686H20196 PE=2 SV=1
 1744 : Q7T0R1_XENLA        0.37  0.60    1  120   20  134  123    6   11  587  Q7T0R1     MGC69066 protein OS=Xenopus laevis PE=2 SV=1
 1745 : Q8VIJ0_MOUSE        0.37  0.60  122  229    1  106  109    2    4  108  Q8VIJ0     Anti-DNA light chain (Fragment) OS=Mus musculus GN=Igkv6-14 PE=2 SV=1
 1746 : Q920E9_MOUSE        0.37  0.58  122  229    1  110  110    2    2  111  Q920E9     Pterin-mimicking anti-idiotope kappa chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
 1747 : Q9UL96_HUMAN        0.37  0.66    1  120    1  121  125    5    9  121  Q9UL96     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1748 : A0N588_9MURI        0.36  0.57  122  229   21  130  111    4    4  131  A0N588     Anti-CD4 mAb M-T310 variable region light chain (Fragment) OS=Mus sp. GN=Ig VL PE=2 SV=1
 1749 : A0N5G1_HUMAN        0.36  0.60  122  229    1  106  109    2    4  116  A0N5G1     Rheumatoid factor C6 light chain (Fragment) OS=Homo sapiens GN=V1 PE=2 SV=1
 1750 : A2MYC9_HUMAN        0.36  0.59  122  218    1  104  105    7    9  104  A2MYC9     V4-3 protein (Fragment) OS=Homo sapiens GN=V4-3 PE=4 SV=1
 1751 : A2MYD0_HUMAN        0.36  0.63  122  231    1   97  110    2   13   99  A2MYD0     V1-17 protein (Fragment) OS=Homo sapiens GN=V1-17 PE=4 SV=1
 1752 : A9UMG6_XENTR        0.36  0.65    1  120   34  156  127    7   11  634  A9UMG6     LOC100135349 protein (Fragment) OS=Xenopus tropicalis GN=LOC100135349 PE=2 SV=1
 1753 : B6ZLM4_9ZZZZ        0.36  0.67    1  120    1  117  123    4    9  239  B6ZLM4     Anti-plumbagin single-chain variable antibody (Fragment) OS=synthetic construct GN=PL-scFv PE=4 SV=1
 1754 : D2I8F3_AILME        0.36  0.62  122  230   20  117  109    2   11  117  D2I8F3     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_022357 PE=4 SV=1
 1755 : F1M8N5_RAT          0.36  0.58  122  227    1  104  108    4    6  108  F1M8N5     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1756 : F6SD50_MACMU        0.36  0.54  122  230    1   99  111    4   14  108  F6SD50     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1757 : F6WAM6_MACMU        0.36  0.64  122  231    1  114  115    4    6  117  F6WAM6     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1758 : F6XJR1_XENTR        0.36  0.59  122  229    1  106  109    2    4  116  F6XJR1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1759 : F7FBN9_MONDO        0.36  0.58  122  230   22  125  113    5   13  135  F7FBN9     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618490 PE=4 SV=1
 1760 : G1Q6Q9_MYOLU        0.36  0.57  125  224    1  105  109    6   13  109  G1Q6Q9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1761 : G1QD96_MYOLU        0.36  0.65    1  120   20  136  124    5   11  139  G1QD96     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1762 : G1TLA0_RABIT        0.36  0.55  126  230    5  103  108    4   12  104  G1TLA0     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1763 : G1TUQ2_RABIT        0.36  0.60  123  230   22  131  113    5    8  131  G1TUQ2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1764 : G1U4I8_RABIT        0.36  0.63    4  116    3  110  115    4    9  110  G1U4I8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1765 : G1U533_RABIT        0.36  0.62    6  116   24  129  114    6   11  129  G1U533     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100009097 PE=4 SV=1
 1766 : G3RT85_GORGO        0.36  0.60  122  230    1   99  110    4   12  108  G3RT85     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1767 : G3S5I9_GORGO        0.36  0.55  123  230    1   98  110    4   14  108  G3S5I9     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101126705 PE=4 SV=1
 1768 : G3SEI0_GORGO        0.36  0.58  122  230    1   99  111    5   14  109  G3SEI0     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1769 : G3TSL1_LOXAF        0.36  0.56  122  230    1   99  111    4   14  109  G3TSL1     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1770 : G3U8G9_LOXAF        0.36  0.65    1  120    1  116  124    6   12  116  G3U8G9     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1771 : G3UDE8_LOXAF        0.36  0.57  122  230    1  105  114    5   14  114  G3UDE8     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1772 : G3UDL4_LOXAF        0.36  0.63    1  117    1  120  126    7   15  124  G3UDL4     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1773 : G3VBE5_SARHA        0.36  0.57  123  230   22  119  111    7   16  129  G3VBE5     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1774 : G3VBT9_SARHA        0.36  0.57  123  230    2   99  110    4   14  109  G3VBT9     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
 1775 : G3VFK3_SARHA        0.36  0.64  124  225    3  100  104    4    8  101  G3VFK3     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
 1776 : G3VJT2_SARHA        0.36  0.61  122  231    1  107  112    4    7  115  G3VJT2     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
 1777 : G7NAZ4_MACMU        0.36  0.54  122  230    1   99  111    4   14  108  G7NAZ4     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_05707 PE=4 SV=1
 1778 : G7PMP5_MACFA        0.36  0.58  122  230   23  121  111    5   14  125  G7PMP5     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_05005 PE=4 SV=1
 1779 : H2P5I2_PONAB        0.36  0.57  122  230   23  121  111    5   14  125  H2P5I2     Uncharacterized protein OS=Pongo abelii PE=4 SV=2
 1780 : H2P764_PONAB        0.36  0.54  122  230   23  121  111    5   14  125  H2P764     Uncharacterized protein OS=Pongo abelii PE=4 SV=2
 1781 : H2S0K4_TAKRU        0.36  0.58  122  225   20  126  112    4   13  126  H2S0K4     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1782 : H2S0K5_TAKRU        0.36  0.55  122  225    1   98  105    4    8   98  H2S0K5     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1783 : H3A2G9_LATCH        0.36  0.60  122  230    1   99  110    3   12  108  H3A2G9     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
 1784 : H9G6M9_ANOCA        0.36  0.65  122  222    5  105  104    5    6  105  H9G6M9     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1785 : H9H5F5_MACMU        0.36  0.62  122  229    5  108  110    5    8  112  H9H5F5     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1786 : H9KXD8_CALJA        0.36  0.53  122  230    1   99  111    4   14  109  H9KXD8     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
 1787 : HV2C_RABIT          0.36  0.61    6  120   24  136  118    3    8  136  P01829     Ig heavy chain V-A2 region P-MU-3 OS=Oryctolagus cuniculus PE=4 SV=1
 1788 : I3JAH1_ORENI        0.36  0.63    4  120    2  115  123    4   15  221  I3JAH1     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1789 : I3JIV3_ORENI        0.36  0.59  122  229    1  105  109    3    5  107  I3JIV3     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1790 : I3N1X3_SPETR        0.36  0.62  124  231    3  107  112    5   11  107  I3N1X3     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1791 : IGW3_HETFR          0.36  0.60    1  120    1  115  122    5    9  118  P83907     IgW heavy chain V region W26 (Fragment) OS=Heterodontus francisci PE=2 SV=1
 1792 : K7ET52_PONAB        0.36  0.53  122  230   21  123  118    6   24  135  K7ET52     Uncharacterized protein OS=Pongo abelii GN=IGLV4-60 PE=4 SV=1
 1793 : KV02_RABIT          0.36  0.60  122  231    2  115  115    4    6  115  P01683     Ig kappa chain V region 3315 OS=Oryctolagus cuniculus PE=1 SV=1
 1794 : KV06_RABIT          0.36  0.55  122  231    1  108  112    4    6  108  P01687     Ig kappa chain V region BS-5 OS=Oryctolagus cuniculus PE=1 SV=1
 1795 : KV08_RABIT          0.36  0.57  125  231    4  108  108    2    4  108  P01689     Ig kappa chain V region 120 OS=Oryctolagus cuniculus PE=1 SV=1
 1796 : KV101_HUMAN         0.36  0.60  122  229    1  106  110    4    6  108  P01593     Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1
 1797 : KV102_HUMAN 1QP1    0.36  0.61  122  229    1  106  109    2    4  108  P01594     Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1
 1798 : KV107_HUMAN         0.36  0.58  122  229    1  106  110    5    6  108  P01599     Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1
 1799 : KV115_HUMAN 1REI    0.36  0.58  122  229    1  106  111    3    8  108  P01607     Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1
 1800 : KV116_HUMAN         0.36  0.62  122  228    1  105  108    2    4  108  P01608     Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1
 1801 : KV13_RABIT          0.36  0.61  126  231    5  110  109    5    6  110  P01694     Ig kappa chain V region 3547 OS=Oryctolagus cuniculus PE=1 SV=1
 1802 : KV201_HUMAN         0.36  0.55  122  229    2  113  112    3    4  115  P01614     Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1
 1803 : KV204_HUMAN         0.36  0.59  122  229    1  111  111    3    3  113  P01617     Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1
 1804 : KV205_HUMAN         0.36  0.58  122  229    5  115  111    3    3  117  P06309     Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1
 1805 : KV2A6_MOUSE         0.36  0.59  122  229    1  111  111    3    3  113  P01630     Ig kappa chain V-II region 7S34.1 OS=Mus musculus PE=1 SV=1
 1806 : KV2A7_MOUSE 2VQ1    0.36  0.56  122  229    1  111  112    5    5  113  P01631     Ig kappa chain V-II region 26-10 OS=Mus musculus PE=1 SV=1
 1807 : KV301_HUMAN         0.36  0.63  122  229    1  107  109    3    3  108  P01619     Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1
 1808 : KV3A9_MOUSE 1EGJ    0.36  0.58  122  229   21  130  113    6    8  131  P01661     Ig kappa chain V-III region MOPC 63 OS=Mus musculus PE=1 SV=1
 1809 : KV3AA_MOUSE         0.36  0.59  122  229    1  110  111    3    4  111  P01662     Ig kappa chain V-III region ABPC 22/PC 9245 OS=Mus musculus PE=1 SV=1
 1810 : KV3AB_MOUSE 1ACY    0.36  0.59  122  229    1  110  111    3    4  111  P01663     Ig kappa chain V-III region PC 4050 OS=Mus musculus PE=1 SV=1
 1811 : KV3AC_MOUSE         0.36  0.59  122  229    1  110  110    2    2  111  P01664     Ig kappa chain V-III region CBPC 101 OS=Mus musculus PE=1 SV=1
 1812 : KV3AE_MOUSE 1F58    0.36  0.59  122  229    1  110  110    2    2  111  P01666     Ig kappa chain V-III region PC 7183 OS=Mus musculus PE=1 SV=1
 1813 : L7N2N8_XENTR        0.36  0.55  122  230    1  107  113    5   10  108  L7N2N8     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1814 : M0R5U0_RAT          0.36  0.58  122  229   21  133  115    7    9  134  M0R5U0     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
 1815 : M3WVJ0_FELCA        0.36  0.60  122  230    2   98  110    4   14  102  M3WVJ0     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1816 : M3X0T7_FELCA        0.36  0.64  124  231    3  111  113    4    9  111  M3X0T7     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1817 : M3X7R1_FELCA        0.36  0.58  122  230   16  124  118    9   18  142  M3X7R1     Uncharacterized protein (Fragment) OS=Felis catus GN=IGLV5-52 PE=4 SV=1
 1818 : Q58E08_XENLA        0.36  0.55  122  231   10  126  121    9   15  231  Q58E08     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
 1819 : Q6GN83_XENLA        0.36  0.66    1  120   31  152  127    6   12  605  Q6GN83     MGC69066 protein (Fragment) OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
 1820 : Q811U6_MOUSE        0.36  0.57  123  229    1  109  109    2    2  111  Q811U6     Anti-human Fc gamma receptor III 3G8 kappa light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1821 : Q96SB0_HUMAN        0.36  0.61  122  231    1   97  110    2   13  108  Q96SB0     Anti-streptococcal/anti-myosin immunoglobulin lambda light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1822 : Q9JL84_MOUSE        0.36  0.54  122  229    1  106  109    3    4  107  Q9JL84     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1823 : A0N7D1_9MURI        0.35  0.60  122  229    1  110  112    5    6  115  A0N7D1     SD6 Fab kappa light chain variable region (Fragment) OS=Mus sp. GN=Ig PE=4 SV=1
 1824 : A2IPI1_HUMAN        0.35  0.58  122  229    3  113  112    4    5  118  A2IPI1     HRV Fab N8-VL (Fragment) OS=Homo sapiens PE=2 SV=1
 1825 : A2N0T3_HUMAN        0.35  0.55    9  120    1  112  117    6   10  115  A2N0T3     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1826 : B5DC72_MOUSE        0.35  0.58  122  229    1  111  111    3    3  114  B5DC72     Variable domain of Fab 54-5C10-A light chain (Fragment) OS=Mus musculus GN=Na PE=2 SV=1
 1827 : B5UB61_MOUSE        0.35  0.62  122  229    1  112  113    5    6  115  B5UB61     CP1-5 light chain variable region (Fragment) OS=Mus musculus GN=CP1-5VL PE=2 SV=1
 1828 : E2QXH1_CANFA        0.35  0.62  122  226    3  110  110    4    7  120  E2QXH1     Uncharacterized protein (Fragment) OS=Canis familiaris GN=IGKV4-1 PE=4 SV=2
 1829 : F1LWW1_RAT          0.35  0.55  122  230   21  121  112    7   14  121  F1LWW1     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1830 : F1M195_RAT          0.35  0.53  123  230    2  105  113    5   14  118  F1M195     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1831 : F1M279_RAT          0.35  0.57  122  228    1  102  109    6    9  108  F1M279     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=2 SV=2
 1832 : F1M6G9_RAT          0.35  0.58  122  230   20  132  113    4    4  132  F1M6G9     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1833 : F1M7I8_RAT          0.35  0.53  122  230   21  122  113    5   15  124  F1M7I8     Protein RGD1565617 OS=Rattus norvegicus GN=RGD1565617 PE=4 SV=2
 1834 : F1Q171_CANFA        0.35  0.55  122  231    1   97  112    3   17   97  F1Q171     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=2
 1835 : F1STC2_PIG          0.35  0.57  123  231   22  133  113    5    5  133  F1STC2     Uncharacterized protein OS=Sus scrofa GN=LOC100625243 PE=4 SV=1
 1836 : F6T8V0_MONDO        0.35  0.53  122  223    1  103  106    3    7  111  F6T8V0     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
 1837 : F6VJF6_ORNAN        0.35  0.62  123  224    2  103  109    6   14  103  F6VJF6     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100681575 PE=4 SV=1
 1838 : F6W517_ORNAN        0.35  0.58    4  113    2  110  113    2    7  117  F6W517     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1839 : F7E066_ORNAN        0.35  0.62    1  112    1  113  119    6   13  115  F7E066     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1840 : F7E8D4_CALJA        0.35  0.54  122  228    1  106  111    6    9  108  F7E8D4     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=IGKV4-1 PE=4 SV=1
 1841 : G1MLW9_AILME        0.35  0.62  122  231    1   99  110    2   11  107  G1MLW9     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1842 : G1MMW9_AILME        0.35  0.57  122  231    1  112  115    3    8  112  G1MMW9     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1843 : G1THE8_RABIT        0.35  0.60  122  224    1  101  105    4    6  110  G1THE8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1844 : G1TNC5_RABIT        0.35  0.59  124  231    3  106  109    3    6  108  G1TNC5     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1845 : G1TQT9_RABIT        0.35  0.65    4  112    3  111  113    4    8  111  G1TQT9     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1846 : G3IKK1_CRIGR        0.35  0.55  122  231   21  123  114    5   15  123  G3IKK1     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024404 PE=4 SV=1
 1847 : G3QD17_GORGO        0.35  0.54  122  231    1  100  112    4   14  100  G3QD17     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=IGKV1D-13 PE=4 SV=1
 1848 : G3RTN7_GORGO        0.35  0.63  122  214    1   99  100    4    8  104  G3RTN7     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101150602 PE=4 SV=1
 1849 : G3SBG7_GORGO        0.35  0.56  122  230   21  119  111    5   14  127  G3SBG7     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1850 : G3TSH6_LOXAF        0.35  0.55  122  230   21  133  113    4    4  133  G3TSH6     Uncharacterized protein OS=Loxodonta africana GN=LOC100673803 PE=4 SV=1
 1851 : G3UBU6_LOXAF        0.35  0.59  125  231    6  111  110    4    7  111  G3UBU6     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1852 : G3UIN4_LOXAF        0.35  0.57  122  229    1  104  113    5   14  115  G3UIN4     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1853 : G3VAS4_SARHA        0.35  0.57  123  231    2   97  110    4   15  110  G3VAS4     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
 1854 : G3VQQ7_SARHA        0.35  0.52  123  230   22  119  113    6   20  129  G3VQQ7     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1855 : H0W120_CAVPO        0.35  0.54  122  230   20  134  119   10   14  135  H0W120     Uncharacterized protein OS=Cavia porcellus GN=LOC100718439 PE=4 SV=1
 1856 : H0W5L9_CAVPO        0.35  0.56  122  231   20  139  125   11   20  244  H0W5L9     Uncharacterized protein OS=Cavia porcellus GN=LOC100735142 PE=4 SV=1
 1857 : H0X621_OTOGA        0.35  0.55  123  230    1   98  110    5   14  100  H0X621     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1858 : H0XNP9_OTOGA        0.35  0.56  122  231    1  103  112    4   11  108  H0XNP9     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1859 : H2S0K3_TAKRU        0.35  0.58  122  226   21  128  113    4   13  138  H2S0K3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1860 : H9GUC5_ANOCA        0.35  0.63  122  221    5  102  103    4    8  102  H9GUC5     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1861 : H9GUI0_ANOCA        0.35  0.56  122  225   10  118  114   10   15  118  H9GUI0     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=2
 1862 : H9H4U1_MACMU        0.35  0.62  125  230    3  107  109    3    7  111  H9H4U1     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1863 : HV202_HUMAN         0.35  0.62    1  120    1  120  129    6   18  120  P01815     Ig heavy chain V-II region COR OS=Homo sapiens PE=1 SV=1
 1864 : I3IXP2_ORENI        0.35  0.58  122  229   23  135  116    5   11  136  I3IXP2     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1865 : I3IXP4_ORENI        0.35  0.58  122  231   23  132  117    8   14  134  I3IXP4     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1866 : I3KZ78_ORENI        0.35  0.61  122  226    1  103  107    4    6  103  I3KZ78     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1867 : I3M8P5_SPETR        0.35  0.58  122  230    1  112  115    5    9  113  I3M8P5     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1868 : I3MVD1_SPETR        0.35  0.55  122  229    1   98  110    4   14  109  I3MVD1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1869 : K7ETL4_PONAB        0.35  0.55  122  230   23  121  111    5   14  133  K7ETL4     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1870 : K7ETN1_PONAB        0.35  0.57  122  230   23  121  111    5   14  125  K7ETN1     Uncharacterized protein OS=Pongo abelii GN=IGKV1-27 PE=4 SV=1
 1871 : K7EVP5_PONAB        0.35  0.55  122  230   23  121  111    5   14  133  K7EVP5     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1872 : K7EVX7_PONAB        0.35  0.56  122  230   23  121  111    5   14  123  K7EVX7     Uncharacterized protein OS=Pongo abelii GN=LOC100939951 PE=4 SV=1
 1873 : K7FWW0_PELSI        0.35  0.61  122  230   21  132  113    5    5  133  K7FWW0     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
 1874 : KV01_RABIT          0.35  0.63  124  231    3  110  110    4    4  110  P01682     Ig kappa chain V region 2717 OS=Oryctolagus cuniculus PE=1 SV=1
 1875 : KV05_RABIT          0.35  0.56  122  231    1  108  112    5    6  108  P01686     Ig kappa chain V region BS-1 OS=Oryctolagus cuniculus PE=1 SV=1
 1876 : KV112_HUMAN         0.35  0.53  122  229    1  106  109    2    4  108  P01604     Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1
 1877 : KV122_HUMAN         0.35  0.57  122  229    1  106  110    3    6  108  P04430     Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1
 1878 : KV12_RABIT          0.35  0.61  122  229    2  110  112    4    7  111  P01693     Ig kappa chain V region 3368 OS=Oryctolagus cuniculus PE=1 SV=1
 1879 : KV14_RABIT          0.35  0.63  124  229    3  108  108    4    4  109  P01695     Ig kappa chain V region K16-167 OS=Oryctolagus cuniculus PE=1 SV=1
 1880 : KV1_CANFA           0.35  0.57  122  229    1  106  110    3    6  108  P01618     Ig kappa chain V region GOM OS=Canis familiaris PE=1 SV=1
 1881 : KV203_HUMAN         0.35  0.58  122  229    1  110  110    2    2  112  P01616     Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1
 1882 : KV2A3_MOUSE         0.35  0.58  122  229    1  111  111    3    3  113  P01628     Ig kappa chain V-II region MOPC 511 OS=Mus musculus PE=1 SV=1
 1883 : KV2A4_MOUSE         0.35  0.56  122  229    1  111  111    3    3  112  P01629     Ig kappa chain V-II region 2S1.3 OS=Mus musculus PE=1 SV=1
 1884 : KV3A8_MOUSE 2VL5    0.35  0.59  122  229    1  110  112    5    6  111  P01660     Ig kappa chain V-III region PC 3741/TEPC 111 OS=Mus musculus PE=1 SV=1
 1885 : KV3AD_MOUSE 2ZCL    0.35  0.59  122  229    1  110  110    2    2  111  P01665     Ig kappa chain V-III region PC 7043 OS=Mus musculus PE=1 SV=1
 1886 : KV3AF_MOUSE         0.35  0.57  122  229    1  110  110    2    2  111  P01667     Ig kappa chain V-III region PC 6308 OS=Mus musculus PE=1 SV=1
 1887 : KV3AG_MOUSE         0.35  0.57  122  229    1  109  110    3    3  110  P01668     Ig kappa chain V-III region PC 7210 OS=Mus musculus PE=1 SV=1
 1888 : KV3AH_MOUSE         0.35  0.58  122  229    1  110  110    2    2  111  P01669     Ig kappa chain V-III region PC 7769 OS=Mus musculus PE=1 SV=1
 1889 : KV5A4_MOUSE 1MQK    0.35  0.57  122  229    1  106  111    3    8  108  P01636     Ig kappa chain V-V region MOPC 149 OS=Mus musculus PE=1 SV=1
 1890 : KV5AA_MOUSE         0.35  0.59  122  229    1  106  110    4    6  108  P01643     Ig kappa chain V-V region MOPC 173 OS=Mus musculus PE=1 SV=1
 1891 : M3XCT3_FELCA        0.35  0.63  124  229   23  127  111    4   11  129  M3XCT3     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1892 : M3YDC4_MUSPF        0.35  0.54  122  230   21  118  112    5   17  133  M3YDC4     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 1893 : M3YHR6_MUSPF        0.35  0.56  122  230   20  129  116    7   13  130  M3YHR6     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 1894 : M7ANJ7_CHEMY        0.35  0.57  122  230   21  123  112    5   12  145  M7ANJ7     Ig kappa chain V-IV region OS=Chelonia mydas GN=UY3_16105 PE=4 SV=1
 1895 : Q53VP8_MOUSE        0.35  0.57  122  229    1  111  111    3    3  112  Q53VP8     Kappa chain (Fragment) OS=Mus musculus PE=2 SV=1
 1896 : Q569B3_RAT          0.35  0.72    1  120   20  141  125    4    8  617  Q569B3     Igh-6 protein OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
 1897 : Q58E54_MOUSE        0.35  0.69    1  120   20  140  125    4    9  485  Q58E54     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
 1898 : Q5F2I0_MOUSE        0.35  0.56  122  229    1  112  112    4    4  115  Q5F2I0     Kappa light chain variable region (Fragment) OS=Mus musculus GN=IgG1 anti-TS1 VL PE=2 SV=1
 1899 : Q5NV87_HUMAN        0.35  0.56  124  218    3  104  103    6    9  104  Q5NV87     V4-6 protein (Fragment) OS=Homo sapiens GN=IGLV11-55 PE=4 SV=1
 1900 : Q5VLR6_RAT          0.35  0.69    1  120   20  141  123    3    4  482  Q5VLR6     BWK3 OS=Rattus norvegicus GN=LOC366772 PE=2 SV=1
 1901 : Q6LEM8_MOUSE        0.35  0.58  122  229    1  111  111    3    3  112  Q6LEM8     Putative uncharacterized protein (Fragment) OS=Mus musculus PE=2 SV=1
 1902 : A0N6R1_9MURI        0.34  0.58  122  229    1  110  112    5    6  110  A0N6R1     Rheumatoid factor RFA28 (Fragment) OS=Mus sp. GN=Ig V PE=2 SV=1
 1903 : A2NI60_HUMAN2Q1E    0.34  0.57  122  229    1  106  109    2    4  108  A2NI60     BRE (Fragment) OS=Homo sapiens PE=2 SV=1
 1904 : A2NV19_MOUSE        0.34  0.58  122  229   20  130  112    4    5  131  A2NV19     Precursor polypeptide (AA -10 to 121) (413 is 1st base in codon) (Precursor) OS=Mus musculus GN=Igkv1-117 PE=2 SV=1
 1905 : F1LZG3_RAT          0.34  0.57  122  231    1  107  113    6    9  108  F1LZG3     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=2 SV=2
 1906 : F1M1G3_RAT          0.34  0.54  122  230    1   99  111    4   14  109  F1M1G3     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1907 : F1M1R0_RAT          0.34  0.59  122  230   21  134  115    5    7  136  F1M1R0     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=2
 1908 : F6V2R3_MONDO        0.34  0.61  122  226   22  130  111    7    8  135  F6V2R3     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=1
 1909 : F6ZNU9_ORNAN        0.34  0.61    1  120   20  143  126    4    8  143  F6ZNU9     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=1
 1910 : F7AWT8_XENTR        0.34  0.54  122  229   20  132  115    8    9  136  F7AWT8     Uncharacterized protein OS=Xenopus tropicalis GN=LOC100497925 PE=4 SV=1
 1911 : F7EI62_XENTR        0.34  0.53  123  231   22  121  113    5   17  121  F7EI62     Uncharacterized protein OS=Xenopus tropicalis PE=4 SV=1
 1912 : F7FQ18_MONDO        0.34  0.60  122  226    1  108  108    3    3  112  F7FQ18     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
 1913 : G1L6H1_AILME        0.34  0.60  125  231    4  108  111    7   10  108  G1L6H1     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1914 : G1M4T3_AILME        0.34  0.56  122  231   20  135  124   11   22  240  G1M4T3     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
 1915 : G1MMG4_AILME        0.34  0.67  124  226    3  102  105    4    7  113  G1MMG4     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 1916 : G1MMH6_AILME        0.34  0.56  122  216    1  105  106    6   12  108  G1MMH6     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=LOC100473072 PE=4 SV=1
 1917 : G1Q3X0_MYOLU        0.34  0.55  122  231   20  137  122    9   16  145  G1Q3X0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1918 : G1R8C4_NOMLE        0.34  0.55  122  230   21  119  111    5   14  129  G1R8C4     Uncharacterized protein OS=Nomascus leucogenys PE=4 SV=2
 1919 : G1TM79_RABIT        0.34  0.59  124  231   23  126  111    6   10  129  G1TM79     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
 1920 : G1TPX4_RABIT        0.34  0.57  125  231    1  103  109    5    8  109  G1TPX4     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
 1921 : G1TWT9_RABIT        0.34  0.62  122  231   24  128  111    4    7  132  G1TWT9     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
 1922 : G1TYZ5_RABIT        0.34  0.60  122  231    1  108  112    4    6  109  G1TYZ5     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 1923 : G3IL03_CRIGR        0.34  0.59  122  231   21  123  112    5   11  123  G3IL03     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024561 PE=4 SV=1
 1924 : G3N5Z8_GASAC        0.34  0.57  122  228    1  104  108    3    5  106  G3N5Z8     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1925 : G3RYF4_GORGO        0.34  0.57  122  230   23  121  111    5   14  123  G3RYF4     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
 1926 : G3S8W9_GORGO        0.34  0.56  122  230   21  127  119    7   22  137  G3S8W9     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
 1927 : G3TX59_LOXAF        0.34  0.53  122  230   21  125  116    6   18  134  G3TX59     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1928 : G3U8Y3_LOXAF        0.34  0.54  122  230   21  125  116    6   18  134  G3U8Y3     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1929 : G3ULD5_LOXAF        0.34  0.56  122  230   21  125  115    6   16  134  G3ULD5     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1930 : G3VXF0_SARHA        0.34  0.57  123  230   22  119  111    7   16  129  G3VXF0     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1931 : H2S812_TAKRU        0.34  0.59  122  231   39  158  121    4   12  265  H2S812     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101062439 PE=4 SV=1
 1932 : H3A0Z5_LATCH        0.34  0.56  122  231   20  132  121    8   19  247  H3A0Z5     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
 1933 : H9GSC9_ANOCA        0.34  0.56    1  120   23  146  127    6   10  146  H9GSC9     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1934 : H9H696_MONDO        0.34  0.53  122  231    1  114  116    5    8  114  H9H696     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
 1935 : I3KXP3_ORENI        0.34  0.63  122  224    1  102  105    4    5  104  I3KXP3     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1936 : I3L728_PIG          0.34  0.58  123  231   22  133  113    5    5  133  I3L728     Uncharacterized protein OS=Sus scrofa GN=LOC100739851 PE=4 SV=1
 1937 : K7ET87_PONAB        0.34  0.54  122  230   23  121  111    5   14  125  K7ET87     Uncharacterized protein OS=Pongo abelii GN=IGKV1-5 PE=4 SV=1
 1938 : K7EUX4_PONAB        0.34  0.57  122  230   23  121  111    5   14  131  K7EUX4     Uncharacterized protein OS=Pongo abelii GN=LOC100939897 PE=4 SV=1
 1939 : K7EYM8_PELSI        0.34  0.60  122  230    3  110  111    4    5  114  K7EYM8     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
 1940 : K9J7P0_XENTR        0.34  0.58  122  230   22  130  113    6    8  130  K9J7P0     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1941 : KV07_RABIT          0.34  0.56  125  231    4  108  111    5   10  108  P01688     Ig kappa chain V region K-25 OS=Oryctolagus cuniculus PE=1 SV=1
 1942 : KV106_HUMAN         0.34  0.58  122  231    1  108  112    4    6  108  P01598     Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1
 1943 : KV202_HUMAN         0.34  0.55  122  229    1  111  111    3    3  113  P01615     Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1
 1944 : KV206_HUMAN         0.34  0.57  122  229   21  131  111    3    3  133  P06310     Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1
 1945 : KV2A1_MOUSE         0.34  0.59  122  229    1  111  112    5    5  112  P01626     Ig kappa chain V-II region MOPC 167 OS=Mus musculus PE=1 SV=1
 1946 : KV3A6_MOUSE         0.34  0.59  122  229   21  130  114    6   10  132  P01658     Ig kappa chain V-III region MOPC 321 OS=Mus musculus PE=1 SV=1
 1947 : KV3A7_MOUSE         0.34  0.58  122  229    1  110  113    5    8  112  P01659     Ig kappa chain V-III region TEPC 124 OS=Mus musculus PE=1 SV=1
 1948 : KV5AG_MOUSE         0.34  0.54  122  229    1  106  112    5   10  108  P01649     Ig kappa chain V-V regions OS=Mus musculus PE=1 SV=1
 1949 : L8HLC1_BOSMU        0.34  0.64  122  229   20  116  111    4   17  118  L8HLC1     Uncharacterized protein (Fragment) OS=Bos grunniens mutus GN=M91_18601 PE=4 SV=1
 1950 : L9KL79_TUPCH        0.34  0.55  122  231   20  131  119    7   16  142  L9KL79     Ig lambda chain V-I region BL2 OS=Tupaia chinensis GN=TREES_T100009969 PE=4 SV=1
 1951 : M0R4C5_RAT          0.34  0.59  122  231   21  131  116    5   11  134  M0R4C5     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
 1952 : M7B3X4_CHEMY        0.34  0.55  125  230    1  100  110    6   14  123  M7B3X4     Uncharacterized protein OS=Chelonia mydas GN=UY3_16107 PE=4 SV=1
 1953 : M7BKR0_CHEMY        0.34  0.62  122  231   21  130  113    5    6  140  M7BKR0     Ig kappa chain V-V region L7 OS=Chelonia mydas GN=UY3_10238 PE=4 SV=1
 1954 : M9MMM2_PONAB        0.34  0.55  122  231   21  134  115    5    6  135  M9MMM2     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1955 : Q3B8R4_RAT          0.34  0.70    1  120   20  140  123    4    5  595  Q3B8R4     Igh-6 protein OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
 1956 : Q811U5_MOUSE2R0W    0.34  0.70    1  120    1  118  122    3    6  118  Q811U5     Anti-human Fc gamma receptor III 3G8 gamma heavy chain variable region (Fragment) OS=Mus musculus PE=1 SV=1
 1957 : R4GC90_ANOCA        0.34  0.58  122  225   29  138  113    9   12  144  R4GC90     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=1
 1958 : A0N7H1_9MURI        0.33  0.58  122  229   20  130  112    4    5  140  A0N7H1     Tg10 kappa (Fragment) OS=Mus sp. GN=Tg10 kappa PE=2 SV=1
 1959 : A2NH53_HUMAN        0.33  0.59  122  231    4  102  111    3   13  112  A2NH53     Immunogobulin kappa, VJ region (Fragment) OS=Homo sapiens PE=4 SV=1
 1960 : B5UB67_MOUSE        0.33  0.56  122  229    1  111  111    3    3  114  B5UB67     EP3-1 light chain variable region (Fragment) OS=Mus musculus GN=EP3-1VL PE=2 SV=1
 1961 : F1N969_CHICK        0.33  0.57    1  113   22  139  122    4   13  146  F1N969     Uncharacterized protein OS=Gallus gallus GN=Gga.369 PE=4 SV=2
 1962 : F6V1N5_MONDO        0.33  0.58  122  228   21  132  114    6    9  133  F6V1N5     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=1
 1963 : F6VKZ3_HORSE        0.33  0.53  122  230    4  102  113    5   18  102  F6VKZ3     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
 1964 : F6XW54_MONDO        0.33  0.52  122  226   20  125  112    8   13  125  F6XW54     Uncharacterized protein OS=Monodelphis domestica GN=LOC100619841 PE=4 SV=2
 1965 : F7BI03_ORNAN        0.33  0.61    1  120   20  140  124    6    7  161  F7BI03     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=1
 1966 : F7DFB4_MACMU        0.33  0.57  124  218    2  103  103    6    9  103  F7DFB4     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1967 : F7FBK8_MONDO        0.33  0.55  122  226   21  130  111    6    7  131  F7FBK8     Uncharacterized protein OS=Monodelphis domestica GN=LOC100619633 PE=4 SV=1
 1968 : F7IIQ8_CALJA        0.33  0.62  125  230    3  107  109    4    7  111  F7IIQ8     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
 1969 : G1LVU5_AILME        0.33  0.53  122  231   21  123  113    5   13  128  G1LVU5     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
 1970 : G1R7H1_NOMLE        0.33  0.57  122  230   23  121  111    5   14  125  G1R7H1     Uncharacterized protein OS=Nomascus leucogenys GN=IGKV1-27 PE=4 SV=2
 1971 : G3U707_LOXAF        0.33  0.54  122  231    1  114  114    3    4  114  G3U707     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1972 : G3VDB7_SARHA        0.33  0.54  122  230   21  119  112    6   16  119  G3VDB7     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
 1973 : H0XU06_OTOGA        0.33  0.58  123  231    2  108  111    5    6  108  H0XU06     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1974 : H2L5N3_ORYLA        0.33  0.62  122  229    1  111  112    3    5  113  H2L5N3     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1975 : H2L5T4_ORYLA        0.33  0.62  122  230    1  110  113    4    7  112  H2L5T4     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101172990 PE=4 SV=1
 1976 : H2LBV4_ORYLA        0.33  0.60  122  230    1  107  110    3    4  108  H2LBV4     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1977 : H2LC06_ORYLA        0.33  0.57  122  231   22  122  111    5   11  131  H2LC06     Uncharacterized protein OS=Oryzias latipes PE=4 SV=1
 1978 : H2PUB0_PONAB        0.33  0.56  122  230   23  125  111    6   10  128  H2PUB0     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1979 : H2S169_TAKRU        0.33  0.53  122  231   21  127  118    4   19  127  H2S169     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1980 : H9G6N2_ANOCA        0.33  0.62  122  230   20  122  112    5   12  124  H9G6N2     Uncharacterized protein OS=Anolis carolinensis GN=LOC100560138 PE=4 SV=2
 1981 : H9GVR1_ANOCA        0.33  0.55  124  231    3  112  116    5   14  122  H9GVR1     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
 1982 : HV2B_RABIT          0.33  0.56    4  119    3  117  124    6   17  117  P01828     Ig heavy chain V-A2 region K-25 OS=Oryctolagus cuniculus PE=1 SV=1
 1983 : K7EU93_PONAB        0.33  0.55  122  230   23  121  111    5   14  125  K7EU93     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
 1984 : K7FU25_PELSI        0.33  0.58  122  230   21  123  112    5   12  131  K7FU25     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
 1985 : K7TH57_MOUSE        0.33  0.60    9  120    1  115  119    7   11  115  K7TH57     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1986 : KV114_HUMAN         0.33  0.61  122  229    1  106  109    2    4  108  P01606     Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1
 1987 : KV117_HUMAN         0.33  0.57  122  228    1  105  108    2    4  108  P01609     Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1
 1988 : KV16_RABIT          0.33  0.59  123  231    1  114  116    6    9  114  P01697     Ig kappa chain V region AH80-5 OS=Oryctolagus cuniculus PE=1 SV=1
 1989 : KV2A5_MOUSE 3CFB    0.33  0.55  122  229    1  111  111    3    3  113  P03976     Ig kappa chain V-II region 17S29.1 OS=Mus musculus PE=1 SV=1
 1990 : L8HNW4_BOSMU        0.33  0.59  122  227   25  129  111    5   11  135  L8HNW4     Ig lambda chain V-II region MGC (Fragment) OS=Bos grunniens mutus GN=M91_02599 PE=4 SV=1
 1991 : Q58E53_MOUSE        0.33  0.69    1  120   20  142  124    4    5  487  Q58E53     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
 1992 : R4GDG5_ANOCA        0.33  0.53  122  231   20  133  119    9   14  144  R4GDG5     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=1
 1993 : F1LZY6_RAT          0.32  0.54  122  230    1  108  112    5    7  108  F1LZY6     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 1994 : F1P4B7_CHICK        0.32  0.58    1  113    1  118  122    4   13  125  F1P4B7     Uncharacterized protein (Fragment) OS=Gallus gallus GN=Gga.371 PE=4 SV=2
 1995 : F6Q0K2_MONDO        0.32  0.54  122  226   20  125  111    7   11  125  F6Q0K2     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
 1996 : F6SWQ5_MACMU        0.32  0.49  122  229   29  132  116    7   20  132  F6SWQ5     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1997 : F6T196_ORNAN        0.32  0.58    4  111    2  109  114    5   12  121  F6T196     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1998 : F7B4K6_ORNAN        0.32  0.58  122  228    1  105  111    6   10  108  F7B4K6     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1999 : F7DNR8_ORNAN        0.32  0.57    2  120   18  137  128    6   17  137  F7DNR8     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 2000 : F7FT14_MONDO        0.32  0.55  124  213    1  108  108    4   18  115  F7FT14     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
 2001 : G1LUE9_AILME        0.32  0.54  122  230   21  125  116    6   18  133  G1LUE9     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
 2002 : G1MMI5_AILME        0.32  0.65  122  231    1  103  111    4    9  110  G1MMI5     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
 2003 : G1PFS0_MYOLU        0.32  0.54  122  231   20  138  126   11   23  243  G1PFS0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 2004 : G1THC9_RABIT        0.32  0.58  123  231    1  104  110    4    7  106  G1THC9     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 2005 : G1TI63_RABIT        0.32  0.59  122  231    1  106  112    5    8  106  G1TI63     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 2006 : G1TMG6_RABIT        0.32  0.62  122  230    3  108  111    5    7  114  G1TMG6     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 2007 : G1TPF8_RABIT        0.32  0.58  122  230    1  103  112    4   12  108  G1TPF8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 2008 : G1U177_RABIT        0.32  0.56  123  231    2  106  112    7   10  107  G1U177     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 2009 : G3IL53_CRIGR        0.32  0.54  122  231   21  122  111    4   10  122  G3IL53     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024615 PE=4 SV=1
 2010 : G3IMJ1_CRIGR        0.32  0.55  122  231   23  121  112    7   15  121  G3IMJ1     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_025131 PE=4 SV=1
 2011 : G3RNA1_GORGO        0.32  0.54  122  229   21  132  114    6    8  144  G3RNA1     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
 2012 : G3U7I4_LOXAF        0.32  0.58  122  230   21  118  111    5   15  134  G3U7I4     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 2013 : H0V3H6_CAVPO        0.32  0.57  122  230    1   99  111    5   14  108  H0V3H6     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100735274 PE=4 SV=1
 2014 : H0XHP3_OTOGA        0.32  0.56  122  231    1  113  115    6    7  113  H0XHP3     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 2015 : H2L5T5_ORYLA        0.32  0.59  122  230    2  114  114    4    6  118  H2L5T5     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101172990 PE=4 SV=1
 2016 : H9H656_MONDO        0.32  0.55  122  231    1  115  117    4    9  115  H9H656     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=LOC100619586 PE=4 SV=1
 2017 : HV203_HUMAN         0.32  0.62    1  120    1  119  125    6   11  119  P01816     Ig heavy chain V-II region DAW OS=Homo sapiens PE=1 SV=1
 2018 : HV205_HUMAN         0.32  0.64    1  120    1  121  125    6    9  121  P01818     Ig heavy chain V-II region HE OS=Homo sapiens PE=1 SV=1
 2019 : I3NC61_SPETR        0.32  0.57  122  230    1   99  111    5   14  110  I3NC61     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 2020 : K7EYR4_PELSI        0.32  0.55  122  230    1   99  110    3   12  107  K7EYR4     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
 2021 : K7FPK9_PELSI        0.32  0.55  122  231   21  117  111    4   15  117  K7FPK9     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
 2022 : K7G8P7_PELSI        0.32  0.61  122  230   21  128  111    4    5  128  K7G8P7     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
 2023 : L9JM07_TUPCH        0.32  0.55  122  230   23  121  111    5   14  125  L9JM07     Ig kappa chain V-I region HK102 OS=Tupaia chinensis GN=TREES_T100021706 PE=4 SV=1
 2024 : M0R628_RAT          0.32  0.58  122  231    1  103  112    5   11  109  M0R628     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 2025 : M0R7M5_RAT          0.32  0.54  122  231    1  114  114    4    4  115  M0R7M5     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 2026 : M0R813_RAT          0.32  0.56  122  231    1  114  114    4    4  114  M0R813     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 2027 : M3WFW2_FELCA        0.32  0.56  122  231   20  136  125   11   23  241  M3WFW2     Uncharacterized protein OS=Felis catus PE=4 SV=1
 2028 : M3YDF0_MUSPF        0.32  0.54  122  230   21  119  113    6   18  121  M3YDF0     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 2029 : M3YDI4_MUSPF        0.32  0.52  122  230   21  125  114    5   14  127  M3YDI4     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
 2030 : M3Z565_MUSPF        0.32  0.58  122  231    1  114  115    5    6  114  M3Z565     Uncharacterized protein (Fragment) OS=Mustela putorius furo PE=4 SV=1
 2031 : Q9UL80_HUMAN        0.32  0.54  122  229    1  112  112    4    4  114  Q9UL80     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 2032 : F1LU24_RAT          0.31  0.52  122  231   20  127  114    5   10  132  F1LU24     Protein LOC100911032 OS=Rattus norvegicus GN=LOC100911032 PE=4 SV=2
 2033 : F6Q2Z4_MONDO        0.31  0.51  122  227   20  123  113    7   16  123  F6Q2Z4     Uncharacterized protein OS=Monodelphis domestica GN=LOC100619812 PE=4 SV=1
 2034 : F6Q3P5_MONDO        0.31  0.52  122  222   20  123  108    5   11  126  F6Q3P5     Uncharacterized protein OS=Monodelphis domestica GN=LOC100617757 PE=4 SV=2
 2035 : F7C506_MACMU        0.31  0.55  122  230   20  124  114    6   14  134  F7C506     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=LOC708249 PE=4 SV=1
 2036 : G1U6V8_RABIT        0.31  0.55  122  231    2  107  112    5    8  107  G1U6V8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
 2037 : G3UDI6_LOXAF        0.31  0.52    9  120    1  121  122    6   11  121  G3UDI6     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 2038 : G3UIH4_LOXAF        0.31  0.51  122  231    1  114  115    6    6  115  G3UIH4     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=LOC100674083 PE=4 SV=1
 2039 : H2L5U5_ORYLA        0.31  0.57  122  230    2  111  113    4    7  113  H2L5U5     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 2040 : H3C3I1_TETNG        0.31  0.50    2  118   11  122  121    8   13  123  H3C3I1     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
 2041 : HV201_HUMAN         0.31  0.65    1  120    1  126  128    5   10  126  P01814     Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1
 2042 : HV204_HUMAN         0.31  0.65    1  120    1  125  127    6    9  125  P01817     Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1
 2043 : HV208_HUMAN         0.31  0.60    1  114   20  141  125    6   14  147  P04438     Ig heavy chain V-II region SESS OS=Homo sapiens PE=2 SV=1
 2044 : I3KCG6_ORENI        0.31  0.56    3  119    2  116  124    6   16  117  I3KCG6     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 2045 : I3MX00_SPETR        0.31  0.52  125  227    1  106  112    7   15  107  I3MX00     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 2046 : L7N3U6_XENTR        0.31  0.55  122  231   20  127  117    8   16  134  L7N3U6     Uncharacterized protein OS=Xenopus tropicalis PE=4 SV=1
 2047 : M7AYM6_CHEMY        0.31  0.60    2  118    1  123  125    4   10  226  M7AYM6     Ig heavy chain V region 3 (Fragment) OS=Chelonia mydas GN=UY3_18051 PE=4 SV=1
 2048 : M7BPX0_CHEMY        0.31  0.54    1  112  127  239  120    5   15  263  M7BPX0     Ig heavy chain V-II region WAH OS=Chelonia mydas GN=UY3_02801 PE=4 SV=1
 2049 : M9MMH2_MONDO        0.31  0.54  122  228   20  124  112    7   12  125  M9MMH2     Uncharacterized protein OS=Monodelphis domestica GN=LOC100619288 PE=4 SV=1
 2050 : S7MNN9_MYOBR        0.31  0.56    1  120   26  159  134    5   14  163  S7MNN9     Ig heavy chain V-II region WAH OS=Myotis brandtii GN=D623_10002034 PE=4 SV=1
 2051 : F6VT01_HORSE        0.30  0.51  122  230   22  120  113    8   18  121  F6VT01     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100065623 PE=4 SV=1
 2052 : F6XWB2_MOUSE        0.30  0.56  122  231    1  114  114    4    4  114  F6XWB2     Uncharacterized protein OS=Mus musculus GN=Igkv1-115 PE=4 SV=1
 2053 : F7H3D9_MACMU        0.30  0.54  123  231    1  107  112    6    8  107  F7H3D9     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 2054 : G3ILT5_CRIGR        0.30  0.47  122  230   21  134  126    7   29  138  G3ILT5     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024857 PE=4 SV=1
 2055 : G3IMG1_CRIGR        0.30  0.57  122  231   23  121  112    7   15  121  G3IMG1     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_025100 PE=4 SV=1
 2056 : G5E6I6_BOVIN        0.30  0.55  122  229    1  111  114    6    9  113  G5E6I6     Uncharacterized protein (Fragment) OS=Bos taurus PE=4 SV=1
 2057 : H0XG90_OTOGA        0.30  0.45  122  230    1  100  115    7   21  102  H0XG90     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 2058 : I3MT84_SPETR        0.30  0.51  124  229    2  103  114    7   20  103  I3MT84     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 2059 : I3N0B1_SPETR        0.30  0.51  122  231    1  108  115    6   12  114  I3N0B1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 2060 : I3NGY9_SPETR        0.30  0.53  122  231    1  103  112    5   11  108  I3NGY9     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 2061 : K7FLP7_PELSI        0.30  0.55  122  231   21  121  113    5   15  121  K7FLP7     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
 2062 : M0RAB8_RAT          0.30  0.53  122  229    1  115  116    6    9  116  M0RAB8     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 2063 : R4GA77_ANOCA        0.30  0.51  122  230   20  115  112    3   19  131  R4GA77     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=1
 2064 : S9YJT3_9CETA        0.30  0.48  122  231   22  123  121   10   30  169  S9YJT3     TRD protein-like protein OS=Camelus ferus GN=CB1_000233034 PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 A E              0   0  185  771   30       Q Q       QQ Q Q    Q  QQQQ    QQQQQQ QQQQQQQ HQQ QQQQ  EEQ Q Q  
     2    2 A V        +     0   0   18  834   19       V VV      VV V V    V  VVVV    VVVVVV VVVVVVV VVV VVVV  VVV VVV  
     3    3 A Q  E     -A   25   0A  90  836   34       Q QQ      QQ Q Q    Q  QQQQ    QQQQQQ QQQQQQQ QQQ QQQQ  QQQ QQQ  
     4    4 A L  E     -A   24   0A  13  881    3       L LL      LL L L    L  LLLL    LLLLLL LLLLLLL LLL LLLL  LLL LLL  
     5    5 A Q  E     -A   23   0A 107  882   70       Q QQ      QQ Q Q    Q  QQQQ    QQQQQQ QQQQQQQ QQQ QQQQ  QQQ QQQ  
     6    6 A Q  E     -A   22   0A  14  887   31       Q QQ      QQ Q Q    Q  QQQQ    QQQQQQ QQQQQQQ QQQ QQQQ  QQQ QQQ  
     7    7 A S        -     0   0   33  892   13       X PP      PP P P    P  PPPP    PPPPPP PPPPPPP PPP PPPP  SSP SSS  
     8    8 A G        -     0   0   52  907   11       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGGGG GGGGG GGG GGG  
     9    9 A A        -     0   0   80 1179   51       A AA      AA A A    AAAAAAAAA  AAAAAAATAAAAAAAAAA ATATA PPA AAPAA
    10   10 A E  E     -d  116   0B  68 1189   46       E EE      EE E E    EEEEEEEEE  EEEEEEKEEEEEEEKEEE EEEEE EEE EEEEE
    11   11 A L  E     +d  117   0B 130 1195   22       L LL      LL L L    LLLLLLLLL  LLLLLLLLLLLLLLLLLF LLLLL LLL LLLLL
    12   12 A V  E     -d  118   0B  28 1197   47       V VV      VV V V    VVVVVVVVV  VVVVVVVVVVVVVVVVVV VVVVV VVV VVVAV
    13   13 A K    >   -     0   0  145 1201   50       K KK      KK K K    KKKKKKKKK  KKKKKKKKKKRKKKKKKK RKKKK KKK KRKKK
    14   14 A P  T 3  S+     0   0   70 1203    8       P PP      PP P P    PPPPPPPPP  PPPPPPPPPPPPPPPPPP PPPPP PPP PAPPP
    15   15 A G  T 3  S+     0   0   59 1209   28       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGGGG GGGGG GGG GGGGG
    16   16 A A    <   -     0   0   36 1213   63       A AA      AA A A    AATAAAAAA  AAAAAAAAAASAAAAAAA SAAAA AAA SSAAA
    17   17 A S        -     0   0   66 1210   29       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SSLSS
    18   18 A V  E     - B   0  83A  10 1213   32       V VV      VV V V    VVVVVVVVV  VVVVVVVVVVVVVVVVVV VVVVV VVV VVVVV
    19   19 A K  E     - B   0  82A 119 1211   53       K KK      KK K K    KKKKKKKKK  KKKKKKKKKKKKKKKKKK KKKKK KKK KKKKK
    20   20 A L  E     - B   0  81A   0 1214   21       L LL      LL L L    LLLLLLLLL  LLLLLLLLLLLLLLLVLL LLLLL IMM IMIML
    21   21 A S  E     - B   0  80A  31 1215   35       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0       C SC      CC C C    CCCCCCCCC  CCCCCCCCCCCCCCYCCC CCCCC CCC CCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70       K KK      KK K K    KKKKKKKKK  KKKKKKKKKKKKKKKKKK KTKKK KKK KKKKK
    24   24 A A  E     +A    4   0A   2 1216   49       A AA      AA A A    AAAAAAAAA  AAAAAAAAAAAAAAAAAA AAAAA AAA AAAAA
    25   25 A S  E     +A    3   0A  49 1216   12       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SSSSS
    26   26 A G  S    S+     0   0   56 1215    3       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGGGG GGGGG GGG GGGGG
    27   27 A Y  S    S-     0   0   39 1216   33       Y YY      YY Y Y    YYYYYYYYY  YYYYYYYYYYYYYYYYYY YYYYF YYY YYYYY
    28   28 A T    >   -     0   0   90 1216   52       T TT      TT T T    TTTTTTTTT  TTTTTTTTTTTTTTTTTT TTTTT TTT TTTTT
    29   29 A F  G >  S+     0   0   13 1216   27       F FF      FF F F    FFFFFFFFF  FFFFFFFFFFFFFFFFFF FFFFF FFF FFFFF
    30   30 A T  G 3  S+     0   0   40 1216   55       T TT      TT T T    TTTTTTTTT  TTTTTTTTTTTTTTTTTT TTTTT TTT TTTTT
    31   31 A S  G <  S+     0   0   23 1216   57       S SS      SS S S    SNSSSSSNS  SSSSSSSSSSSSSSSSSS SSSSN DDS SSSSS
    32   32 A Y  E <  S-E  100   0B  40 1139   28       Y YY      YY Y Y    YYYYYYYYY  YYYYYYYYYYYYYYYYYY YYYYF YYY YYYYY
    33   33 A W  E     -E   99   0B  40 1148   92       W WW      WW W W    WLWWWWWLW  WWWWWWWWWWWWWWWWWL WWWWL NYW DGDWW
    34   34 A M  E     -EF  98  51B   0 1206   49       M MM      MM M M    MMMMMMMMM  MMMMMMMMMMMMMMMMMM MMMMM MMI MIIMM
    35   35 A H  E     -EF  97  50B   0 1212   72       H HH      HH H H    HHHHHHHHH  HHRHHHDHHHHHHHDHHH DHHHH HHT HNNHH
    36   36 A W  E     -EF  96  49B   0 1216    0       W WW      WW W W    WWWWWWWWW  WWWWWWWWWWWWWWWWWW WWWWW WWW WWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17       V VV      VV V V    VVVVVVVVV  VVVVVVVVVVVVVVVVVV VVVVV VVV IVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22       K KK      KK K K    KKKKKKKKK  KKKKKKKKKKKKKKKKKN KKKKK KKK KKKKK
    39   39 A Q  E     +EF  93  45B  20 1216    5       Q QQ      QQ Q Q    QQPQQQQQQ  QQQQQQQQQQQQQQQQQQ QQQQQ QQQ QQQQQ
    40   40 A R    >   -     0   0   35 1216   71       R RR      RR R R    RRRRRRRRR  RRRRRRRRRRRRRRRRRR RRRRR SKR QRRRR
    41   41 A P  T 3  S+     0   0  130 1215   15       P PP      PP P P    PPPPPPPPP  PPPPPPPPPPPPPPPPPP PPPPP HPP PPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGGGG GGGGG GGG GGGGG
    43   43 A R  S <  S-     0   0  156 1216   43       R RR      RR R R    RRRRRRRRR  RRRRRRRQRRRRRRRQRR QRRQR KKQ NQQQQ
    44   44 A G        -     0   0   16 1215   36       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGGGG GGGGG SGG GGGGG
    45   45 A L  E     -F   39   0B   8 1215   10       L LL      LL L L    LLLLLLLLL  LLLLLLLLLLLLLLLLLL LLLLL LLL LLLLL
    46   46 A E  E     -F   38   0B  34 1216    6       E EE      EE E E    EEEEEEEEE  EEEEEEEEEEEEEEEEEE EEEEE EEE EEEEE
    47   47 A W  E     -F   37   0B   3 1216   10       W WW      WW W W    WWWWWWWWW  WWWWWWWWWWWWWWWWWW WWWWW WWW WWWWW
    48   48 A I  E     -     0   0B   0 1215   31       I II      II I I    IIIIIIIII  IIIIIIIIIIIIIIIIII IIIII III IIIII
    49   49 A G  E     -FG  36  60B   0 1216   35       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGGGG GGGGG GGG GGGGG
    50   50 A R  E     -FG  35  59B  32 1216   94       R RN      RR R R    RRRRRRRRR  RRRRRRRNRRRRRRRRRR NRRNR YED WYWYE
    51   51 A I  E     -FG  34  58B   0 1207   17       I II      II I I    IIIIIIIII  IIIIIIIIIIIIIIIIII IIIII III IIIII
    52   52 A D     >  -     0   0   26 1212   86       D DD      DD D D    DDDDDDDDD  DDDDDDDNDDDDDDDHDD YDDND YYY YNYNN
    53   53 A P  T  4 S+     0   0    0 1212   83       P PP      PP P P    PPPPPPPPP  PPPPPPPPPPPPPPPPPP PPPPP PPP PPPPP
    54   54 A N  T  4 S-     0   0   96 1213   69       N NN      NN N N    NDNNNNNDN  NNNNNNNGNNNNNNNSNN SNNSA YGG GGGSS
    55   55 A G  T  4 S-     0   0   69 1216   57       S SS      SS S S    SSGSSSSSS  SSSSSSSNSSSSSSSDSS DSSNS NSS NNDTN
    56   56 A G     <  +     0   0   25  915   61       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGSGG SGGGG GGG GGGGG
    57   57 A G        -     0   0   43 1195   77       G GG      GG G G    GGGGGGGGG  GGGGGGGGGGGGGGGDGG EGGGG GNS NYSYR
    58   58 A T  E     -G   51   0B  62 1209   46       T TT      TT T T    TTTTTTTTT  TTTTTTTTTTTTTTTTTT TITTT TTT TTTTT
    59   59 A K  E     -G   50   0B  89 1212   88       K KK      KK K K    KKKKKKKKR  KKKKKKTNKKKKKKTNKT HIKNN GYN KKKEN
    60   60 A Y  E     -G   49   0B  46 1215    9       Y YY      YY Y Y    YYYYYYYYY  YYYYYYYYYYYYYYYYYY YYYYY YYY YYYYY
    61   61 A N    >>  -     0   0   12 1216   63       N NN      NN N N    NNSNNNNNN  NNNNNNNNNNNNNNNNNN NNNNN NNN NNNNN
    62   62 A E  G >4 S+     0   0  148 1216   64       E EE      EE E E    EEEEEEEEE  EEEEEEEEEEEEEEEQEE QEEEE QEE QEEQE
    63   63 A K  G 34 S+     0   0  109 1216   64       K KK      KK K K    KKMKKKKKN  KKKKKKKKKKKKKKKKKH KKKRR KKK KKKKK
    64   64 A F  G X> S+     0   0    5 1216   45       F FF      FF F F    FFFFFFFFF  FFFFFFFFFFFFFFFFFF FFFFF FFF FFFFF
    65   65 A K  T << S+     0   0  156 1216   40       K KK      KK K K    KKKKKKKKK  KKKKKKKKKKKKKKKKKR KKKKK KKK NKKKK
    66   66 A S  T 34 S+     0   0  108 1216   35       S SS      SS S S    SSSSSSSSI  SSSSSSSSSSSSSSSGSS DTSGN SGS GGGDS
    67   67 A K  T <4 S+     0   0   33 1214   21       K KK      KK K K    KKKKKKKKK  KKKKKKKKKKKKKKKKKK KKRKK KKK KKKKK
    68   68 A A  E  <  -C   83   0A   2 1216   69       A AA      AA A A    AAAAAAAAA  AAAAAAAVAAAAAAAAAA AAAAA AAA ATAAA
    69   69 A T  E     -C   82   0A  58 1216   37       T TT      TT T T    TTTTTTTTT  TTTTTTTTTTTTTTTTTT TTTTT TTT TTTTT
    70   70 A L  E     +C   81   0A   7 1216   27       L LL      LL L L    LLLLLLLLL  LLLLLLLLLLLLLLLLLL LLLLL LLL LLLLL
    71   71 A T  E     -C   80   0A  57 1213   47       T TT      TT T T    TTTTTTTTT  TTTTTTTTTTTTTTTTTT TTTTT TTT TTTTT
    72   72 A V  E     -C   79   0A  28 1216   71       V VV      VV V V    VVVVVVVVV  VVVVVVVVVVVVVVVVVI VVVSV VAV AVAAV
    73   73 A D  E   > -C   78   0A  69 1216    7       D DD      DD D D    DDDDDDDDD  DDDDDDDDDDDDDDDDDD DDDDD DDD DDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62       K KK      KT K K    KKKKKKKKK  KKKKKKKKKKKKKKKKKK KKKKN NTK KKKKK
    75   75 A P  T 3 5S+     0   0  122 1215   37       P PP      PS P P    PPPPPPPPP  PPPPPPPSPPPPPPPSPP SPPSP SSP SSSSS
    76   76 A S  T 3 5S-     0   0   37 1216   65       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SSSSS
    77   77 A S  T < 5 +     0   0   24 1216   48       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS STSSS SSS SSSSS
    78   78 A T  E   < -BC  23  73A   8 1216   64       T TT      TT T T    TTTTTTTTT  TTTTTTTTATTTTTTTTT TTTTT TTT TTTTT
    79   79 A A  E     -BC  22  72A   0 1207   67       A AA      AA A A    AAAAAAAAA  AAAAAAAAAAAAAAAAAA AAAAA AAA AAAAA
    80   80 A Y  E     -BC  21  71A  61 1209   36       Y YY      YY Y Y    YYYYYYYYY  YYYYYYYYYYYYYYYYYY YYYYY YYY YYYYY
    81   81 A M  E     -BC  20  70A   0 1212    9       M MM      MM M M    MMMMMMMMM  MMMMMMMTMMMMMMMMMM MMMMM MMM MMMMM
    82   82 A Q  E     -BC  19  69A  69 1215   43       Q QQ      QQ Q Q    QQQQQQQQQ  QQQQQQQQQQQQQQQQQQ QQQEH EQQ QQQQQ
    83   83 A L  E     -BC  18  68A   0 1215   14       L LL      LL L L    LLLLLLLLL  LLLLLLLLLLLLLLLLLL LLLLL LLL LLLLL
    84   84 A S        +     0   0   32 1215   56       S SS      SH S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SRSSS
    85   85 A S  S    S-     0   0   89 1216   25       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SSSSS
    86   86 A L        +     0   0    2 1216   15       L LL      LL L L    LLLLLLLLL  LLLLLLLLLLLLLLLLLL LLLLL LLL LLLLL
    87   87 A T    >   -     0   0   61 1215   68       X TT      TT T T    TTTTTTTTT  TTTTTTTTTTTTTTTTTT TTTTT TTT TTTTT
    88   88 A S  G >  S+     0   0   72 1216   59       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SSSSS
    89   89 A E  G 3  S+     0   0  107 1216   21       E EE      EE E E    EEEEEEEEE  EEEEEEEEEEEEEEEEEE EEEEE EEE EEEEE
    90   90 A D  G <  S+     0   0    7 1216    3       D DD      DD D D    DDDDDDDDD  DDDDDDDDDDDDDDDDDD DDDDD DDD DDNDD
    91   91 A S    <   +     0   0   31 1216   34       S SS      SS S S    SSSSSSSSS  SSSSSSSSSSSSSSSSSS SSSSS SSS SSSSS
    92   92 A A  E    S- H   0 116B  10 1214    5       A AA      AA A A    AAAAAAAVT  AAAAAATAAAAAAATAAA AAAAA AAA AAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48       V VV      VV V V    VVVVVVVVV  VVVVVVVVVVVVVVVVVV VVVVV VVV VVVVV
    94   94 A Y  E     -EH  38 114B   0 1216    1       Y YY      YY Y Y    YYYYYYYYY  YYYYYYYYYYYYYYYYYY YYYYY YYY YYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3       Y YY      YY Y Y    YYYYYYYYY  YYYYYYYYYYYYYYYYYY YYYYY YFY FFFYY
    96   96 A a  E     +E   36   0B   0 1216    1       C CC      CC C C    CCCCCCCCC  CCCCCCCCCCCCCCCCCC CCCCC CCC CCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24       A AT      AA A A    AAAAAAAAA  AAAAAAAAAAAAA.AATA AAAAA AAA AAAAA
    98   98 A R  E     -E   34   0B  13 1196   38         RR      RR R R    RRRRRRRRR  RRRRRKGRKSRRR.G RR RRLRR RRP RRRRR
    99   99 A M  E     -EI  33 107B   5 1101   82                 Y  Y S    GYGYDFSYG  SSTSYRG RYKWI.G EY  RL.Y   D  S HG
   100  100 A W  E >   -E   32   0B  89 1101   89                 D  D Y    LYNYDYDYN  LTFLDSN SGDDY.N GR  LA.Y   S  V YD
   101  101 A Y  T 3  S+     0   0  112  572   91                 Y  Y Y    YYYYYDYYY  YLIIGNF NSGEA.F .L  GE.Y   N  Y YG
   102  102 A Y  T 3  S-     0   0  133  629   92                 Y  Y G    DGPYGYDGP  DSTTSYP YSSDG.P DG  DAGG   H  Y RN
   103  103 A G  S <  S+     0   0   38  705   79                 G  G S    GSYAREYSY  yHTTSGY GYSYDAY YR  GYRS   L  G YY
   104  104 A T        -     0   0   32  784   66                 S  S s    NSY.T.DSY  dYvYFA. A.FA.R. d.  V.GS   .  g TV
   105  105 A Y        +     0   0   81  679   93                 S  S y    W.....Y..  YYaYY.. .WY.... ..  ..Y.   .  y ..
   106  106 A Y        -     0   0   32  842   66                 Y  Y Y    Y....YA..  AAPAA.Y .YA...Y .Y  ..Y.   Y  Y .G
   107  107 A F  E     +I   99   0B   0  885   48                 F  F F    FFFM.FMFF  MMFMMFF FFMM.WF mF  M.FF   F  F .F
   108  108 A D  E     +     0   0B  25  997   46                 D  D D    DDDD.DDDD  DDDDDDD DDDD.DD DD  D.DD   D  D DA
   109  109 A Y  E     -J  168   0C 108 1059   61                 Y  Y Y    VYYYFVYYY  YYYYYVY VVYYYYY YY  Y.YY   Y  Y YY
   110  110 A W  E     -I   97   0B  23 1092    2                 W  W W    WWWWWWWWW  WWWWWWW WWWWWWW WW  WWWW   W  W WW
   111  111 A G        -     0   0    3 1067   15                 G  G G    GGGGGGGGG  GGGGGGG GGGGGGG GG  GGGG   G  G GG
   112  112 A Q        -     0   0  141 1047   41                 Q  Q Q    TQQQQTQQQ  QQQQQT  TTQQQQQ QQ  QQQQ   Q  Q QQ
   113  113 A G        -     0   0   20 1013   12                 G  G G    G  GGGG    GGGGGG  GGGGGG  GG  GGG    G  G GG
   114  114 A T  E     - H   0  94B   2  996   31                 T  T T    T  TTTT    TTTTTT  TTTTTT  TT  TTT    T  T TT
   115  115 A T  E     - H   0  93B  60  979   76                 T  T T    T  STTS    SSTSST  TTSSST  ST  SLT    T  T TL
   116  116 A L  E     -dH  10  92B   1  972   19                 L  L L    V  VLVV    VVLVVV  VVVVVL  VL  VVL    L  L LV
   117  117 A T  E     -d   11   0B  57  953   21                 T  T T    T   TTT    TTTTTT  TTTTTT  TT  TTT    T  T TT
   118  118 A V  E     +d   12   0B   4  935    8                 V  V V    V   VVV    VVVVVV  VVVVVV  VV  VVV    V  V VV
   119  119 A S              0   0   64  917   10                 S  S S    S   SSS    SSSSSS  SSSSSS  SS  SSS    S  S SS
   120  120 A S              0   0  122  885   21                 S  S S    S   SSS    SSSSSS  SSSSSS  SS  SAS    S  S SA
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32  QQQQQ Q  QQQQQQ  Q Q QQQQ         QQ                  Q     Q   Q     
   123    2 B A        -     0   0   19  713   70  AAAXA A  AAAAAA  A X AAXA         AA                  A     A   A     
   124    3 B V        -     0   0   84  765   49  VVVVV V  VVVVVV  V V VVVV         VV                  V     V   V     
   125    4 B V  E     -Q  145   0D  10  820   26  VVVVV V  VVVVVV  V V VVVV         VV                  V     V   V     
   126    5 B T  E     +Q  144   0D  69  829   11  TTTTT T  TTTTTT  T T TTTT         TT                  T     T   T     
   127    6 B Q  E     -Q  143   0D  18  832    2  QQQQQ Q  QQQQQQ  Q Q QQQQ         QQ                  Q     Q   Q     
   128    7 B E        -     0   0   59  833   63  EEEEE E  EEEEEE  E E EEEE         EE                  E     E   E     
   129    8 B S  S    S+     0   0  101  841   38  SSSSS S  SSSSSS  S S SSSS         SS                  S     S   S     
   130    9 B A  E     -k  226   0C  59  842   50  AAAAA A  AAAAAA  A A AAAA         XA                  A     A   A     
   131   10 B L  E     -k  227   0C  57  847   76  LLLLL L  LLLLLL  L L LLLL         LL                  L     L   L     
   132   11 B T  E     +k  228   0C  84  848   77  TTTTT T  TTTTTT  T T TTTT         IT                  T     T   T     
   133   12 B T  E     -k  229   0C  18  848   68  TTTTT T  TTTTTT  T T TTTT         TT                  T     T   T     
   134   13 B S    >   -     0   0   55  849   70  SSSSS S  SSSSSS  S S SSSS         SS                  L     L   L     
   135   14 B P  T 3  S+     0   0   61  848   65  PPPPP P  PPPPPP  P P PPPP         PP                  P     P   P     
   136   15 B G  T 3  S+     0   0   46  850    7  GGGGG G  GGGGGG  G G GGGG         GG                  G     G   G     
   137   16 B E    <   -     0   0  108  850   56  EEEEE E  EEEEEE  E E GEEG         EG                  G     G   G     
   138   17 B T  E     - R   0 199D  88  850   66  TTTTT T  TTTTTT  T T TTTT         TT                  T     T   T     
   139   18 B V  E     - R   0 198D  14  850   33  VVVVV V  VVVVVV  V V VVVV         VV                  V     V   V     
   140   19 B T  E     - R   0 197D  53  849   41  TTTTT T  TTTTTT  T T ITII         TI                  T     T   T     
   141   20 B L  E     - R   0 196D   0  849   25  LLLLL L  LLLLLL  L L LLLL         LL                  L     L   L     
   142   21 B T  E     - R   0 195D  22  849   52  TTTTT T  TTTTTT  T T TTTT         TT                  T     T   T     
   143   22 B b  E     -QR 127 194D   0  850    2  CCCCC C  CCCCCC  C C CCCC         CC                  C     C   C     
   144   23 B R  E     -Q  126   0D 133  850   77  RRRRR R  RRRRRR  R R RRRR         RR                  H     H   H     
   145   24 B S  E >   -QS 125 148D  11  850   68  SSSSS S  SSSSSS  S S SSSS         SS                  S     S   S     
   146   25 B S  T 3  S+     0   0   81  850   27  SRSSS S  TSSNSS  S S SSSS         SS                  S     S   S     
   147   26 B T  T 3  S-     0   0   87  850   71  TTTTS T  TTTTTT  T T TTTT         TT                  T     T   T     
   148   27 B G  B <  S+S  145   0D  39  850   55  GGGGG G  GGGGGG  G G GGGG         GG                  G     G   G     
   149   28 B A        -     0   0   40  390   77  AAAAV A  AAAAAT  A A AAAA         AA                  A     A   A     
   150   29 B V        -     0   0    3  620   45  VVVVV V  VVVVVV  V V VIVV         VV                  V     V   V     
   151   30 B T    >   -     0   0   56  541   72  TTTTT T  TTTTTT  T T TTTT         FT                  T     T   T     
   152   31 B T  G >  S+     0   0   94  694   78  TTTTT T  TTTTIT  T T TTTT         FT                  T     T   T     
   153   32 B S  G 3  S+     0   0   84  802   62  SSSSS S  GSSSSS  R S SNSS         SS                  S     S   S     
   154   33 B N  G <  S-     0   0   13  673   73  NNNNN N  NNNNNN  N N NNNN         NN                  N     N   N     
   155   34 B Y    <   -     0   0   98  781   50  YYYYY Y  YYYYYY  Y Y YFYY         YY                  Y     Y   Y     
   156   35 B A        -     0   0    0  817   59  AAAAA A  AAAAAA  A A AAAA         VA                  A     A   A     
   157   36 B N  E     -L  212   0C   0  827   79  NNNNN N  NNNNNN  N N NNNN         SN                  N     N   N     
   158   37 B W  E     -LM 211 171C   0  849    0  WWWWW W  WWWWWW  W W WWWW         WW                  W     W   W     
   159   38 B V  E     -LM 210 169C   0  849   25  VVVVV V  VVVVVV  V V VVVV         VI                  I     I   I     
   160   39 B Q  E     -LM 209 168C  10  849   10  QQQQQ Q  QQQQQQ  Q Q QQQQ         QQ                  Q     Q   Q     
   161   40 B E  E     -LM 208 167C  20  849    8  EEQEE E  EEEQEE  E E EEEE         EE                  E     E   E     
   162   41 B K  E  >  - M   0 166C  68  849   50  KKKKK K  KKKKKK  K K KKKK         KK                  K     K   K     
   163   42 B P  T  4 S+     0   0   98  843   23  PPPPP P  PPPPPP  P P PPPP         HP                  A     A   A     
   164   43 B D  T  4 S-     0   0  148  846   16  DDDDD D  DDDDDD  D D DDDD         DD                  D     D   D     
   165   44 B H  T  4 S+     0   0   90  845   66  HHHHH H  HHHHYH  H H HHHH         HH                  H     H   H     
   166   45 B L  E  <  - M   0 162C  92  846   57  LLLLL L  LLLLLL  L L LLLL         LL                  L     L   L     
   167   46 B F  E     + M   0 161C   9  847   19  FFFFF F  FFFFFF  F F FFFF         FF                  F     F   F     
   168   47 B T  E     -JM 109 160C  56  843   61  TTTTT T  TTTTTT  T T TTTT         TT                  T     T   T     
   169   48 B G  E     + M   0 159C   1  848   64  GGGGG G  GGGGGG  A G GGGG         GG                  G     G   A     
   170   49 B L  E     +     0   0C   4  848   24  LLLLL L  LLLLLL  L L LLLL         LL                  I     I   I     
   171   50 B I  E     +NM 177 158C   0  848   19  IIIII I  IIMIII  I I IIII         II                  V     V   V     
   172   51 B G  E  >  +N  176   0C   0  849   33  GGGGG G  GGGGGG  G G GGGG         GG                  G     G   T     
   173   52 B G  T  4 S-     0   0    9  848   87  GGGGG G  GGRNGG  G R GDGG         GG                  D     G   G     
   174   53 B T  T  4 S+     0   0    9  849   68  TTTTT T  TTTTTT  T T TTTT         NT                  T     T   T     
   175   54 B N  T  4 S+     0   0  102  841   49  NNNNN N  NNNNNY  N N SNSS         FS                  S     S   N     
   176   55 B N  E  <  -N  172   0C  77  849   69  NNNNN N  NNNNNS  N I NNNN         NN                  N     N   N     
   177   56 B R  E     -N  171   0C 113  850   66  RRRRR R  RRRRRR  R R RRRR         RR                  R     R   R     
   178   57 B A    >   -     0   0    1  849   73  AAAAA V  AAPAAA  P P AVAA         AA                  A     A   A     
   179   58 B P  T 3  S+     0   0   97  849   39  PPPPP S  PPTPPP  P T PPPP         PP                  P     P   P     
   180   59 B G  T 3  S+     0   0   83  850   18  GGGGG G  GGGGGG  G G GGGG         GG                  G     G   G     
   181   60 B V  S <  S-     0   0   13  848   23  VVVVV V  VVVVVV  V V VVVV         VV                  A     A   A     
   182   61 B P    >   -     0   0   57  850    9  PPPPP P  PPPPPP  P P PPPP         PP                  P     P   P     
   183   62 B A  T 3  S+     0   0   77  850   59  AAAAA A  AAAAAA  A A VAVV         AV                  A     A   A     
   184   63 B R  T 3  S+     0   0   58  850    5  RRRRR R  RRRRRR  R R RRRR         RR                  R     R   R     
   185   64 B F  E <   +T  198   0D   4  850    1  FFFFF F  FFFFFF  F F FFFF         FF                  F     F   F     
   186   65 B S  E     -T  197   0D  51  849   17  SSSSS S  SSSSSS  S S SSSS         SS                  S     S   S     
   187   66 B G  E     +T  196   0D   9  850    4  GGGGG G  GGGGGG  G G GGGG         GG                  G     G   G     
   188   67 B S  E     -T  195   0D  41  850    7  SSSSS S  SSSSSS  S S SSSS         SS                  S     S   S     
   189   68 B L  E     -T  194   0D  59  835   79  LLLLL L  LLLLLL  L L LLLL         LL                  L     L   L     
   190   69 B I  E >   -T  193   0D  86  842   31  IIIII I  IIIIII  I I IIII         II                  L     L   L     
   191   70 B G  T 3  S-     0   0   67  850   18  GGGGG G  GGGGGG  G G GGGG         GG                  E     E   E     
   192   71 B N  T 3  S+     0   0  105  828   57  DDNDD D  DDDNDD  D D DDDD         GD                  G     G   G     
   193   72 B K  E <  S- T   0 190D  68  833   67  KKKKK K  KKKKKK  K K KKKK         KK                  K     K   K     
   194   73 B A  E     -RT 143 189D   0  838   81  AAAAA A  AAAAAA  A A AAAA         AA                  A     A   A     
   195   74 B A  E     -RT 142 188D   0  849   57  AAAAA A  AAAAAV  A A AAAA         AA                  A     A   A     
   196   75 B L  E     -RT 141 187D   0  850    2  LLLLL L  LLLLLL  L L LLLL         LL                  L     L   L     
   197   76 B T  E     -RT 140 186D  19  850   33  TTTTT T  TTTTTT  T T TTTT         TT                  T     T   T     
   198   77 B I  E     -RT 139 185D   0  849    5  IIIII I  IIIIII  I I IIII         II                  I     I   I     
   199   78 B T  E    S+R  138   0D  78  850   46  TTTTT T  TTTTTT  T T TTTT         TT                  T     T   T     
   200   79 B G  S    S-     0   0   15  850   57  GGGGG G  GGGGGG  G G GGGG         GG                  G     G   G     
   201   80 B A        -     0   0    0  849   51  AAAAA A  ATAAAA  A A AAAA         AA                  A     A   A     
   202   81 B Q    >   -     0   0   80  849   32  QQQQQ Q  QQQQQQ  Q Q QQQQ         QQ                  Q     Q   Q     
   203   82 B T  G >  S+     0   0   84  850   59  TTTTT T  TTTTTT  T T TTTT         TT                  I     I   I     
   204   83 B E  G 3  S+     0   0   99  850   17  EEEEE E  EEEEEE  E E EEEE         EE                  E     E   E     
   205   84 B D  G <   +     0   0    1  850    2  DDDDD D  DDDDDD  D D DDDD         DD                  D     D   D     
   206   85 B E    <   +     0   0   71  849   74  EEEEE E  EEEEEE  E E DEDD         ED                  E     E   E     
   207   86 B A  E    S- O   0 227C   3  850   14  AAAAA A  AAAAAA  A A AAAA         AA                  A     A   A     
   208   87 B I  E     -LO 161 226C  55  850   71  IIIII I  IMIIMV  I V MIMM         IM                  T     T   T     
   209   88 B Y  E     -LO 160 225C   0  850    0  YYYYY Y  YYYYYY  Y Y YYYY         YY                  Y     Y   Y     
   210   89 B F  E     -L  159   0C   5  848    8  FFFFF F  FFFFFF  F F FFFF         FF                  F     F   F     
   211   90 B b  E     -L  158   0C   0  849    1  CCCCC C  CCCCCC  C C CCCC         CC                  C     C   C     
   212   91 B A  E     -LP 157 221C   0  848   73  AAAAA A  AAAAVA  A A AAAA         AA                  S     S   S     
   213   92 B L  E     - P   0 220C   0  845   83  LLLLL L  LLLLLL  L L LLLL         LL                  L     L   L     
   214   93 B W  E     + P   0 219C  21  834   71  WWWWW W  WWWWWW  W W WWWW         WW                  W     W   W     
   215   94 B Y  E >  S- P   0 218C  33  829   88  YYYYY Y  YYYYYY  Y Y YYYY         YF                  Y     Y   Y     
   216   95 B S  T 3  S-     0   0  106  829   66  SSSSS S  SSSSSS  S S SNSS         SR                  S     S   N     
   217   96 B N  T 3  S+     0   0  105  824   81  NNNNN N  NNNNNN  n N TNTT         DN                  N     N   N     
   218   97 B H  E <   -P  215   0C  39  647   66  HHHHH H  HHHRHH  f H H.HH         HH                  H     .   H     
   219   98 B L  E     -P  214   0C   1  382   85    WWL W  WWLWWL  W L WWFF          F                        .   Y     
   220   99 B V  E     -P  213   0C  12  489   66    VVV V  VVVVVL  V V VVV           V                        H   I     
   221  100 B F  E     -P  212   0C  17  540   30    F   F  FF FFF  F   FF            F                        F   F     
   222  101 B G        -     0   0    1  481   35    G   G  GG GGG  G   GG            G                        G   G     
   223  102 B G        -     0   0   51  513   58    G   G  GG GGG  G   GG            G                        G   G     
   224  103 B G        -     0   0    8  528   33    G   G  GG GGG  G   GG            G                        G   G     
   225  104 B T  E     - O   0 209C   0  550   33    T   T  TT TTT  T   TT            T                            T     
   226  105 B K  E     -kO 130 208C  82  547   67    K   K  KK KKK  K   KK            K                                  
   227  106 B L  E     -kO 131 207C   0  546   44    L   L  LL LLL  L   LL            V                                  
   228  107 B T  E     -k  132   0C  34  614   65    T   T  TT TTT  T   TT            T                                  
   229  108 B V  E     -k  133   0C   3  593   35    V   V  VV VVV  V   VV            V                                  
   230  109 B L              0   0  120  399   31    L   L  LL LLL  L   LL            L                                  
   231  110 B G              0   0   62  207   39    G   G  GG GG   G   GG            G                                  
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 A E              0   0  185  771   30  QQQQ   QE Q     Q QQQEQQEEQQEQ   QEQE      QEQQQE QEQE          EQQEEE
     2    2 A V        +     0   0   18  834   19  VVVV   VV V     V VVVVVVVVVVVV   VVVV      VVVVVV VVVV          VVVVVV
     3    3 A Q  E     -A   25   0A  90  836   34  QQQQ   QQ Q     Q QQQQQQQKQQQQ   QQQQ      QKQQQQ QQNQ          QQQQQQ
     4    4 A L  E     -A   24   0A  13  881    3  LLLL   LL L    LL LLLLLLLLLLLL   LLLL      LLLLLL VLLL          LLLLLL
     5    5 A Q  E     -A   23   0A 107  882   70  QQQQ   QQ Q    QQ KQQQQQQQQQQL   QQQQ      QQQQQQ QQLQ          QLKQQQ
     6    6 A Q  E     -A   22   0A  14  887   31  QQQQ   QQ Q    QQ QQQQQQQQQQQQ   QQQQ      QQQQQQ QEQQ          QQQQQQ
     7    7 A S        -     0   0   33  892   13  SPPS   SS P    PL SPPSSSSSSSSP   PSSS      SSSSSS SSSS          SSSSSS
     8    8 A G        -     0   0   52  907   11  GGGG G GG GGG  GG GGGGDDGGGGGG   GGGG      GGGGGG GGRG          GGGGGG
     9    9 A A        -     0   0   80 1179   51  ATTP A APPSAAAATAAATAPATPDTAAT APAPAPAAAA ATDAAAP APAPPAAAAP AAAPPAPPA
    10   10 A E  E     -d  116   0B  68 1189   46  EEEEEE EEQVEEEEEEEEEEEEEEEEEEE EEEEEEEEEE EEEEEEE EHAEEEEEEE EEEEEEEEE
    11   11 A L  E     +d  117   0B 130 1195   22  LLLLLL LLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLL LLLLLLLLLLLLLLLLLL LLLLLLLLL
    12   12 A V  E     -d  118   0B  28 1197   47  VVVVVV VVVVVVVVVVAVVVVVVQVVVVV AVVVVVVAAA VVVAAAVVAVVVVVAAAV VMVVVVVVV
    13   13 A K    >   -     0   0  145 1201   50  KKKKKK KKRRKKRKKKRKKKKKKRRKKRK RKRKMKRKRKKRKRKKSKRRKKKKRRRRKKKKRKKKKKK
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPPP PPPPPPPPPPPPPPPPPPPPPAP PPPPPPPPPPPPPPPPPLPPPPPPPPPPPPPPPTPPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28  GGGGGG GGGGGGGGGGGGGGGGGGGAGGG GGGGGGGGGGGGGGGGGGGWGGGGGGGGGGGGGGGGGGG
    16   16 A A    <   -     0   0   36 1213   63  SAAAAA TAATAAAAAAAAAAAAAAASSSA AATAAATAAAASSATSAPAAAAAAAAAAAAAAAAAADDA
    17   17 A S        -     0   0   66 1210   29  SSSSSS SSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSLSSSSSLSSSSSSSSS
    18   18 A V  E     - B   0  83A  10 1213   32  VVVVVV VVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVLVVVVVVVVVVVVVVVVVVVVVVVVVV
    19   19 A K  E     - B   0  82A 119 1211   53  KKKKKK KKKKKKKKKKKKKKKKKKKKKKN KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    20   20 A L  E     - B   0  81A   0 1214   21  MLLIMV LMILVMLLLLLLLLMIILMILML LMLMMMVMLMMILILIFILLMLMILLLLVILILMIIMML
    21   21 A S  E     - B   0  80A  31 1215   35  SSSSSS SSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCCC CCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70  KKKKKK KKKKKKKKQKKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKT
    24   24 A A  E     +A    4   0A   2 1216   49  AAAAAA AAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
    25   25 A S  E     +A    3   0A  49 1216   12  SSSSSS SSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSLSSSSSSTLSSSSSS
    26   26 A G  S    S+     0   0   56 1215    3  GGGGGG GGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    27   27 A Y  S    S-     0   0   39 1216   33  YYYYYY YYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYF
    28   28 A T    >   -     0   0   90 1216   52  TTTATT TTSTTTTTTTTTTTTTTTTTTTT TTTTTTATTTTATTTTTSTNTTTTTTTTATTTTTTTTTN
    29   29 A F  G >  S+     0   0   13 1216   27  FFFFFF FFFFFFFFFFFFFFFFFFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFI
    30   30 A T  G 3  S+     0   0   40 1216   55  TTTSTT TTTTTTTTTTTNTTTTTTTTTTT TTTTTTTTTTTSTTTTTTTNTTTTTTTTTTTSTSTTTTK
    31   31 A S  G <  S+     0   0   23 1216   57  SSSSSS SDSSSSDSSSSSSSDDDEDSESS SSSDDDNGSSSSDNSSSGSSNDDSDSSSSSESDDSDDSD
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YYYSYY NYYYYYYYFYYYYYYHHYYNYYY YYYYHYYYYYYYYYYYYYSYYYYYYYYYYYYYYYYYYYT
    33   33 A W  E     -E   99   0B  40 1148   92  YWWWVW HYWWWWEYWWWIWWYAAYAYYGW WVWYWYLWWWVWAAYDWYWWVYYDEWWWNDIWEYYYYVY
    34   34 A M  E     -EF  98  51B   0 1206   49  IMMMMM MMMMMIMMMMMMMMMIIMMMIIM MMMMIMIMMMMMMMIIMMMMMIMIVMMMMIITMMIIMMM
    35   35 A H  E     -EF  97  50B   0 1212   72  YHHNHH NKHHHTHYHQLHHQKHHYHHDNH HHHKHKEHQHHNQYYSQHHQHHKNHQQQYNHEHHHNDHH
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWWW WWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17  IVVVVV IVVAVVVVVVVVVVVVVVVIVVI VVVVVVVVVVVVVVVIVVAVVVVVVVVVVVVVVVVVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22  KKKKKK KKKKKKKKKKKKKKKKKKKRKKR KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQQ QQQQQKQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
    40   40 A R    >   -     0   0   35 1216   71  RRRRKR TSRRRRTRRRRRRRSKRRSQRRR RKRSRSRRRRKRRSRTRSRRMSSRTRRRSRRRTSRRSKR
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPPPP TPPPPPPPPPPPPPHPPPPPPPP PPPHPHPPPPPPPPPTPHPPPHHPPPPPHPSPPHPPH.P
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGGGG GGGGGGVGGGGGGGGEEKGGGGG GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGVGGGGLE
    43   43 A R  S <  S-     0   0  156 1216   43  QQQKQQ QKQQQQHQQQQQRQKQQQQNQQQ QQQKQKQQQQQQQQQQQKQQQKKQHQQQKQQHHKQQKEQ
    44   44 A G        -     0   0   16 1215   36  GGGGGG GSGGGGGGGGGGGGSGGGGGGGG GGGSGSGGGGGGGGGGGSGGGSSGGGGGSGGGGSGGSGG
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLLL LLLLLLLLLLLLLPLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEEE EEEEEEEEEEEEEEEEEEEEEEE EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEVEEEE
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWWW WWWWWWWWWWWWWWWWWLWWWWW WWWWWWWWWWWWWWWYWWWWWWWWWWWWWWWWWWWWWWW
    48   48 A I  E     -     0   0B   0 1215   31  IIIIII IIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
    49   49 A G  E     -FG  36  60B   0 1216   35  GGGGGG GGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    50   50 A R  E     -FG  35  59B  32 1216   94  RNNRYR IDMERDAENEAYREDYYRTWDYG AYVDADVYAYYQYTYYAEEAYYDWAAAAYWWEAYWKYYR
    51   51 A I  E     -FG  34  58B   0 1207   17  IIIIII IIIIIIIIIIIFIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIFIIIIIIII
    52   52 A D     >  -     0   0   26 1212   86  GNNYNH NNDHHYHNYDYSDDNSSDIYDNN YNDNENNNYNNYLIYNYNHYHNNYHYYYDYYLHYYGYND
    53   53 A P  T  4 S+     0   0    0 1212   83  PPPPPP PPPPPPPPPPPPPPPPPPPPPPP PPPPTPPPPPPPPPPTPPPPPPPPPPPPPPPPPPPPPLP
    54   54 A N  T  4 S-     0   0   96 1213   69  GSSGYS GNSNSGGSSSGYNSNGGELGEGS GYSNSNGSGSYGWLGGGYNGYNNGGGGGYGGGGNGGNYA
    55   55 A G  T  4 S-     0   0   69 1216   57  SNNDND SNDCDSSNNDDNSDNNNDINNNN DNDNDNSTDTNDNINSDNSDNSNDSDDDTDSSSNDSNNN
    56   56 A G     <  +     0   0   25  915   61  GGGGDS GGSGSGGGGSGDGIGGGGDGGGG GDSGSGGGGGDGGDGGGGGGDGGGGGGGGGGGGGGGGDG
    57   57 A G        -     0   0   43 1195   77  DGGDGD GGENDTGGDYDDDYGDDSTNDYG DGYGYGGYDYGDVTGGEGHDGYGSGDDDGSSSGGNSGGN
    58   58 A T  E     -G   51   0B  62 1209   46  TTTTTT TTTITTTTTTTTTTTIITTTTIT TTTTTTTTTTTTTTTTTTTTSTTTTTTTTTITTNTTTTT
    59   59 A K  E     -G   50   0B  89 1212   88  NNNNKN SSRNNNANNNRKKDSKKDSKANN RENSTSNEREKNDSYYRSNSKNSKARRRSKKNAGKYSKK
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYYYY YYLYYYYFYYYCFYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
    61   61 A N    >>  -     0   0   12 1216   63  NNNNNN NNNNNNNNNNTNNNNNNVNNNNN ANNNNNNNTNNNNNSNSNNTDNNNNTTTNNNNNNNNNND
    62   62 A E  G >4 S+     0   0  148 1216   64  EEEGEQ VQQEQEQEEQQEEQQEEEQQEEE QEQQHQEQQQEGQQEEQQEQDEQEQQQQQEEEQQEEQEP
    63   63 A K  G 34 S+     0   0  109 1216   64  KKKKKK KKKKKKKKKKKKKEKKKKKKKKK YKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
    64   64 A F  G X> S+     0   0    5 1216   45  FFFFFF FFFFFFFFFFFFFFFFFFFFFFF FFFFFFFFFFFFFFFFVFFFFFFFFFFFFFFFFFFFFFF
    65   65 A K  T << S+     0   0  156 1216   40  KKKKKK KKKKKKKKKKKKRKKKKKKDKKK KKKKKKKKKKKKKKKKKKKREKKKKKKKKKKKKKKKKKQ
    66   66 A S  T 34 S+     0   0  108 1216   35  GSSGGG GGDGGSGSSGGGTGGGGNGGGGS DGGGGGGDGDGGGGGGGGGGGSGGGGGGGGDGGGGGGGG
    67   67 A K  T <4 S+     0   0   33 1214   21  KKKKKK KKKKKKKKKKKKKKKKKKKKRKK RKKKKKKKKKKKKKKKKKKKKKKKKKKKRKKKKKKKKKK
    68   68 A A  E  <  -C   83   0A   2 1216   69  AAAAAA AAAAAAAAAAAAAAAAAAAAATA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATAAAA
    69   69 A T  E     -C   82   0A  58 1216   37  TTTTTT TTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
    70   70 A L  E     +C   81   0A   7 1216   27  FLLLLL LLLLLLLLLLLLLLLLLLLLMLL VLLLLLLLLLLLLLFLLLLLLLLLLLLLLLLFLLLLLLI
    71   71 A T  E     -C   80   0A  57 1213   47  TTTTTT TTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
    72   72 A V  E     -C   79   0A  28 1216   71  VVVASV VVVVVVAVVVAAVVVAAAAAAVV ASVVVVAAAASAVAAVAVVASVVAAAAAVAAAAVAAVSA
    73   73 A D  E   > -C   78   0A  69 1216    7  DDDDDD DDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62  KKKKKK KKKTKTKKKTKKKTKKKTKKTKK KKTKKKKKKKKKTKTKKTTKKKKKKKKKKKKTKKKKKKT
    75   75 A P  T 3 5S+     0   0  122 1215   37  SSSSSS SSSSSSSSYSSSPSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
    76   76 A S  T 3 5S-     0   0   37 1216   65  SSSSSS SSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSSSSS
    77   77 A S  T < 5 +     0   0   24 1216   48  SSSSSS SSSSSSSSSSSSSSSSSNNSNSS SSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSNSSSSSSN
    78   78 A T  E   < -BC  23  73A   8 1216   64  TTTTTT TTTTTTTTTTTTTTTTTTTTTTA TTTTTTTATTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
    79   79 A A  E     -BC  22  72A   0 1207   67  AAAAAA AAAAAAAAAAAAVAAAAAAAAAT AAAAVAAAAAAAAAAAAAAAAAAAAAAAAAVAAAAAAAA
    80   80 A Y  E     -BC  21  71A  61 1209   36  YCYYYY FYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYYFYYYYYYYYYYYYYYYYYYYYYYY
    81   81 A M  E     -BC  20  70A   0 1212    9  MTMMMM MMMVMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMVMMMMMMMMMMMMMMMMMMML
    82   82 A Q  E     -BC  19  69A  69 1215   43  QQQQEQ QQQDQQEQQQQEHQQQQQEQEQQ QDQQQQQQQQEQEELQQEDQEEQQEQQQHQEQEEFQEEQ
    83   83 A L  E     -BC  18  68A   0 1215   14  LLLLLL LLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    84   84 A S        +     0   0   32 1215   56  SSSSSS SNSSSSSSSSSSRSNNNSSSSRS NSSNSNSSSSSSSSGSSHSSSSNSSSSSNSSSSRSSHSS
    85   85 A S  S    S-     0   0   89 1216   25  SSSSSS SSSSSSSSSSSSSSSSSSRSRST SSSSSSSSSSSNRRSSSSSSSRSSSSSSSSRSSSSSSSS
    86   86 A L        +     0   0    2 1216   15  LLLLLL LLPLLLLLLLLLLLLLLLLLLLP LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    87   87 A T    >   -     0   0   61 1215   68  TTTTTT TTTTTTTTTTATTTTTTTTTTTT ATTTTTTTATTTTTTTATTATTTTTAAATTTTTTTTTTT
    88   88 A S  G >  S+     0   0   72 1216   59  PSSSSS PSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSPPSSSSSSSSSSSSSSSSSSSSSSS
    89   89 A E  G 3  S+     0   0  107 1216   21  EEEEEE EEEEVEEEEEEEEEEEEEEEEEE EEEEEEDEEEEEDEEEEEEEEEEEEEEEEEGEEEEEEEE
    90   90 A D  G <  S+     0   0    7 1216    3  DDDDDD DDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDDNDDDDDNDDDDDDDDD
    91   91 A S    <   +     0   0   31 1216   34  TSSSSS SSSSSSSSSSSSSSSSSTSSSSS SSSSSSSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSST
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAAA AAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAVAAAALAAAAAAAAAAAAAAAAAAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48  VVVVVV VVVVVVVVVVVVVVVVVTVVVVV VVVVVVVVVVVVVVYVVVVVVTVVVVVVVVVVVVVVVVV
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYYYY YYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYDYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3  YYYFYY YYYYYYYYYYYYYYYFFFYFYFY YYYYYYFYYYYFYYFYYYYYYYYFYYYYFFFYYYFFYYY
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCCC CCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAAAA AAAAAATTTAAATAAKKAAAAAA AAAAAAAAASAAAAAAAAAAATAATAAAAAAATATAAAA
    98   98 A R  E     -E   34   0B  13 1196   38  RRRRRI RRR IKRRRSRRRRRRRRRRSRR RRPRRRRTRLRRRRRRRRRRRRRRARRRRRRRRRRRRR 
    99   99 A M  E     -EI  33 107B   5 1101   82   NR DS  DS SMFSKHRGRRD      SW SSTDLDDLDRGW    T QRE DRRWDDWSHGYGGSGW 
   100  100 A W  E >   -E   32   0B  89 1101   89   WG GE  YN EGYWDYDYGYK      HD TTVRGRGSGFLD    F RTN YFALIYGVETYyGGDA 
   101  101 A Y  T 3  S+     0   0  112  572   91   DW NI  SY IWYYYYY.LYD      YY YRDYGYNTNDQY    . RVG DYTRTGYRAGYy.YYI 
   102  102 A Y  T 3  S-     0   0  133  629   92   FE YR  YY RDGFYGG.FGY      YE NGDYPWYMYYIG    . NGN WYYATSYPNEYS.DSY 
   103  103 A G  S <  S+     0   0   38  705   79   DA RG  Vg GSSDgsv.yGY      gG GYWAYYYIDWTS    . YGF YDYMvSGrWYAY.YYy 
   104  104 A T        -     0   0   32  784   66   .. Gy  .s yNS.ssd.dQF      sD HY.M.F.TY..S    . A.Y F...y..iD..DGDYd 
   105  105 A Y        +     0   0   81  679   93   .. .n  .y n.Y...G.d..      .R SY......Y...    . ... .Y..YY.....H..Sn 
   106  106 A Y        -     0   0   32  842   66   .. .Y  .Y YYY...Nyy..      yY PAY.Y...A.WC    Y .Y. .d..AG..Y..YwWYA 
   107  107 A F  E     +I   99   0B   0  885   48   .M FV  FF VVF.f.Ffm..      fF FMF.F.FMM.FF    F MFF .fF.MFIfFFMFfFGM 
   108  108 A D  E     +     0   0B  25  997   46   .D DD  DD DDD.VDDDDDD      DD DDDDDDDDD.AD    D DDD DADDDADDDDDDDAAD 
   109  109 A Y  E     -J  168   0C 108 1059   61   YY YY  YY YYYVYYYYYYY      YV YYVYYVYYY.YY    S YYY VYYYYYYYYYYYYYYY 
   110  110 A W  E     -I   97   0B  23 1092    2   WW WW  WW WWWWWWWWWWW      WW WWWWWWWWW.WW    W WWW WWWWWWWWWWWWWWWW 
   111  111 A G        -     0   0    3 1067   15   GG GG  GG GGGGGGGGGGG      GG GGGGGGGGGGGG    G GGG GGGGGGGGGGGGGGGG 
   112  112 A Q        -     0   0  141 1047   41   QQ QQ  QQ QQQAQQQQQQQ      QT QQTQQAQQQQQQ    Q QQQ AQQQQQQQQQQQQQQQ 
   113  113 A G        -     0   0   20 1013   12   GG G   GG   GGGGGGGGG      GG GGGGGGGGGGGG    G GGG GGGGGGGGGGGGGGGG 
   114  114 A T  E     - H   0  94B   2  996   31   TT T   TT   TTTTTTTTT      TT TTTTTTTTTTTT    T TTT TTTTTTTTTTTTTTTT 
   115  115 A T  E     - H   0  93B  60  979   76   TS T   TT   TTLTTTSST      PT TSTSTTTSSTLT    T STT TLTSSLATTTSTTLLS 
   116  116 A L  E     -dH  10  92B   1  972   19   LV L   LL   LVVLLIVVL      LV LVVVVVLVVLVL    L VLL VVLVVVLLLLVILVVV 
   117  117 A T  E     -d   11   0B  57  953   21   TT T   TT   TTTTTTTTT      TT TTTTTTTTTTTT    T TTT TTTTTTTTTTTTTTTT 
   118  118 A V  E     +d   12   0B   4  935    8   VV V   VV   VVVVVVVVV      VV VVVVVVVVVVVV    V VVV VVVVVVVVVVVVVV   
   119  119 A S              0   0   64  917   10   SS S   SS   SSSSSSSSS      SS SSSSSSSSSSSS    S SSS SSSSSSSSSSSSSS   
   120  120 A S              0   0  122  885   21   SS S   SS   SSASSSSSS      SS SSSSSSSSSSAS    S SSS SASSSASSSSSSSA   
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32        Q                       Q                                       
   123    2 B A        -     0   0   19  713   70        A                       A                                       
   124    3 B V        -     0   0   84  765   49        V                       V                                       
   125    4 B V  E     -Q  145   0D  10  820   26        V                       V                                       
   126    5 B T  E     +Q  144   0D  69  829   11        T                       T                                       
   127    6 B Q  E     -Q  143   0D  18  832    2        Q                       Q                                       
   128    7 B E        -     0   0   59  833   63        E                       E                                       
   129    8 B S  S    S+     0   0  101  841   38        S                       T                                       
   130    9 B A  E     -k  226   0C  59  842   50        A                       S                                       
   131   10 B L  E     -k  227   0C  57  847   76        L                       L                                       
   132   11 B T  E     +k  228   0C  84  848   77        T                       T                                       
   133   12 B T  E     -k  229   0C  18  848   68        T                       T                                       
   134   13 B S    >   -     0   0   55  849   70        L                       T                                       
   135   14 B P  T 3  S+     0   0   61  848   65        P                       P                                       
   136   15 B G  T 3  S+     0   0   46  850    7        G                       G                                       
   137   16 B E    <   -     0   0  108  850   56        G                       G                                       
   138   17 B T  E     - R   0 199D  88  850   66        T                       T                                       
   139   18 B V  E     - R   0 198D  14  850   33        V                       V                                       
   140   19 B T  E     - R   0 197D  53  849   41        T                       T                                       
   141   20 B L  E     - R   0 196D   0  849   25        L                       L                                       
   142   21 B T  E     - R   0 195D  22  849   52        T                       T                                       
   143   22 B b  E     -QR 127 194D   0  850    2        C                       C                                       
   144   23 B R  E     -Q  126   0D 133  850   77        H                       G                                       
   145   24 B S  E >   -QS 125 148D  11  850   68        S                       S                                       
   146   25 B S  T 3  S+     0   0   81  850   27        S                       S                                       
   147   26 B T  T 3  S-     0   0   87  850   71        T                       T                                       
   148   27 B G  B <  S+S  145   0D  39  850   55        G                       G                                       
   149   28 B A        -     0   0   40  390   77        A                       A                                       
   150   29 B V        -     0   0    3  620   45        V                       V                                       
   151   30 B T    >   -     0   0   56  541   72        T                       T                                       
   152   31 B T  G >  S+     0   0   94  694   78        T                       T                                       
   153   32 B S  G 3  S+     0   0   84  802   62        S                       S                                       
   154   33 B N  G <  S-     0   0   13  673   73        N                       N                                       
   155   34 B Y    <   -     0   0   98  781   50        Y                       Y                                       
   156   35 B A        -     0   0    0  817   59        A                       A                                       
   157   36 B N  E     -L  212   0C   0  827   79        N                       S                                       
   158   37 B W  E     -LM 211 171C   0  849    0        W                       W                                       
   159   38 B V  E     -LM 210 169C   0  849   25        I                       V                                       
   160   39 B Q  E     -LM 209 168C  10  849   10        Q                       Q                                       
   161   40 B E  E     -LM 208 167C  20  849    8        E                       Q                                       
   162   41 B K  E  >  - M   0 166C  68  849   50        K                       K                                       
   163   42 B P  T  4 S+     0   0   98  843   23        A                       P                                       
   164   43 B D  T  4 S-     0   0  148  846   16        D                       Y                                       
   165   44 B H  T  4 S+     0   0   90  845   66        H                       Q                                       
   166   45 B L  E  <  - M   0 162C  92  846   57        L                       V                                       
   167   46 B F  E     + M   0 161C   9  847   19        F                       P                                       
   168   47 B T  E     -JM 109 160C  56  843   61        T                       Q                                       
   169   48 B G  E     + M   0 159C   1  848   64        G                       G                                       
   170   49 B L  E     +     0   0C   4  848   24        I                       V                                       
   171   50 B I  E     +NM 177 158C   0  848   19        V                       I                                       
   172   51 B G  E  >  +N  176   0C   0  849   33        G                       G                                       
   173   52 B G  T  4 S-     0   0    9  848   87        A                       G                                       
   174   53 B T  T  4 S+     0   0    9  849   68        T                       T                                       
   175   54 B N  T  4 S+     0   0  102  841   49        S                       S                                       
   176   55 B N  E  <  -N  172   0C  77  849   69        N                       N                                       
   177   56 B R  E     -N  171   0C 113  850   66        R                       R                                       
   178   57 B A    >   -     0   0    1  849   73        A                       V                                       
   179   58 B P  T 3  S+     0   0   97  849   39        P                       P                                       
   180   59 B G  T 3  S+     0   0   83  850   18        G                       G                                       
   181   60 B V  S <  S-     0   0   13  848   23        A                       V                                       
   182   61 B P    >   -     0   0   57  850    9        P                       P                                       
   183   62 B A  T 3  S+     0   0   77  850   59        A                       A                                       
   184   63 B R  T 3  S+     0   0   58  850    5        R                       R                                       
   185   64 B F  E <   +T  198   0D   4  850    1        F                       F                                       
   186   65 B S  E     -T  197   0D  51  849   17        S                       S                                       
   187   66 B G  E     +T  196   0D   9  850    4        G                       G                                       
   188   67 B S  E     -T  195   0D  41  850    7        S                       S                                       
   189   68 B L  E     -T  194   0D  59  835   79        L                       L                                       
   190   69 B I  E >   -T  193   0D  86  842   31        L                       L                                       
   191   70 B G  T 3  S-     0   0   67  850   18        E                       G                                       
   192   71 B N  T 3  S+     0   0  105  828   57        G                       D                                       
   193   72 B K  E <  S- T   0 190D  68  833   67        K                       K                                       
   194   73 B A  E     -RT 143 189D   0  838   81        A                       A                                       
   195   74 B A  E     -RT 142 188D   0  849   57        A                       A                                       
   196   75 B L  E     -RT 141 187D   0  850    2        L                       L                                       
   197   76 B T  E     -RT 140 186D  19  850   33        T                       T                                       
   198   77 B I  E     -RT 139 185D   0  849    5        I                       I                                       
   199   78 B T  E    S+R  138   0D  78  850   46        T                       T                                       
   200   79 B G  S    S-     0   0   15  850   57        G                       G                                       
   201   80 B A        -     0   0    0  849   51        A                       A                                       
   202   81 B Q    >   -     0   0   80  849   32        Q                       Q                                       
   203   82 B T  G >  S+     0   0   84  850   59        I                       T                                       
   204   83 B E  G 3  S+     0   0   99  850   17        E                       E                                       
   205   84 B D  G <   +     0   0    1  850    2        D                       D                                       
   206   85 B E    <   +     0   0   71  849   74        E                       E                                       
   207   86 B A  E    S- O   0 227C   3  850   14        A                       A                                       
   208   87 B I  E     -LO 161 226C  55  850   71        T                       T                                       
   209   88 B Y  E     -LO 160 225C   0  850    0        Y                       Y                                       
   210   89 B F  E     -L  159   0C   5  848    8        F                       Y                                       
   211   90 B b  E     -L  158   0C   0  849    1        C                       C                                       
   212   91 B A  E     -LP 157 221C   0  848   73        S                       V                                       
   213   92 B L  E     - P   0 220C   0  845   83        L                       L                                       
   214   93 B W  E     + P   0 219C  21  834   71        W                       W                                       
   215   94 B Y  E >  S- P   0 218C  33  829   88        Y                       F                                       
   216   95 B S  T 3  S-     0   0  106  829   66        S                       S                                       
   217   96 B N  T 3  S+     0   0  105  824   81        G                       N                                       
   218   97 B H  E <   -P  215   0C  39  647   66        R                       H                                       
   219   98 B L  E     -P  214   0C   1  382   85        Y                       F                                       
   220   99 B V  E     -P  213   0C  12  489   66        I                                                               
   221  100 B F  E     -P  212   0C  17  540   30        F                                                               
   222  101 B G        -     0   0    1  481   35        G                                                               
   223  102 B G        -     0   0   51  513   58        G                                                               
   224  103 B G        -     0   0    8  528   33        G                                                               
   225  104 B T  E     - O   0 209C   0  550   33                                                                        
   226  105 B K  E     -kO 130 208C  82  547   67                                                                        
   227  106 B L  E     -kO 131 207C   0  546   44                                                                        
   228  107 B T  E     -k  132   0C  34  614   65                                                                        
   229  108 B V  E     -k  133   0C   3  593   35                                                                        
   230  109 B L              0   0  120  399   31                                                                        
   231  110 B G              0   0   62  207   39                                                                        
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 A E              0   0  185  771   30  QE        QEQEEE      QE QQQQEE      QQE           EEQQQQEQQQ         
     2    2 A V        +     0   0   18  834   19  VV        VVVVVA      VV VVVVVV      VVV           IVVVVVVVVV         
     3    3 A Q  E     -A   25   0A  90  836   34  QQ        QQQQQQ      KQ HQQQQQ      QQQ           QQQQQKQKQQ         
     4    4 A L  E     -A   24   0A  13  881    3  LL        LLLLLL      LL LLLLLL      LLL           LLLLLLLLLL         
     5    5 A Q  E     -A   23   0A 107  882   70  QQ        QQQQQQ      LQ QQQQQQ      QKQ           HHQQQHQQVV         
     6    6 A Q  E     -A   22   0A  14  887   31  QQ        QQEQQQ      QQ QQQQQQ      QQQ           QQQQQQQEQQ         
     7    7 A S        -     0   0   33  892   13  PS        PSSSSS      SS SPSSSS      CSS           SSPSPSSSSS         
     8    8 A G        -     0   0   52  907   11  GG        GGGGGG      GG GGGGGG      GGG           GGGGGGGGGG         
     9    9 A A        -     0   0   80 1179   51  APAP    AASAPPPAPA AAPAP AAASPA PAPTAAAA  PATTAAAAPPPAAAPATAA  APAAAAP
    10   10 A E  E     -d  116   0B  68 1189   46  EEEE D  EEVEEEEEEE EEEAE EEEEEE EEEEEEEE  EEEEEEEEEEEEEEEEEEE  EEEEEEE
    11   11 A L  E     +d  117   0B 130 1195   22  LLLL L LLLLLLVLLLL LLLLV LLLLLL LLLLLLLL  LLLLLLLLQLLLLIVLLVV  LLLLLLL
    12   12 A V  E     -d  118   0B  28 1197   47  VVMV V VAVVVVGRVVM VVEVG VVVVEV VMVMAVVV  EVMMMMMMVVVVMVVVARR  VVVMVVI
    13   13 A K    >   -     0   0  145 1201   50  KKKK K RRRRRKRRRKK RRKKR RKKRKK RKKKRKRR  KRKKKKKKKKERKRKRKKK  KKKKRKK
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPPP PPPPPPPPPPP PPPPP PPPPPP PPPPPPPP  PPPPPPPPPPAPPPPSPPP  PPPPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28  GGGGGGGGGGGGGGGGGG GGGGG GGGGGG GGGGGGGG  GGGGGGGGGGGGGGGGGGG  GGGGGGG
    16   16 A A    <   -     0   0   36 1213   63  AAAATAAAAAASASSTAAAAAAAS TVSAAA AAAAATAA  ATAAAAAAATAVAAAAAAA  AAAAAAA
    17   17 A S        -     0   0   66 1210   29  SSSSSSSSSSSSSSSSSSSSSSSS SSSSSS SSSSSPSL  SSSSSSSSSSSSSSSSASS  SSSSSSS
    18   18 A V  E     - B   0  83A  10 1213   32  VVVVVVVVVVVVVVVVVVVVVVVV VVVVVV VVVVVVVV  VVVVVVVVVVVVVVVVVVV  VVVVVVV
    19   19 A K  E     - B   0  82A 119 1211   53  QKKKKKKKKKKKKKKKKKKKTKKK KKKKKK KKKKKKKK  KKKKKKKKKKKKKKKKKKK  KKKKTKK
    20   20 A L  E     - B   0  81A   0 1214   21  LIIVVLLLLLLLMILIMIILLIMI MMILIL MIIILMLL  IIIIMIIIIMLLILLLMVV  LILILIM
    21   21 A S  E     - B   0  80A  31 1215   35  SSSSSSSSSSSSSSSSSSSSSSSS SSSSSS SSSSSSSS  SSSSSSSSSSSSSSSSSSS  SSSSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCCCCCCCCCCCCCCCCCCCCC CCCCCC CCCCCCCC  CCCCCCCCCCCCCCCCCCC  CCCCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70  KKKKKKKKKKKKKKKKKKKKKKKK KKKKKT KKKKKKKK  KKKKKKKKKKKKKKKTKKK  TKTKKKK
    24   24 A A  E     +A    4   0A   2 1216   49  AAAAAAAAAAATAAAAAAAAAAAA AAAAAA AAAAAVAA  AAAAAAGATAAAATAAAAA  ATAAAAA
    25   25 A S  E     +A    3   0A  49 1216   12  SSTSSSSSSLSSSSSASTTLSSSS VSSSSS STSTSSSS  SSTTTTTTSSSSTSSSSSS  SSSTSSS
    26   26 A G  S    S+     0   0   56 1215    3  GGGGGGGGGGGGGGGGGGGGGGGG GGGGGG GGGGGGGG  GGGGGGGGGGGGGGGGGGG  GGGGGGG
    27   27 A Y  S    S-     0   0   39 1216   33  HYYYYYYYYYYYYYYYYYYYYYYY YYYYYF YYYYYYYF  YYYYYYYYYYYYYYYFYYY  FYFYYYY
    28   28 A T    >   -     0   0   90 1216   52  TTTAATTTTTTTKTSTTTTTTSTT TTTTSN TTSTTTIN  STTTTTTTTTTTTTINTTT  NTNTTTT
    29   29 A F  G >  S+     0   0   13 1216   27  FFFFFFFFFFFFFFIFFFFFFFFF FFFFFI FFFFFFFI  FFFFFFFFFFFFFFFIFFF  IFIFFFF
    30   30 A T  G 3  S+     0   0   40 1216   55  TTSTTTTTTTTTSTTTTSSTITTT TTTTTK TSTSSTTK  TTSSSSSSTTGTSTTKTTT  KTKSTTT
    31   31 A S  G <  S+     0   0   23 1216   57  NDSSNSESDDSSSDDNSSSDDGDD NSNTGD DSGSDSSD  GNSSVSNDENDNSDSDDSS  DEDSDDA
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YYYYYYYSYYYYSYYYYYYYYYYY YYYYYT YYYYYYYY  YYYYYYYYYYYYYYYYYYY  TYTYYHY
    33   33 A W  E     -E   99   0B  40 1148   92  WYWNLWIWYEWYVVLWVWWEENWV WWDWNY VWYWYVWY  NWWWWWWWTYYWWWDYWWW  YTYWEAV
    34   34 A M  E     -EF  98  51B   0 1206   49  IMIMIIIMIMMIMMMIMIIMMMVM IIIMMM IIMIIIIM  MLIIIIIIIMVMIMIMMMM  MMMIMII
    35   35 A H  E     -EF  97  50B   0 1212   72  HNEYENHHNHHNHNHGHEEHHNSN GNHHNH SEHENSHH  NGEEEEEEHHHNDNDHHHH  HHHEHHH
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWWWWWWWWWWWWWWWWWWWWW WWWWWW WWWWWWWW  WWWWWWWWWWWWWWWWWWW  WWWWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17  VVVVVIVAVVVVVVVVVVVVVVVV VVIVVV VVVVVIVV  VVVVVVVVVVVVVVVVVVV  VVVIVVV
    38   38 A K  E     -EF  94  46B   7 1216   22  KKKKKKKKKKKKKKKKKKKKKKKK KRKKKK KKKKNKKK  KKKKKKKKKRKKKKRKKRR  KKKKKKK
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQQQQQQQQQQHEQQQQQQQQ QQQQQQ QQQQQQQQ  QQQQQQQQQQQQQQQQQQQ  QQQQQQQ
    40   40 A R    >   -     0   0   35 1216   71  RSRSRRRRRTRRKSRRKRRTTSSS RRQRSR RRSRRTRR  SRRRRRRRSSSRRRTRRAA  RSRRTKK
    41   41 A P  T 3  S+     0   0  130 1215   15  PHPHPPSPTPPPAPPPPPPPPNHP PPPHNP TPHPTTSP  NPPPPPPPHHHPPPPPPPT  PHPPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGGGGGGGVGGGGEGGGGVVGGG GGGGGE GGVGGGGE  GGGGGGGGGGGGGGEEGGA  EGEGVEG
    43   43 A R  S <  S-     0   0  156 1216   43  QKHKQQQQQHQQQQHHQHHHHKKQ HQNQKK QHKHQQQQ  KHHHHHHHKKKQHQQQQQQ  QKRHHQQ
    44   44 A G        -     0   0   16 1215   36  GSGSGGGGGGGGGGGGGGGGGSSG GGGGSG GGSGGGGG  SGGGGGGGSSSGGGGGGGG  GSGGGGG
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLLLLLLLLLLLLLLLLLLLLL LLLLLL LLLLLLLL  LLLLLLLLFLLLLLLLLLL  LLLLLLL
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEEEEEEEEEEEEEEEEEEEEE EEEEEE EEEEEEEE  EEEEEEEEEEDEEEEEEEE  EEEEEEE
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWWWWWWWWWWWWWWWWWWWWW WWWWWW WWWWWWWW  WWWWWWWWWWWWWWWWWWW  WWWWWWW
    48   48 A I  E     -     0   0B   0 1215   31  IIIIIIIIIIIIIIIIIIIIIIII IIIIII IIIIIIII  IIIIIIIIIIIIIIIIIMI  IIIIIII
    49   49 A G  E     -FG  36  60B   0 1216   35  GGGGGGGGGGGGGGGGGGGGGGGG GGGGGG GGGGGGAG  GGGGGGGGGGGGGGGGGGG  GGGGGGG
    50   50 A R  E     -FG  35  59B  32 1216   94  EDEYVRWEEAEHYWWDYEEAANEW DDWNNR EEREEYRW  NDEEEEEEGYNMEAWWYRR  RGREAYH
    51   51 A I  E     -FG  34  58B   0 1207   17  IIIIIIFIIIIIIIIIIIIIIIII IIIIII IIIIIIII  IIIIVIIIIIIIIIIIIVV  IIIIIIV
    52   52 A D     >  -     0   0   26 1212   86  NNLDNAYHYHYYNDDYNLLHDDYD YYYYDD YLNLYYYD  DYLLLLLLNYYHLDFDNDD  DNDLDSD
    53   53 A P  T  4 S+     0   0    0 1212   83  PPPPPPPPPPPPPPPPPPPPPPPP PPPPPP PPPPPPPP  PPPPPPPPPPPPPPPPPPP  PPPPPPP
    54   54 A N  T  4 S-     0   0   96 1213   69  NNGYGGGNGGSGYEEGYGGGEYNE GGGGYA GGYGGEGE  YGGGGGGGNNNSGFGENSS  ANAGEGD
    55   55 A G  T  4 S-     0   0   69 1216   57  DNSNSSSSSSSNNYDGNSSSTYSY RRNSYS NSNSSSTN  YGSSTSSSSSNDSDENTDD  NNNGTNN
    56   56 A G     <  +     0   0   25  915   61  GGGGGGGGGGGGDGGGDGGGGGGG GGGGGG GGGGGGGG  GGGGGGGDGGGSGSGGAGG  GDGGGGD
    57   57 A G        -     0   0   43 1195   77  RGSGGSSNNGRYVSEFGSSGNSAS FMNIGN NSATYSSN  GYTTGSNTGAGERYSDYEE  NIYFGDG
    58   58 A T  E     -G   51   0B  62 1209   46  STTTTTITTTTTTTTTTTTTTTTT TTTTTT TTTTTTTT  TTTTTTTTTTNSTTTTTTT  TTTTTIT
    59   59 A K  E     -G   50   0B  89 1212   88  NSNSNYKNYANEKDKNKNNAASND TNKNSK YNSNYGYI  SNNNKNHNNSDRNSEEDNN  KNETAKK
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYYYYYYYYYYYYYYYYYYYYFY YYYYYY YYYYYYYY  YYYYYYHYYYYLYYYYYYY  YYYYYYY
    61   61 A N    >>  -     0   0   12 1216   63  NNNNNNNNNNDNNAANNNNNNNNA NNNDND NNNNNNND  NNNNNNNNNNNDNNNANAA  DNDNNNN
    62   62 A E  G >4 S+     0   0  148 1216   64  EQGQEEEGEQEEGEQDEEEQQQEE EDQEQP EEQEEEEP  QEEEEEEEQQQQEQEPQQQ  PQPEQEE
    63   63 A K  G 34 S+     0   0  109 1216   64  KKKKKMKKKKKKKKKNKKKKKKKK KKKKKK KKNKKKKK  KKKKKKKKKKKKKKKKKKK  KKKQKKK
    64   64 A F  G X> S+     0   0    5 1216   45  FFFFFFFFFFFFFFFLFFFFFFFF FFFFFF FFFFFFFF  FFFFFFFFFFFFFFFFFFF  FFFFFFF
    65   65 A K  T << S+     0   0  156 1216   40  KKKKKKKKKKKKKKQKKKKKKKKK KKNKKQ KKKKKKKQ  KKKKRKKKKKKKKKKQKQQ  QKQRRKK
    66   66 A S  T 34 S+     0   0  108 1216   35  NGGGGGDGGGGGGKSGGGGGGGGK GTGNGD DGDGGGGG  GGGGGGGGGGGDGGGGDSS  GGVGGGG
    67   67 A K  T <4 S+     0   0   33 1214   21  KKKKKKKKKKKKKKKKKKKKKKKK KKKKKK MKKKKKKK  KKKKKKKKKKKKK.RKKRR  KKKKKKK
    68   68 A A  E  <  -C   83   0A   2 1216   69  AAAAAAAAAAAAAAAAAAAAAAAA AAAGAA AAAAAAAA  AAAAAAAAAAAATTAAAVV  AAAAAAA
    69   69 A T  E     -C   82   0A  58 1216   37  TTTTTTTTTTTTTTTTTTTTTTTT TTTITT TTSTTTTS  TTTTTTTTTTTTTTTTTSS  TTTTSTT
    70   70 A L  E     +C   81   0A   7 1216   27  LLFLLLLLLLLLLLLLLFFLLLLL LLLLLI LFLFLLLI  LLFFFFFFLLLLFLLMLII  ILIFLLL
    71   71 A T  E     -C   80   0A  57 1213   47  TTTTTTTTTTTTTTTTTTTTTTTT TTTTTT TTTITTTT  TTIITTTTTTTTTTSTTTT  TTTTTTT
    72   72 A V  E     -C   79   0A  28 1216   71  VVAVAVAVAAVSSAAASAAAAVVA ALAVVA VAVAAVAA  VAAAAAAAIVVVAVVAAVV  AVAAAAS
    73   73 A D  E   > -C   78   0A  69 1216    7  DDDDDDDDDDDDDDDDDDDDDDDD DDDDDD DDDDDDDD  DDDDDDDDDDDDDDDDDDD  DDDDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62  KKAKKTKTKKTTKTTTKTTKKKKT ATKTKT KTKTKKKT  KTTTTTTTKKKKTTKTKKK  TKTTKKR
    75   75 A P  T 3 5S+     0   0  122 1215   37  SSSSSSSSSSSSSSSSSSSSSSSS STSSSS SSSSSSSS  SSSSSSSSSSASSSSSSSS  SSSSSSS
    76   76 A S  T 3 5S-     0   0   37 1216   65  SSSSSSSSSSSSSSSSSSSSSSTS SSSSSS SSSSSSSS  SSSSSSSSSSSSSSSSSTT  SSSSSSS
    77   77 A S  T < 5 +     0   0   24 1216   48  SSNSSSSSSSSSSSNSSNNSSSSS SSSSSN NNSNSNSN  SSNNNNNNSTSSNSSNSNS  NSSNSSS
    78   78 A T  E   < -BC  23  73A   8 1216   64  TATTTTTTTTTTTTTTTTTTTTTT TTTTTT TTTTTTTT  TTTTTTTTTTTTTSTTTTT  TTTTTTT
    79   79 A A  E     -BC  22  72A   0 1207   67  ATAAAAVAAAAAAAAAAAAAATAA AAAAAA AAAAAAAA  AAAAAAAAAAAAAAAAAAA  AAAAAAA
    80   80 A Y  E     -BC  21  71A  61 1209   36  YYYYYYYYYYYYYYYYYYYYYYYY YYYYYY YYYYYFFY  YYYYYYYYYYYYYYYYYYY  YYYYYYY
    81   81 A M  E     -BC  20  70A   0 1212    9  MMMMMIMVMMVMMIMIVMMMMMMI MMMMML MMMMMMML  MMMMMMMMMMMMIMMLMMM  LMLMMMM
    82   82 A Q  E     -BC  19  69A  69 1215   43  QEQHQQEDQEDQEQQQEQQEEQEQ QQQHQQ QQEQQQQQ  QQQQQQQQDEEQQLEQQEE  QEQQEQG
    83   83 A L  E     -BC  18  68A   0 1215   14  LLLLLLLLLLFLLLLLLLLLLLLL LLLLLL LLLLLLLL  LLLLLLLLLLLLFLLLLLL  LLLLLLL
    84   84 A S        +     0   0   32 1215   56  SRSNSSSSSSSRSSSSSSSSRASS SSSSKS TSHSSSSS  KSSSSSSSRRRSSSTSRSS  SRSSRNS
    85   85 A S  S    S-     0   0   89 1216   25  SSSSSSRSSSSSSSSSSSSSSSRS SSSSSS SSSSRSSS  SSSSSSSSSSSSSSRSSSS  SSSSSSN
    86   86 A L        +     0   0    2 1216   15  LLLLLLLLLLLLLLLLLLLLLLLL LLLLLL LLLLLLLL  LLLLLLLLLLLPLLLLLLL  LLLLLLL
    87   87 A T    >   -     0   0   61 1215   68  TTTTTSTTTTTTTTTTTTTTTTTT TTTATT TTTTTAKT  TTTTTTTTTTTTTTTTTRR  TTTTTTT
    88   88 A S  G >  S+     0   0   72 1216   59  PSSSSSSSSSSSSSSSSSSSSSSS SSSSSS SSSSSASS  SSSSSSSSSSSSSSSSSAA  SSSSSSS
    89   89 A E  G 3  S+     0   0  107 1216   21  EEEEDEEEEEEEEEEEEEEEEEEE EEEEEE EEEEEGEE  EEEEEEEEEDEEEEEEEEE  EEEEEEE
    90   90 A D  G <  S+     0   0    7 1216    3  EDDDDDDDDDDNDDDDDDDDDDDD DDDDDD DDDDDDDD  DDDDDDDDDDDDDDDDDDD  DDDDDDD
    91   91 A S    <   +     0   0   31 1216   34  FSSSSSSSSSSSSTTSSSSSSSST SSSSST SSSSSSST  SSSSSSSSSSSSSSSTSTT  TSTSSSS
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAAAAAAAAAAAAAAAAAAAAA AAAAAA AAAAAAAA  AAAAAAAAAAAAAAAAAAA  AAAAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48  VVVVVVVVVVVIVTTIVVVVVVIT IVVVVV VVVVVVVV  VVVVVVVVVVVVVVVVVVV  VVVVVVV
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYYYYYYYYYYYYYYYYYYYYYY YYYYYY YYYYYYYY  YYYYYYYYYYYYYYYYYYY  YYYYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3  YYYYFFFYFYYFYFFHYYYYYYYF YYFYYY FYYYFYFY  YFYYYYYYYYYYYFFYYYY  YYFYYFY
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCCCCCCCCCCCCCCCCCCCCC CCCCCC CCCCCCCC  CCCCCCCCCCCCCCCCCCC  CCCCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAAAAAAATTAAAAAGAATTATA ASAAAA AAAAAAAA  AATAAAAATAAAAAANAAA  AAAATKA
    98   98 A R  E     -E   34   0B  13 1196   38  RRRRRRRRRRRRRR RTRRRRRRR RRRRVG RRTRRRYR  RRRRRRPRRRRRNRR KRR  RRVRRHR
    99   99 A M  E     -EI  33 107B   5 1101   82  SGGDWKHSSVETS  GGESLLQ   SADGIY SLDVS G   GRVVMAKSDGGWYGG K    KRNGGWG
   100  100 A W  E >   -E   32   0B  89 1101   89  DYTDDEELINgGA  ITVRRAG   GGYgYD GSISY Y   GLSSLWVYYDnRGpD t    YRWEWEF
   101  101 A Y  T 3  S+     0   0  112  572   91  GGGGGLAAYY..Y  YFRYDHG   .S..YY YGYGR .   GGGGPLRDK.i.S.Y .    GADWDNG
   102  102 A Y  T 3  S-     0   0  133  629   92  YYEKDTNRPD.GY  YLRYYYY   .N..GG RPYQY .   SDQQTRRGY.YDS.Y .    NWDTGYD
   103  103 A G  S <  S+     0   0   38  705   79  YDYGGtWFYY.yD  nWRAWWY   .Yf.nN GGDSD .   tYSSGrkyDlYyR.R .    YFFLAWY
   104  104 A T        -     0   0   32  784   66  DP.LSvDAADeg.  s......   gAggp. A.y.. d   i....gadegs..d. .    PA.A..G
   105  105 A Y        +     0   0   81  679   93  ....Y.......Y  P.Y....   l...A. ..l.W l   P....f.R..qwWgR t    .......
   106  106 A Y        -     0   0   32  842   66  W..yyaY..y.Yd  Y.y..Y.   RfY.W. y.F.Y Y   W....yYY.LYYYYY w    ...y...
   107  107 A F  E     +I   99   0B   0  885   48  FFFmmgF.MmFFi  FFmM.FF   .m.LFF mFF.F .   F...FmFFvFFFF.F f    F.Fv...
   108  108 A D  E     +     0   0B  25  997   46  VDDDDDD.DDDDA  DADD.DD   DDDDAD DADDD .   A.DDGDDDDDDDD.D P    D.DD..G
   109  109 A Y  E     -J  168   0C 108 1059   61  YVYYYYYYYYYYY  SYYY.VF   YYYVYY YYYYV .   Y.YCDYYVYYNVVYL F    YYSFY.F
   110  110 A W  E     -I   97   0B  23 1092    2  WWWWWWWWWWWWW  WWWW.WW   WWWWWW WWWWW W   WWWWWWWWWWWWWWW W    WWWWW.W
   111  111 A G        -     0   0    3 1067   15  GGGGGGGGGGGGG  GGGGGGG   GGGGGG GGGGG G   GGGGGGGGGGGGGGG G    GGGGGGG
   112  112 A Q        -     0   0  141 1047   41  QTQQQQQQQQQQQ  QQQQQAQ   QQQAQQ QQQQA Q   QQQQQQQAQQQAAQQ Q    QQQQQQQ
   113  113 A G        -     0   0   20 1013   12  GGGGGGGGGGGGG  GGGGGGG   GGGGGG GGGGG G   GGGGGGGGGGGGGGG G    GGGGGGG
   114  114 A T  E     - H   0  94B   2  996   31  TTTTTTTTTTTTT  TTTTTTT   TTVTTT TTTTT T   TTTTTTTTTTTTTTT T    TTTTTTT
   115  115 A T  E     - H   0  93B  60  979   76  LTTSSTTLSSTTT  TLSSTTT   TSMTLT SLTTT P   LLTTLSSTTTTTTTT T    TLTSLTS
   116  116 A L  E     -dH  10  92B   1  972   19  VVLVVLLVVVLIV  LVVVLVL   LVVLVL VVLLV I   VVLLVVLVLLIVVLV V    LVLVVLV
   117  117 A T  E     -d   11   0B  57  953   21  TTTTTTTTTTITT  TTTTTTT   TTTTTT TTTTT T   TTTTTTTTTTTTTTT T    TTTTTTT
   118  118 A V  E     +d   12   0B   4  935    8  FVVVVVVVVVVVV  VVVVVVV   VVVVVV VVVVV V   VVVVVVVVVVVVVVV V    VVVVVVV
   119  119 A S              0   0   64  917   10  SSSSSSSSSSSSS  SSSSSSS   SSSSSS SSSSS S   SSSSSSSSSSSSSSS S    SSSSSSS
   120  120 A S              0   0  122  885   21  ASSSSSSASSSSS  SASSSSS   SSSS S SASSS S   AASSASSSSSSSSSS S    SASSASS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32                          Q      Q        Q                    QK       
   123    2 B A        -     0   0   19  713   70                          E      A        D                    AA       
   124    3 B V        -     0   0   84  765   49                          V      M        V                    VV       
   125    4 B V  E     -Q  145   0D  10  820   26                          V      V        VV                   VV       
   126    5 B T  E     +Q  144   0D  69  829   11                          T      T        IT                   TT       
   127    6 B Q  E     -Q  143   0D  18  832    2                          Q      Q        QQ                   QQ       
   128    7 B E        -     0   0   59  833   63                          E      E        EE                   EE       
   129    8 B S  S    S+     0   0  101  841   38                          T      T        SS                   SS       
   130    9 B A  E     -k  226   0C  59  842   50                          S      S        SS                   SS       
   131   10 B L  E     -k  227   0C  57  847   76                          L      L        LL                   LL       
   132   11 B T  E     +k  228   0C  84  848   77                          S      S        IY                   YS       
   133   12 B T  E     -k  229   0C  18  848   68                          T      T        TI                   II       
   134   13 B S    >   -     0   0   55  849   70                          T      N        TS                   SS       
   135   14 B P  T 3  S+     0   0   61  848   65                          P      P        PP                   PP       
   136   15 B G  T 3  S+     0   0   46  850    7                          G      G        GG                   GG       
   137   16 B E    <   -     0   0  108  850   56                          G      G        GG                   GG       
   138   17 B T  E     - R   0 199D  88  850   66                          T      T        TT                   TT       
   139   18 B V  E     - R   0 198D  14  850   33                          V      V        VV                   VV       
   140   19 B T  E     - R   0 197D  53  849   41                          T      T        TA                   TT       
   141   20 B L  E     - R   0 196D   0  849   25                          L      L        LL                   LL       
   142   21 B T  E     - R   0 195D  22  849   52                          T      T        TT                   TT       
   143   22 B b  E     -QR 127 194D   0  850    2                          C      C        CC                   CC       
   144   23 B R  E     -Q  126   0D 133  850   77                          G      G        GA                   AA       
   145   24 B S  E >   -QS 125 148D  11  850   68                          S      S        SS                   SS       
   146   25 B S  T 3  S+     0   0   81  850   27                          S      S        SS                   SS       
   147   26 B T  T 3  S-     0   0   87  850   71                          T      T        AT                   TT       
   148   27 B G  B <  S+S  145   0D  39  850   55                          G      G        GR                   GG       
   149   28 B A        -     0   0   40  390   77                          A      A        AA                   AA       
   150   29 B V        -     0   0    3  620   45                          V      V        VV                   VV       
   151   30 B T    >   -     0   0   56  541   72                          T      T        TT                   TT       
   152   31 B T  G >  S+     0   0   94  694   78                          T      T        ST                   TT       
   153   32 B S  G 3  S+     0   0   84  802   62                          S      S        NS                   SS       
   154   33 B N  G <  S-     0   0   13  673   73                          N      N        NN                   NN       
   155   34 B Y    <   -     0   0   98  781   50                          Y      Y        YC                   YY       
   156   35 B A        -     0   0    0  817   59                          A      A        AA                   AA       
   157   36 B N  E     -L  212   0C   0  827   79                          S      C        NA                   AT       
   158   37 B W  E     -LM 211 171C   0  849    0                          W      W        WW                   WW       
   159   38 B V  E     -LM 210 169C   0  849   25                          V      V        VV                   VV       
   160   39 B Q  E     -LM 209 168C  10  849   10                          Q      Q        QQ                   QQ       
   161   40 B E  E     -LM 208 167C  20  849    8                          Q      Q        EQ                   QQ       
   162   41 B K  E  >  - M   0 166C  68  849   50                          K      K        KK                   KK       
   163   42 B P  T  4 S+     0   0   98  843   23                          P      P        PP                   PP       
   164   43 B D  T  4 S-     0   0  148  846   16                          Y      Y        YS                   SS       
   165   44 B H  T  4 S+     0   0   90  845   66                          Q      Q        QE                   EE       
   166   45 B L  E  <  - M   0 162C  92  846   57                          R      S        GK                   IT       
   167   46 B F  E     + M   0 161C   9  847   19                          F      P        RP                   PS       
   168   47 B T  E     -JM 109 160C  56  843   61                          Q      R        QK                   KK       
   169   48 B G  E     + M   0 159C   1  848   64                          G      G        GG                   GG       
   170   49 B L  E     +     0   0C   4  848   24                          L      L        LL                   LL       
   171   50 B I  E     +NM 177 158C   0  848   19                          I      I        II                   II       
   172   51 B G  E  >  +N  176   0C   0  849   33                          G      F        GY                   YY       
   173   52 B G  T  4 S-     0   0    9  848   87                          G      D        GA                   HG       
   174   53 B T  T  4 S+     0   0    9  849   68                          T      S        TT                   TT       
   175   54 B N  T  4 S+     0   0  102  841   49                          S      S        SS                   SS       
   176   55 B N  E  <  -N  172   0C  77  849   69                          Y      N        NN                   TT       
   177   56 B R  E     -N  171   0C 113  850   66                          R      R        RQ                   RR       
   178   57 B A    >   -     0   0    1  849   73                          N      N        VN                   NN       
   179   58 B P  T 3  S+     0   0   97  849   39                          P      P        .S                   SP       
   180   59 B G  T 3  S+     0   0   83  850   18                          G      G        GG                   GG       
   181   60 B V  S <  S-     0   0   13  848   23                          V      V        VV                   VI       
   182   61 B P    >   -     0   0   57  850    9                          P      P        PP                   PP       
   183   62 B A  T 3  S+     0   0   77  850   59                          A      A        AA                   AA       
   184   63 B R  T 3  S+     0   0   58  850    5                          R      R        RR                   RR       
   185   64 B F  E <   +T  198   0D   4  850    1                          F      F        FF                   FF       
   186   65 B S  E     -T  197   0D  51  849   17                          S      S        SS                   TT       
   187   66 B G  E     +T  196   0D   9  850    4                          G      G        GG                   GG       
   188   67 B S  E     -T  195   0D  41  850    7                          S      S        SS                   SS       
   189   68 B L  E     -T  194   0D  59  835   79                          L      L        LL                   LL       
   190   69 B I  E >   -T  193   0D  86  842   31                          V      L        .F                   LL       
   191   70 B G  T 3  S-     0   0   67  850   18                          G      G        GG                   GG       
   192   71 B N  T 3  S+     0   0  105  828   57                          Q      D        ND                   DD       
   193   72 B K  E <  S- T   0 190D  68  833   67                          K      K        KK                   KK       
   194   73 B A  E     -RT 143 189D   0  838   81                          A      A        AA                   AA       
   195   74 B A  E     -RT 142 188D   0  849   57                          V      T        AA                   AA       
   196   75 B L  E     -RT 141 187D   0  850    2                          L      L        LF                   FF       
   197   76 B T  E     -RT 140 186D  19  850   33                          T      T        TT                   TT       
   198   77 B I  E     -RT 139 185D   0  849    5                          I      I        II                   II       
   199   78 B T  E    S+R  138   0D  78  850   46                          T      T        MT                   TT       
   200   79 B G  S    S-     0   0   15  850   57                          G      G        GG                   GG       
   201   80 B A        -     0   0    0  849   51                          A      A        AA                   AA       
   202   81 B Q    >   -     0   0   80  849   32                          Q      Q        QQ                   QQ       
   203   82 B T  G >  S+     0   0   84  850   59                          S      S        PT                   TT       
   204   83 B E  G 3  S+     0   0   99  850   17                          E      E        EE                   EE       
   205   84 B D  G <   +     0   0    1  850    2                          D      D        DD                   DD       
   206   85 B E    <   +     0   0   71  849   74                          E      E        EE                   EE       
   207   86 B A  E    S- O   0 227C   3  850   14                          A      A        DA                   AA       
   208   87 B I  E     -LO 161 226C  55  850   71                          E      E        ET                   TT       
   209   88 B Y  E     -LO 160 225C   0  850    0                          Y      Y        CY                   YY       
   210   89 B F  E     -L  159   0C   5  848    8                          Y      Y        YY                   YS       
   211   90 B b  E     -L  158   0C   0  849    1                          C      C        CC                   CC       
   212   91 B A  E     -LP 157 221C   0  848   73                          V      A        AA                   AA       
   213   92 B L  E     - P   0 220C   0  845   83                          L      L        LL                   LL       
   214   93 B W  E     + P   0 219C  21  834   71                          W      W        WW                   WW       
   215   94 B Y  E >  S- P   0 218C  33  829   88                          F      Y        FY                   YY       
   216   95 B S  T 3  S-     0   0  106  829   66                          S      S        SS                   SS       
   217   96 B N  T 3  S+     0   0  105  824   81                          N      N        NN                   NN       
   218   97 B H  E <   -P  215   0C  39  647   66                          H      H        HH                   ..       
   219   98 B L  E     -P  214   0C   1  382   85                          Y      F        FF                   ..       
   220   99 B V  E     -P  213   0C  12  489   66                                                               HH       
   221  100 B F  E     -P  212   0C  17  540   30                                                               FF       
   222  101 B G        -     0   0    1  481   35                                                               HH       
   223  102 B G        -     0   0   51  513   58                                                               SS       
   224  103 B G        -     0   0    8  528   33                                                               DD       
   225  104 B T  E     - O   0 209C   0  550   33                                                               TT       
   226  105 B K  E     -kO 130 208C  82  547   67                                                               SS       
   227  106 B L  E     -kO 131 207C   0  546   44                                                               LL       
   228  107 B T  E     -k  132   0C  34  614   65                                                                        
   229  108 B V  E     -k  133   0C   3  593   35                                                                        
   230  109 B L              0   0  120  399   31                                                                        
   231  110 B G              0   0   62  207   39                                                                        
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 A E              0   0  185  771   30      EQQ Q       QQE EEQQQ         QQE Q QQQ QQ        QQQQQQQQQ  QQQQQ
     2    2 A V        +     0   0   18  834   19      VVV M       VDV IVVVV         VVV V VVV VV        VVVVVVVLV  VVVVV
     3    3 A Q  E     -A   25   0A  90  836   34      QQQ Q       QQQ QQQQQ         QQQ Q QQQ QQ        HQQQKQQKQ  QQQQQ
     4    4 A L  E     -A   24   0A  13  881    3      LLL L       LLL LLLLL         LLL L LLL LL        LLLLLLLLL  LLLLL
     5    5 A Q  E     -A   23   0A 107  882   70      QQQ V       QQQ QQHVV         VQQ Q VVV VV        QQQQQQVQV  VVVVV
     6    6 A Q  E     -A   22   0A  14  887   31      QQQ Q       QQQ QQEQQ         QQQ Q QQQ QQ        QQQQQQQEQ  QQQQQ
     7    7 A S        -     0   0   33  892   13      SSS S       PSSSSSSSS         SSS S SSS SS        SSPSSSSSS  SSSSS
     8    8 A G        -     0   0   52  907   11      GGG G       GGGGGGGGG         GGG D GGG GG        GGGGGGGGG  GGGGG
     9    9 A A        -     0   0   80 1179   51  ATAAPAAPA PA AAPAAAATPAAAPAPAAAAA AAAAA AAA AAAPPA AAPSAAPPPAPA  AAAAA
    10   10 A E  E     -d  116   0B  68 1189   46  EEEEEEEEE EE EEEEEEEEEEEEEEEEEEEE EEEEE EEE EEEEEEEEEEDEEEEQEEE  EEEEE
    11   11 A L  E     +d  117   0B 130 1195   22  LLLLLLLLV LL LLLLRLLLLVVVLLLLLLLLLVVLLL VVV VVLLLLLLLLLLLLVLVLV  VVVVV
    12   12 A V  E     -d  118   0B  28 1197   47  VMVVVAAVR VA VVVVVVVVVARKVVVVVVVVARLVVV RRR KKVVVVMVVGVAVVVVKVQ  RKKKK
    13   13 A K    >   -     0   0  145 1201   50  KKRRKKRKK KG KKKRKKKKKKKKKKKKKKKRRKRRKK KKK KKKKKRKRKKKKKKRRKKK  KKKKK
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPPPPPP PP PPPPPPPPPPPPPPPPPPPPPPLPPPPPPP PPPPPPPPPPPPPPPPPPP  PPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28  GGGGGGGGG GG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGRGGGGGGGGGGGGGGGG  GGGGG
    16   16 A A    <   -     0   0   36 1213   63  AAAAASAAA AA AAATAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAASAAVTAAA  AAAAT
    17   17 A S        -     0   0   66 1210   29  SSSSSSSSS SS SSSSSSSSSSSSSSSSSSSLSSSSSSSSSS SSSSSLALSSSSSLSSSSS  SSSSS
    18   18 A V  E     - B   0  83A  10 1213   32  VLVVVVVVV VV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVV  VVVVV
    19   19 A K  E     - B   0  82A 119 1211   53  KKTKKKRKK KK KKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKEK  KKKKK
    20   20 A L  E     - B   0  81A   0 1214   21  LILLVILIV IL LLMLIILILMIVLLILLLLLMILLLIIVVV VVLVVLILLILIMIIIVIV  VVVLI
    21   21 A S  E     - B   0  80A  31 1215   35  SSSSSSSSS SS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSSSSS  SSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCIC  CCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70  TKKKKKKKK KTKTTKKKKTKKKKKKTKTTTTKKKRTTKKKKK KKTKKKKKTKKKKKKKKKK  KKKKK
    24   24 A A  E     +A    4   0A   2 1216   49  AAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAGAAAA  AAAAA
    25   25 A S  E     +A    3   0A  49 1216   12  SSLLSSSSS SSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSTSSSSSSSSSSSS  SSSSS
    26   26 A G  S    S+     0   0   56 1215    3  GGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG  GGGGG
    27   27 A Y  S    S-     0   0   39 1216   33  FYYYYYYYY YYYFFYFYYFYYYYYYFYFFFFFYYYFFYYYYY YYFYYFYFFYYYFYYYYYY  YYYYY
    28   28 A T    >   -     0   0   90 1216   52  NSTTPTTTT STTNNTSATNSTTTTTNSNNNNNTTTNNTSTTT TTNSSNTNNSTTSTTSTST  TTTTT
    29   29 A F  G >  S+     0   0   13 1216   27  IFFFFFFFF FFFIIFFFFIFIFFFFIFIIIIIFFFIIFFFFF FFIFFIFIIFFFFFFFFFF  FFFFF
    30   30 A T  G 3  S+     0   0   40 1216   55  KSTTTTTST TTSKKTTSNKTTTTTTKTKKKKKTTTKETTTTT NTKTTKSKKTSTTTTTTTT  TTTTT
    31   31 A S  G <  S+     0   0   23 1216   57  DSDDDSGNS GSSDDDSgDDGDTSSNDDDDDDDSDSdDDGSSS SGDDDDSDDGTSSSDSGYS  SGGSS
    32   32 A Y  E <  S-E  100   0B  40 1139   28  TYYYYYYSY YYYTTYY.YTYYYYYYTYTTTTYYYYlTHYYYY YYTYYYYYTHSYYFYYYYY  YYYYY
    33   33 A W  E     -E   99   0B  40 1148   92  YWEEFDGWY FWWYYIWwNYNYWWYDYKYYYYYWNY.YANWWY YYYNKYRYYNYDKDSWYYT  YAYNY
    34   34 A M  E     -EF  98  51B   0 1206   49  MIMMMIVMM MMIKMIMMMMMVMMMIMIMMMMMMMVMMIMMMM MMMMIMIMMMMVIIMMMMI  MMMIM
    35   35 A H  E     -EF  97  50B   0 1212   72  HEHHNSSNH NQEHHNNNDHNNHYHNHYHHHHHHHEHHHNHHH HHHYYHEHHYNSLSHHHHS  HHHNH
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWW  WWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17  VIVMVIVVV VVVVVVVVVVVVIVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVLIVMLVVMV  VVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22  KKKKKKKKR MKKKKKKKKKKKKRRRKKKKKKKKRKKKKKRRQ RRKKKKKKKKKKKKKKRKR  RRRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQQQLQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQMQQQQ  QQQQQ
    40   40 A R    >   -     0   0   35 1216   71  RRTTSTRRP SRRRRRRRSRSSRAARRSRRRRRRAKRRNSAAA AARSSRRRRSVTTRNRASA  AAAAA
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPPHTTPP HPPPPTPPHPHHPPPPPHPPPPPPPNPPPHPPP PPPHHPPPPHPTSPHPPHP  PPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22  EGVVGGGGG GGGEEGGGGEGGGGGEEGEEEEEGGREEEGGGG GGEGGEGEERGGGGAGGVG  GGGGG
    43   43 A R  S <  S-     0   0  156 1216   43  QHHHKQQQQ KQHQQQQKRQKKQQQQQKQQQQQQQHQQQKQQE QQQKKQHQQKQQQQQQQKQ  QQQQQ
    44   44 A G        -     0   0   16 1215   36  GGGGSGGGG SGGGGGGGSGSSGGGGGSGGGGGGGGGGGSGEG GGGSSGGGGSSGGGSDGSG  GRGGG
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLILLPLLLLL  LLLLL
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEEEEEE EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EEEEEEEEEEEEEEEEEEE  EEEEE
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWWYWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWYWWWWWWW  WWWWW
    48   48 A I  E     -     0   0B   0 1215   31  IIIIIIVIV IIIIIIIIIIVIIVMIIIIIIIIIMIIIIIMVV MMIIIIIIIIIIVIIIMIM  KMMMI
    49   49 A G  E     -FG  36  60B   0 1216   35  GGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGG  GGGGG
    50   50 A R  E     -FG  35  59B  32 1216   94  REAANYERR RAERREMRNRDDYTIWRYRRRRWADRWRYNERR IRRYYWEWRYYYTWIMWRW  RWWWR
    51   51 A I  E     -FG  34  58B   0 1207   17  IIIIIIIII IIIIIIIIIIIIIFIIIIIIIIIIVIIIFIVVI IIITIIIIIIIIIIIIIII  IIIII
    52   52 A D     >  -     0   0   26 1212   86  DLDHNNYYY NYLDDYHYNDNNNDNFDDDDDDDYNYDDSNNDN NNDDDDLDDDYNYSSDNNY  YNNNN
    53   53 A P  T  4 S+     0   0    0 1212   83  PPPPPTPPP PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP PPPPPPPPPPATPPTPPPP  PTPPP
    54   54 A N  T  4 S-     0   0   96 1213   69  AGEGYGGGG YGGAAGSGNAYYSGSGAYAAAAEGNGEAGYNLS SNAYYEGEAYGGGGYSNYG  GGNSN
    55   55 A G  T  4 S-     0   0   69 1216   57  NSTSNSSDS NDSNNSDDYNYNTDGDNNNNNNNNNNDTNYNPN GSNNNNSNNNNSNDDDSNS  NNSNS
    56   56 A G     <  +     0   0   25  915   61  GGGGSGGGG GGGGGGSGDGGGGGGGGGGGGGGSGGGGDGGGG GGGGGGGGGGGGGGGSGGG  GGGGG
    57   57 A G        -     0   0   43 1195   77  NYRGDGNDN DDSNNSEESNGGYNSSNGNTNNNDGNEHDNNIN SGNGVNSNNGDGDSNEGVN  DNGNN
    58   58 A T  E     -G   51   0B  62 1209   46  TTTTVTTAT TTTTTTTTTTTTTTTNTTTTTTTTTTTSFITTT TTTSTTTTTTIITSTVTIT  TTTTT
    59   59 A K  E     -G   50   0B  89 1212   88  KNAAIYYYK FRNKKYRHIKRSDKSNKTKKKKINDDKKKNKNN SNKTTINIKSNYSENKNSN  KKNGN
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYYYYYYY YYYYYYLYYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYYLYYY  YYYYY
    61   61 A N    >>  -     0   0   12 1216   63  DNNNNNSNA NANDDNNSNDSNNAANDNDDDDDKAPADNNAAA AAGNNDNDDNNTNNNNANA  ASAAA
    62   62 A E  G >4 S+     0   0  148 1216   64  PEQQQEEGQ QQEPPEQGQPQQQQQEPQPPPPPQQQPPELQQQ QQPQQPEPPQQEQEQQQQQ  QQQQQ
    63   63 A K  G 34 S+     0   0  109 1216   64  KKKKKKKKK KKKKKKRQKKKKNKKKKKKKKKKKKKKKRNKKK KKKKKKKKRKKKKKKRKNK  KKKKK
    64   64 A F  G X> S+     0   0    5 1216   45  FFFFFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FFFFFFFFFSYFFFFLFFF  FFFFF
    65   65 A K  T << S+     0   0  156 1216   40  QKKKKKKKQ KKKQQKKKKQKKKQQKQEQQQQQKKNQQKKQQQ QQQKEQKQQKKKKKKKQKQ  QQQQQ
    66   66 A S  T 34 S+     0   0  108 1216   35  GGDGDGGGG GDGGGGDGGGDGDGGGGDGGGGGGGGDGGGGGG GGGGDGGGGGGGGGGDGDG  GGGGG
    67   67 A K  T <4 S+     0   0   33 1214   21  KKKKKKKKR KKKKKKKKKKKKKRRKKKKKKKKKRKKKKKRRR RRKKKKKKKKKKRKKKRKR  RRRRR
    68   68 A A  E  <  -C   83   0A   2 1216   69  AAAAAAAAV AAAAAAAAAAAAAVVAAAAAAAAAVAAAAAVVV VVAAAAAAAAAAAAAAVAV  VVVVV
    69   69 A T  E     -C   82   0A  58 1216   37  TTTTTTTTS TTTTTTSTTTTTTSTTTSTTTTSKTTTTTTSSS TTATSSTSTTKTATTITST  STTTA
    70   70 A L  E     +C   81   0A   7 1216   27  IFLLLLLLI LLFIILLLLILLLIMLILIIIIILILIILLMII MSILLIFIILLLLLMLMLM  MIMMM
    71   71 A T  E     -C   80   0A  57 1213   47  TTTTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTTTTTTT  TTTTT
    72   72 A V  E     -C   79   0A  28 1216   71  AAAAVVTAV VAAAAAVAVAVVAGRTAAAAAAAAATASAVRGG RRAVAAAAAVVVAAVVRVA  RRRRR
    73   73 A D  E   > -C   78   0A  69 1216    7  DDDDDDDDD DDDDDDDDEDDDDDDDDDDDDDDVDDDDDDDDD DDDDDDDDDDDDDDDDDDD  NDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62  TTQKKKKKK KKTTTKTKKTKKKKTKTKTTTTTTKTTTKKTTT TTTKKTSTTKTKKKKKTKK  TTTTT
    75   75 A P  T 3 5S+     0   0  122 1215   37  SSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSSSSS  SSSSS
    76   76 A S  T 3 5S-     0   0   37 1216   65  SSSSSSSST SSSSSSSSSSSSSTTSSSSSSSSTTSSSSSTTT TISSSSSSSSFSSSSSIST  TAITI
    77   77 A S  T < 5 +     0   0   24 1216   48  NNSSSSSSS SNNNNNNSSNRSRSSSNSNNNNNSSSNNSSSSS SSNTSNNNNSSSSNINSSS  SSSSS
    78   78 A T  E   < -BC  23  73A   8 1216   64  TTTTTTTTT TTTTTTVTTTTITTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTTTTSTT  TTTTT
    79   79 A A  E     -BC  22  72A   0 1207   67  AAAAAAAAA AAAAAAVAAAAAAAVVAAAAAAAAAAAAAAAAA VAAAAAAAAAAAAAAAAAA  AAAAA
    80   80 A Y  E     -BC  21  71A  61 1209   36  YYYCYFYYY HYYYYYYYYYYYYYYYYLYYYYYYYFYYYYYYY YYYFLYYYYYYFYYYYYYY  YYYYY
    81   81 A M  E     -BC  20  70A   0 1212    9  LMMMMMMMM MMMLLMMMMLMMMMMMLMLLLLLMMMLLVMMMM MMLMMLILLMMMMMMMMMI  MMMMM
    82   82 A Q  E     -BC  19  69A  69 1215   43  QQEEQQHQE EQQQQLQQEQQQQEEHQHQQQQQEEEQQQQEED EEQHHQQQQHDQRHEQEEE  EEEEE
    83   83 A L  E     -BC  18  68A   0 1215   14  LLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLFLLL  LLLLL
    84   84 A S        +     0   0   32 1215   56  SSRSNSSSS RSSSSSSNRSNNSSSSSNSSSSSSSRSSNNSSS SSSNNSSSSNSSSSASSHS  SSSNR
    85   85 A S  S    S-     0   0   89 1216   25  SSSSSSSSS SSSSSSSGSSSNSSSRSSSSSSSSSSSSSGSSS SRSSSSSSSSSSSSRGRSS  SSRSS
    86   86 A L        +     0   0    2 1216   15  LLLLLLLLL LLLLLLPLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLPLLL  LLLLL
    87   87 A T    >   -     0   0   61 1215   68  TTTTTTTTR AATTTTTTTTTTTRRTTTTTTTTTRTTTTTRRR RRTTTTTTTTTTTTTTRTR  RRRRR
    88   88 A S  G >  S+     0   0   72 1216   59  SSSSSPSSA SSSSSSSSSSSSSASSSSSSSSSNPSSSSSAAA SSSSSSSSSSSPSSSSSSS  ASSSS
    89   89 A E  G 3  S+     0   0  107 1216   21  EEEEEEEVE EEEEEEEEDEEDEEEEEEEEEEEEEEEEEEEEE EDEEEEEEEEEEEEDEDEE  EEEEE
    90   90 A D  G <  S+     0   0    7 1216    3  DDDDDDDDD DDDDDDDDDDDDDDDDDDDNDDDDDDDDDDDDD DDDDDDDDDDDDDNDDDDD  DDDDD
    91   91 A S    <   +     0   0   31 1216   34  TSSSSTSST SSSTTSSSSTSSSTTSTSTTTTTSTTTTSSTTM TTTSSTSTTSSTSSSSTST  MTTTT
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAAAAAA AAAAAAAAAAAATAAAAAAAAAAAAAAAAAAAA AVAAAAAAAAAAAAAAAAA  AAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48  VIVVVVVVV VVVVVVVVVVVVVVVVVIVVVVVVTVIVVVMVV VVVVVVVVVIVVVVIVVVV  VVTVT
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYYYYYYY YYYYYFYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYY  YYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3  YYSYYYFFY YYYYYFYFYYYYYYYFYYYYYYYYYYYYFYYYY YYFYYYYYYYFYYFYYYYY  FYYYY
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCYCCCCCCC CCCCCCCCCCCCCCCCCCC  CCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24  AATTAAAAA AGAGAAAAAAAATAAAAAAAAAATAAAVTAAAA AAATAAAAAAATTAATAAA  AATAG
    98   98 A R  E     -E   34   0B  13 1196   38  RSRRRNRRR RYRRRIRRRRRRRRRRRRRSRRRRRRRRRRRR  RRRRRRRRRRRRRRRRRRR  RRRR 
    99   99 A M  E     -EI  33 107B   5 1101   82  SGSGWNSS  RVGGWYRGTGDGR  SKEYSGWWE  NRSW      SREWEWDG DGSGG P        
   100  100 A W  E >   -E   32   0B  89 1101   89  YGYGDYSN  YADDGRnNeWYPG  GRGYYGAGR  LGLG      TRGYYVDQ gSkAE T        
   101  101 A Y  T 3  S+     0   0  112  572   91  YIFDYS.W  DYGANTpWyLTVP  ATGGGWPYR  .ANN      YSGYSYYA .F.YV V        
   102  102 A Y  T 3  S-     0   0  133  629   92  GTDGTSYD  YWNRYDYPSRYYS  VGSYNDHYG  LVMS      YPSYFDHL .L.YS D        
   103  103 A G  S <  S+     0   0   38  705   79  STYLyYYV  DGYYAYYYyRyYY  lDyPYYYgG  YVAL      GWyAAGAY .l.gW F        
   104  104 A T        -     0   0   32  784   66  .A..g.sR  G....A..gdysg  pAg...YsY  G...      s.g..Y.G .dgf. .        
   105  105 A Y        +     0   0   81  679   93  ....e.d.  .......W..eda  ..S...GyY  G..Y      f.s..F.. rW.Y. .        
   106  106 A Y        -     0   0   32  842   66  ....KWL.  ......yY..gRW  ..s...yyW  Y..h      y.P..y.. IN.Y. .        
   107  107 A F  E     +I   99   0B   0  885   48  ...F.FFF  M.VFMMlLfmfGF  mMfFV.gmF  YF.m      mFFM.mFM MFfFF .        
   108  108 A D  E     +     0   0B  25  997   46  DD.ADAAA  D.GDDDDDADADP  DDDAD.EDA  DD.D      DADD.DAD DDADA D        
   109  109 A Y  E     -J  168   0C 108 1059   61  YY.YYYYY  Y.YYYSYVYYYYY  YYYYY.NYY  YYYH      YHFYYYYC AVYYY Y        
   110  110 A W  E     -I   97   0B  23 1092    2  WWWWWWWW  W.WWWWWWWWWWW  WWWWWWWWW  WWWW      WWWWWWWW WWWWW W        
   111  111 A G        -     0   0    3 1067   15  GGGGGGGG  G.GGGGGGGGGGG  GGGGGGGGG  GGGG      GGGGGGGG GGGGG G        
   112  112 A Q        -     0   0  141 1047   41  QQQQQQQQ  QQQQQQQARQQQQ  QQQQQQQQQ  QQQQ      QQQQQQQQ QAQQQ Q        
   113  113 A G        -     0   0   20 1013   12  GGGGGGGG  GGGGGGGGGGGGG  GGGGGGGGG  GGGG      GGGGGGGG GGGGG G        
   114  114 A T  E     - H   0  94B   2  996   31  TTTTTTTT  ATTTTTTTTTTTT  TTTTTTTTT  TTTT      TTTTTTTT TTTTT T        
   115  115 A T  E     - H   0  93B  60  979   76  TTTLLLLL  SLLTSSSTLSLLL  SSTLTTTSL  TASS      SLTSLSLS STLTL T        
   116  116 A L  E     -dH  10  92B   1  972   19  LLLVVVVV  VVVLVVVVVVVVV  VVLVLLLVV  ILVV      VVLVVVVV VVVVV V        
   117  117 A T  E     -d   11   0B  57  953   21  TTTTTTTT  TTTTTTTTTTTTT  TTTTTTTTT  TTTT      TTTTTTTT TTTTT T        
   118  118 A V  E     +d   12   0B   4  935    8  VVVVVVVV  VVVVVVVVVVVVV  VVVVVVVVV  VVVV      VVVVVVVV VVVVV V        
   119  119 A S              0   0   64  917   10  SSSSSSSS  SSSSSSSSSSSSS  SSSSSSSSS  SSSS      SSSSSSSS SSSSS S        
   120  120 A S              0   0  122  885   21  SSSAASAA  STASSSSSASAAA  SSSASSSSA  SSS       S SSASAS S ASA S        
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32                                             Q                          
   123    2 B A        -     0   0   19  713   70           A                                 A                          
   124    3 B V        -     0   0   84  765   49           V                                 V                   V      
   125    4 B V  E     -Q  145   0D  10  820   26           V                                 V                   LV     
   126    5 B T  E     +Q  144   0D  69  829   11           T                                 T                   SI     
   127    6 B Q  E     -Q  143   0D  18  832    2           Q                                 Q                   QQ     
   128    7 B E        -     0   0   59  833   63           E                                 E                   EQ     
   129    8 B S  S    S+     0   0  101  841   38           S                                 S                   SS     
   130    9 B A  E     -k  226   0C  59  842   50           S                                 S                   SS     
   131   10 B L  E     -k  227   0C  57  847   76           L                                 L                   LL     
   132   11 B T  E     +k  228   0C  84  848   77           Y                                 Y                   SI     
   133   12 B T  E     -k  229   0C  18  848   68           V                                 I                   MT     
   134   13 B S    >   -     0   0   55  849   70           S                                 S                   SN     
   135   14 B P  T 3  S+     0   0   61  848   65           P                                 P                   PP     
   136   15 B G  T 3  S+     0   0   46  850    7           G                                 G                   GG     
   137   16 B E    <   -     0   0  108  850   56           G                                 G                   GG     
   138   17 B T  E     - R   0 199D  88  850   66           T                                 T                   ST     
   139   18 B V  E     - R   0 198D  14  850   33           V                                 V                   VV     
   140   19 B T  E     - R   0 197D  53  849   41           T                                 T                   TI     
   141   20 B L  E     - R   0 196D   0  849   25           F                                 L                   ML     
   142   21 B T  E     - R   0 195D  22  849   52           T                                 T                   TT     
   143   22 B b  E     -QR 127 194D   0  850    2           C                                 C                   CC     
   144   23 B R  E     -Q  126   0D 133  850   77           A                                 A                   GG     
   145   24 B S  E >   -QS 125 148D  11  850   68           S                                 S                   SA     
   146   25 B S  T 3  S+     0   0   81  850   27           S                                 S                   SS     
   147   26 B T  T 3  S-     0   0   87  850   71           T                                 T                   TT     
   148   27 B G  B <  S+S  145   0D  39  850   55           G                                 G                   Gg     
   149   28 B A        -     0   0   40  390   77           A                                 A                   Pa     
   150   29 B V        -     0   0    3  620   45           V                                 V                   VV     
   151   30 B T    >   -     0   0   56  541   72           T                                 T                   TS     
   152   31 B T  G >  S+     0   0   94  694   78           T                                 T                   TT     
   153   32 B S  G 3  S+     0   0   84  802   62           S                                 S                   SS     
   154   33 B N  G <  S-     0   0   13  673   73           N                                 N                   HN     
   155   34 B Y    <   -     0   0   98  781   50           Y                                 Y                   YY     
   156   35 B A        -     0   0    0  817   59           A                                 V                   SA     
   157   36 B N  E     -L  212   0C   0  827   79           A                                 D                   VS     
   158   37 B W  E     -LM 211 171C   0  849    0           W                                 W                   WW     
   159   38 B V  E     -LM 210 169C   0  849   25           L                                 I                   VI     
   160   39 B Q  E     -LM 209 168C  10  849   10           Q                                 Q                   QQ     
   161   40 B E  E     -LM 208 167C  20  849    8           Q                                 Q                   QQ     
   162   41 B K  E  >  - M   0 166C  68  849   50           K                                 K                   KK     
   163   42 B P  T  4 S+     0   0   98  843   23           P                                 P                   SP     
   164   43 B D  T  4 S-     0   0  148  846   16           Y                                 Y                   GY     
   165   44 B H  T  4 S+     0   0   90  845   66           E                                 Q                   HQ     
   166   45 B L  E  <  - M   0 162C  92  846   57           T                                 T                   VV     
   167   46 B F  E     + M   0 161C   9  847   19           P                                 P                   PP     
   168   47 B T  E     -JM 109 160C  56  843   61           Q                                 Q                   LK     
   169   48 B G  E     + M   0 159C   1  848   64           G                                 Q                   GG     
   170   49 B L  E     +     0   0C   4  848   24           L                                 I                   LI     
   171   50 B I  E     +NM 177 158C   0  848   19           I                                 I                   II     
   172   51 B G  E  >  +N  176   0C   0  849   33           D                                 G                   GG     
   173   52 B G  T  4 S-     0   0    9  848   87           D                                 D                   GG     
   174   53 B T  T  4 S+     0   0    9  849   68           T                                 N                   TT     
   175   54 B N  T  4 S+     0   0  102  841   49           S                                 S                   TT     
   176   55 B N  E  <  -N  172   0C  77  849   69           H                                 N                   TN     
   177   56 B R  E     -N  171   0C 113  850   66           R                                 Q                   RR     
   178   57 B A    >   -     0   0    1  849   73           I                                 V                   YV     
   179   58 B P  T 3  S+     0   0   97  849   39           P                                 P                   PP     
   180   59 B G  T 3  S+     0   0   83  850   18           G                                 G                   GG     
   181   60 B V  S <  S-     0   0   13  848   23           V                                 V                   IV     
   182   61 B P    >   -     0   0   57  850    9           P                                 P                   PP     
   183   62 B A  T 3  S+     0   0   77  850   59           A                                 A                   AV     
   184   63 B R  T 3  S+     0   0   58  850    5           R                                 R                   RR     
   185   64 B F  E <   +T  198   0D   4  850    1           F                                 F                   FF     
   186   65 B S  E     -T  197   0D  51  849   17           T                                 S                   SS     
   187   66 B G  E     +T  196   0D   9  850    4           G                                 G                   GG     
   188   67 B S  E     -T  195   0D  41  850    7           S                                 S                   SA     
   189   68 B L  E     -T  194   0D  59  835   79           L                                 L                   IL     
   190   69 B I  E >   -T  193   0D  86  842   31           L                                 L                   LA     
   191   70 B G  T 3  S-     0   0   67  850   18           G                                 G                   GG     
   192   71 B N  T 3  S+     0   0  105  828   57           D                                 D                   NG     
   193   72 B K  E <  S- T   0 190D  68  833   67           K                                 K                   KK     
   194   73 B A  E     -RT 143 189D   0  838   81           A                                 A                   AA     
   195   74 B A  E     -RT 142 188D   0  849   57           A                                 A                   AT     
   196   75 B L  E     -RT 141 187D   0  850    2           F                                 L                   LL     
   197   76 B T  E     -RT 140 186D  19  850   33           T                                 T                   TT     
   198   77 B I  E     -RT 139 185D   0  849    5           I                                 I                   II     
   199   78 B T  E    S+R  138   0D  78  850   46           T                                 T                   TT     
   200   79 B G  S    S-     0   0   15  850   57           G                                 G                   GG     
   201   80 B A        -     0   0    0  849   51           A                                 I                   AA     
   202   81 B Q    >   -     0   0   80  849   32           Q                                 Q                   QQ     
   203   82 B T  G >  S+     0   0   84  850   59           T                                 P                   PP     
   204   83 B E  G 3  S+     0   0   99  850   17           E                                 E                   EE     
   205   84 B D  G <   +     0   0    1  850    2           D                                 D                   DD     
   206   85 B E    <   +     0   0   71  849   74           E                                 E                   EE     
   207   86 B A  E    S- O   0 227C   3  850   14           A                                 A                   AA     
   208   87 B I  E     -LO 161 226C  55  850   71           T                                 T                   EE     
   209   88 B Y  E     -LO 160 225C   0  850    0           Y                                 Y                   YY     
   210   89 B F  E     -L  159   0C   5  848    8           Y                                 Y                   YY     
   211   90 B b  E     -L  158   0C   0  849    1           C                                 C                   CC     
   212   91 B A  E     -LP 157 221C   0  848   73           A                                 T                   AA     
   213   92 B L  E     - P   0 220C   0  845   83           L                                 L                   LL     
   214   93 B W  E     + P   0 219C  21  834   71           W                                 Q                   WW     
   215   94 B Y  E >  S- P   0 218C  33  829   88           Y                                 Y                   FF     
   216   95 B S  T 3  S-     0   0  106  829   66           S                                 S                   SS     
   217   96 B N  T 3  S+     0   0  105  824   81           N                                 n                   SN     
   218   97 B H  E <   -P  215   0C  39  647   66           H                                 r                   .H     
   219   98 B L  E     -P  214   0C   1  382   85           L                                                     .      
   220   99 B V  E     -P  213   0C  12  489   66           H                                                     V      
   221  100 B F  E     -P  212   0C  17  540   30           S                                                            
   222  101 B G        -     0   0    1  481   35           D                                                            
   223  102 B G        -     0   0   51  513   58           A                                                            
   224  103 B G        -     0   0    8  528   33           N                                                            
   225  104 B T  E     - O   0 209C   0  550   33           T                                                            
   226  105 B K  E     -kO 130 208C  82  547   67           R                                                            
   227  106 B L  E     -kO 131 207C   0  546   44           L                                                            
   228  107 B T  E     -k  132   0C  34  614   65           G                                                            
   229  108 B V  E     -k  133   0C   3  593   35           V                                                            
   230  109 B L              0   0  120  399   31           L                                                            
   231  110 B G              0   0   62  207   39           S                                                            
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    1 A E              0   0  185  771   30  QQQ      QQQKQ QQQQEQQQQQQ       QQEQQQQQ QEEEEQ QQ         Q EEKQQQ  
     2    2 A V        +     0   0   18  834   19  VVV      VIVVVVVVVVVVVVVVV       VVIELVVV VVMVMV VV         V VVVVEV  
     3    3 A Q  E     -A   25   0A  90  836   34  QQQ      QQQQQQQQQQQQQQQQQ       QQQQKQQQ QQQQQQ QQ         Q QQQQQQ  
     4    4 A L  E     -A   24   0A  13  881    3  LLL      LLLLLLLLLLLLLLLLL       LLLLLLLL LLLLLL LL         L LLLLLL  
     5    5 A Q  E     -A   23   0A 107  882   70  VVQ      VQLQVVQVVVVVVVVVV       VQQVKVVV VVVVVV VV         V VVVVVV  
     6    6 A Q  E     -A   22   0A  14  887   31  QQQ      QQQQEQQQQQQQQQQQQ       QQQQEQQQ QQQQQQ QQ         Q EEQQQQ  
     7    7 A S        -     0   0   33  892   13  SSS      SPSSSSSSSSSSSSSSS       SSSSSSSS SSSSSS SS         S SSSSSS  
     8    8 A G        -     0   0   52  907   11  GGG      GGGGGGGGGGGGGGGGG       GGGGGGGG GGEGEG GG         G GGGGGS  
     9    9 A A        -     0   0   80 1179   51  AAPPAAPAAAAPAAAAAAPAAAAAAA AAAPAAAPPAPAAA PAAAAA APAA AAAAPAA AAAAAP  
    10   10 A E  E     -d  116   0B  68 1189   46  EEEDEEEEEEEEEEEEEEEEEEEEEE EEEEEEEEEENEEE EEEEEE EEEEEEDEEEEEEEEEEEQ  
    11   11 A L  E     +d  117   0B 130 1195   22  VVVLLLLLLLLLLVVLVVVVIVVVVV LLLLLXVLLVLVVV VVVLVV VVIVLLLLLLFVLVVVVAV  
    12   12 A V  E     -d  118   0B  28 1197   47  KQVVMAVVVRVVVRRVKRKRKKKKKK VVVVVVRVVRVRRR KKKKKK KKVVVVVVVVVRVKKRKKK  
    13   13 A K    >   -     0   0  145 1201   50  KKRKKRKKRKKKKKKRKKKKQKKKKK KRKRKKKRRKKKKK KKKKKK KKRKKRRRRKKKKKKKKKK  
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPPPPP PPPPPP PPPPPSPSPPPPPPPPPPP  
    15   15 A G  T 3  S+     0   0   59 1209   28  GGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGG GGGGGG GGGGGGGGGGGGGGGGGGG  
    16   16 A A    <   -     0   0   36 1213   63  AAVAAATAVAAAAAATAAAAAAAAAA AAAVAAAVTAAAAA AAAAAA AAATAAAAATAAAAAASAA  
    17   17 A S        -     0   0   66 1210   29  SSSSSSSSSSASSSSSSSSSSSSSSS SLSSSSSSSSSSSS SSSSSS SSLSSSSSLSSSSSSSSSS  
    18   18 A V  E     - B   0  83A  10 1213   32  VVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVMVVVVVVV VVVVVV VVVVVVVVVVVVVVVVVVV  
    19   19 A K  E     - B   0  82A 119 1211   53  KKKKKKKKKKNKKRKKKKKKKKKKKK KKKKKKKKKKKKKK KKKKKK KNKKKKKKKKKKKKKKKKK  
    20   20 A L  E     - B   0  81A   0 1214   21  VVIMIMMLIILILVVVVVVVLVVVVV LLLILLIIVVIVVV VVIVIF VVLLLLLLLILVLVVVVVV  
    21   21 A S  E     - B   0  80A  31 1215   35  SSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSS SSSSSS SSSSSSSSSTSSSSSSSSS  
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCC CCCCCCCCCCCCCCCCCCC  
    23   23 A K  E     -AB   5  78A 113 1216   70  KKKKKKKTKRKRKKKKKKKKKKKKKK TKTKTTKKKKKKKK KKKKKK KKKTTTTTKKTKTKKKKKK  
    24   24 A A  E     +A    4   0A   2 1216   49  AAGAAAAAGTAAAAVAAAAAAAAAAA AAAGAAAGADAAAA AVAVAA AAAAAAAAATAAAAAAAAA  
    25   25 A S  E     +A    3   0A  49 1216   12  SSSSTSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSS SSSSSS SSSSSSSSSSSSSSSSSSS  
    26   26 A G  S    S+     0   0   56 1215    3  GGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGG GGGGGG GGGDGGGGGGGGGGGGGGG  
    27   27 A Y  S    S-     0   0   39 1216   33  YYYDYDYFYYFYYYYYYYYYYFFFYY FFFYFFYYYYYFYY YYYYYY YYFFFFYFFYFYFYYYGYY  
    28   28 A T    >   -     0   0   90 1216   52  TTTTTIINTTSATTTGTTTTTTTTTT NNNTNNTTSTSTTT TTTTTT TTNNNNNNNSNTNTTTTST  
    29   29 A F  G >  S+     0   0   13 1216   27  FFFFFFFIFFFFFFFLFFFFFFFFFF IIIFIIFFFFFFFF FFFFFF FFIIITIIIFIFIFFFFFF  
    30   30 A T  G 3  S+     0   0   40 1216   55  TTTTSTAKTTTSSTTTTTTTTGGGTT KKKTKKTTITTTTT TTTTTT TTKKKKEKKTATKSTTSTT  
    31   31 A S  G <  S+     0   0   23 1216   57  DSDDTKDDDSskDGSNSSSSSSSSDD DDDDDDDDDSGTRD SEYEYD DSDDDDDDDGDSDSGSSSN  
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YYYSYYYTYYf.YYYEYYSKYYYYYY TYTYTTYYYYYYYY SLRLRY YYYITYTYYYTYTYYYYYY  
    33   33 A W  E     -E   99   0B  40 1148   92  YIAVWTVYAW.wFYYLAYAYYAAAYY YYYAYYWANYYYLY ASYSYF YIYYYYYYYFYYYYYTTAY  
    34   34 A M  E     -EF  98  51B   0 1206   49  MIMIIMIMMM.MIMMIMMMMMIIIMM IMMMIMMLIMIMMM MMLMLM MIMMMMIMMMIIMMMIIIM  
    35   35 A H  E     -EF  97  50B   0 1212   72  HSHTEHSHHHHNHNHEHHQYHSSSSS HHHHHHHHYHHHHH QHHHHH QSHHHHHHHNHHHHHHNSH  
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWW WWWWWW WWWWWWWWWWWWWWWWWWW  
    37   37 A V  E     -EF  95  47B   0 1216   17  VVVMVIVVVVVVIVVIVVVVVVVVVV VVVVAVVVVVVVVV VVLVLM VVVVVVVVVVVVVVVVVVV  
    38   38 A K  E     -EF  94  46B   7 1216   22  RRKKIKKKKRKKKRRKRRRRRRRRRR KKRKKKRKKRKRRR RRRRRL RRKKKKKKKMKQKRRRRRR  
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQQQQQQRRQQQKQQQQQQQQQQ QQQQQQQQQQQQQQ QQQQQQ QQQQQQQQQQQQQQQQQQQ  
    40   40 A R    >   -     0   0   35 1216   71  AASRRRRRSARRRAARAAAAAAAAAA RRRSRRASSASAAA AATATA AARRRRRRRSRARAAAAAA  
    41   41 A P  T 3  S+     0   0  130 1215   15  PPHTPPTPHPPPSPPPPPPSPPPPPP PPPHPPPHHPHPPP PPPPPP PPPPPPPPPHPPPPPPPPP  
    42   42 A G  T 3  S+     0   0   83 1216   22  GGAGGGGEAGGGGGGGGGGGGGGGGG EEEAEEGGGGVGGG GGGGGG GGEEEEEEEGEGEGGGGGG  
    43   43 A R  S <  S-     0   0  156 1216   43  QQKQHQQQKQQKQHQQQQQKQQQQQQ QQQKQQQKKQKQQQ QKQKQQ QQQQQQQQQKQQQQQQQQQ  
    44   44 A G        -     0   0   16 1215   36  GGSGGGGGSGGGGGGGRGGGGGGGGG GGGSGGGSSGSGGG GGGGGR GGGGGGGGGSGGGGGGGGG  
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLL LLLLLL LLLLLLLLLLLLLLLLLLL  
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEEEEEEEEEEEEEEEEEEEEEEE EEEEEEEEEEKEEE EEEEEE EQEEEEEEEEEQEEEEEEE  
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWW WWWWWW WWWWWWWWWWWWWWWWWWW  
    48   48 A I  E     -     0   0B   0 1215   31  MMIIIIIIIVIIIIMIMVIIIMMMMM IIIIIIVIIVIVVM MMMMMM MMIIIIIIIIIVIMMVMMM  
    49   49 A G  E     -FG  36  60B   0 1216   35  GGGGGGGGGGGGGGGGGGGAGGGGGG GGGGGGGGGGGGGG GGGGGG GGGGGGGGGGGGGGGGGGG  
    50   50 A R  E     -FG  35  59B  32 1216   94  WWVEEYERVRVRWYRVWWWRLVVVGG RWRVRRRIYRRRSR WGWGWW EWWRKWRWWRRWRIWWGVR  
    51   51 A I  E     -FG  34  58B   0 1207   17  IIIIIIIIIVIIFIVNIVIHIIIIII IIIIIIVIIIIVVV IVIVII IIIIIIIIIIIVIIIVIII  
    52   52 A D     >  -     0   0   26 1212   86  YYSYFNYDSYNFNNYNNYIDSMIIII DDDSDDNSDYNDLD IDTDTS NYDDDDDDDNDYDNNYIIY  
    53   53 A P  T  4 S+     0   0    0 1212   83  PPTPPPSPTPPPPPPPAPVPPPPPPP SPPTPPPTPPPPPP VPPTPA PPPPPPPPPPPPPPPPPPP  
    54   54 A N  T  4 S-     0   0   96 1213   69  GGYGGSGAYGSGGSGGGNGEYLLLII AEAYAASYYGYLLE GVYVYG SGEAAEAEEYANASNEILS  
    55   55 A G  T  4 S-     0   0   69 1216   57  NSNSSTSNYDSDSRDSNNSDNVVVVV NNNYNNNYNDNPLD NYNYNN SNNNNNHNNNHNNGSDFVS  
    56   56 A G     <  +     0   0   25  915   61  GGGDGGGGGGGGGGGDGGGGGGGGGG GGGGGGGGGGGGGG GGGGGG GGGDGGGGGGDGXGWGGGS  
    57   57 A G        -     0   0   43 1195   77  NNNSSYSNDDRDSYDGNNNKNVIIVV DNNNNNDNGSAISE NENENN SNNNNDNDNDHNNSTDTVS  
    58   58 A T  E     -G   51   0B  62 1209   46  TTTTANFTATTTITTTTTTTKTTTTT STTTTTTTSTTTTT TITITT TTTTTTCTTTSTSTTTATT  
    59   59 A K  E     -G   50   0B  89 1212   88  KISYNNYKSNNHKNNDKKNIGNNNNN KIKNKKNSSSSNNK NININK NKIKKGKEIFKKKSNKNNN  
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYNYHYYYYYYFYYYYYYYYYYYYY YYYYYYYYYYYYYY YHYRYY YYYYYYYYYYYYYYYYYYY  
    61   61 A N    >>  -     0   0   12 1216   63  AANNNNNDNANSNNANSAASAAAAAA DDDNADANNANAAA AAAAAS ATDDDADADTDAGAAAAAA  
    62   62 A E  G >4 S+     0   0  148 1216   64  QQQEEPEPQQEGEQQEQQQQQEEEQQ PPPQPPQQQQQQQQ QEQEQQ QQPPPPPPPQPQPQQQQQQ  
    63   63 A K  G 34 S+     0   0  109 1216   64  QKKKKKKKKKKKKKKKKKKKNKKKKK KKKKKKKKKKNKKK KKKKKK KKKKKKKKKKKKKKKKKKK  
    64   64 A F  G X> S+     0   0    5 1216   45  FFFFFFFFFFFFFFFFFFFFFFFFFF FFFFFFFFFFFFFF FFFFFF FFFFFFFFFFFFFFFFFFF  
    65   65 A K  T << S+     0   0  156 1216   40  QQKKKKKQKQKQKKQKQQQQQQQQQQ QQQKQQQKKQNQQQ QQQQQQ QQQQQQQQQKPQQQQQQQQ  
    66   66 A S  T 34 S+     0   0  108 1216   35  GGGGGDGGGGNGDDGGGGGGGGGGDD GGGGGGGGGGDGGG GGDGDG GGGGGGGGGGGGGGGGGGG  
    67   67 A K  T <4 S+     0   0   33 1214   21  RRKKKKKKKRKKKRRKRRRRRRRRRR KKKKKKRKKRKRRR RRRRRR RRKKKKKKKKKRXRKKRRR  
    68   68 A A  E  <  -C   83   0A   2 1216   69  VVAAAAAAAVAAAVVAVVVVVVVVVV AAAAAAVAAVAVVV VVAVAV VVAAAAAAAAAVAVVVVVV  
    69   69 A T  E     -C   82   0A  58 1216   37  TTTTTTITTSTKTTCTTSTTTTTTTT TSTTATSTTFSSSS TTTTTT TTSTTTTTSTTSTTTSTTT  
    70   70 A L  E     +C   81   0A   7 1216   27  MMMLFMLIMILLLMMLIMIIIIIIMM IIIMLIIMLILIII IMIMII MMIIIMIMILMMIMMMIMM  
    71   71 A T  E     -C   80   0A  57 1213   47  TTTTTTATTTTTTTTTTSTTTTTTTT TTTTTTTTTTTTTT TTTTTT TTTTTTTTTTTTTTTTTTT  
    72   72 A V  E     -C   79   0A  28 1216   71  RAVAAAVAVGVAATRARRRSTTAAAA AAAVAARVVRVGGG RERERR RAAAAAAAAVARARKRAAR  
    73   73 A D  E   > -C   78   0A  69 1216    7  DDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDD DDDDDD DDDDDDDDDDDDDDDDDDD  
    74   74 A K  T > 5S+     0   0  105 1216   62  TKKKTKKTKKKKKKMKTTTTTTTTTT TTTKTTTKKMKTKT TTRTRT TKTTTTTTTKTITTTTKTT  
    75   75 A P  T 3 5S+     0   0  122 1215   37  SSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSS SSSSSS SSSSSSSSSSPSSSSSSSS  
    76   76 A S  T 3 5S-     0   0   37 1216   65  TTSSSASSSMSSSFTSATTTTTTTTT SSSSSSTSSTSTTT TTMTMA TTSSSSSSSSSTSTITTTT  
    77   77 A S  T < 5 +     0   0   24 1216   48  SSSNNTNNSSTVTSSSSSSNSSSSSS NNNSNNSSNSSSSS SDSDSS SSNNNNNNNGNSSSSSSSS  
    78   78 A T  E   < -BC  23  73A   8 1216   64  TTTTTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTT TTTTTT TTTTTTTTTTTTATTTTTT  
    79   79 A A  E     -BC  22  72A   0 1207   67  AAVAAAAAAAAAVAAAAAAAGAAAAA AAAAAAAAAAAAAA AAAAAA AAAAAAAAAAVAAVAAAAA  
    80   80 A Y  E     -BC  21  71A  61 1209   36  YYHYYYYYYYYFYYYYYYYYYYYYYY YYYYYYYYFYYYYY YYYYYY YYYYYYYYYHYYYYYYYYY  
    81   81 A M  E     -BC  20  70A   0 1212    9  MIMMMMMLMMMLMMMMMMMMMMMMMM LLLMLLMMMMMMMM MMMMMM MMLLLLLLLMLMLMMMMMM  
    82   82 A Q  E     -BC  19  69A  69 1215   43  EEEQHQHQEEQQDDEREEEEEEEEEE QQQEHQEEYEEEEE EEEEEE EEQQQQHQQEHEQEEEEEE  
    83   83 A L  E     -BC  18  68A   0 1215   14  LLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLL LLLLLL LLILLLLLLLLLLLLLLLL  
    84   84 A S        +     0   0   32 1215   56  SSASDSSTARTTSRSSSSSNSSSSSS SSSASSSANSHSSS SSSSSS SSSNSSNSSRNSSSSSSSS  
    85   85 A S  S    S-     0   0   89 1216   25  SSRSSSGSRSSSRSSSSSSSSSSSSS SSSRSSSRNSSSSS SSSSSS SSSSSSSSSSSSSSRNSSS  
    86   86 A L        +     0   0    2 1216   15  LLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLL LLLLLL MLLLLLLLLLLLLLLLLLL  
    87   87 A T    >   -     0   0   61 1215   68  RRTTTTTTTRTTTRRTRRRSRRRRRR TTTTTTITTRTRRS RRRRRR RRTTTTTTTATRTRRSRRR  
    88   88 A S  G >  S+     0   0   72 1216   59  PSSSSSSSSPSSSSAVSASSSSSSPP SSSSSSASSASAAA SSSSSS PHSSSSSSSSSASSSASPP  
    89   89 A E  G 3  S+     0   0  107 1216   21  EEEEEEEEEEEEEAEDEEEEEEEEEE EEEEEEEEEEEDDD EEEEEE EEEEEEEEEEEEEEDEEEE  
    90   90 A D  G <  S+     0   0    7 1216    3  DDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDD DDDDDD DDDDDDDDDDDDDDDDDDD  
    91   91 A S    <   +     0   0   31 1216   34  TTSSSSSTSTSSSSTSTTMTTTTTTT TTTSTTMSSTSTTT TTTTTT TTTTTTATTSTTTTTTTTT  
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAAGAAAAAAAAATAAAAAAAAAA AAAAAAAAAAAAAA AAAAAA AAAAAAAAAAAAAAAAAAA  
    93   93 A V  E     -EH  39 115B  21 1216   48  VVNVVVVVIVVVVVVVVMVVVVVVVV VVVVVVVIFVVVVM VVVVVV VVVVVVVVAVVMVVVLVVV  
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYLYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYY YYYYYY YYYYYYYYYYYYYYYYYYY  
    95   95 A Y  E     -E   37   0B   1 1216    3  YYYFFYFYYYHFFYYCYYYYYYYYYY YYYYYYYYYYYYYY YYYYYY YYYYYYYYYYYYYYYYYYY  
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCC CCCCCCCCCCCCCCCCCCC  
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAAAATAAASAAAAVAAAATAAAAA AAAAAAAAAAAAAA AAAAAV AAAAANSNAAAATAAAAAA  
    98   98 A R  E     -E   34   0B  13 1196   38  RRRSRWRRRRIRRRRRRR  RRRRRR RRRFRRRRRRIRRS   RRRR RRRRKLRRNRRRRRRRRRR  
    99   99 A M  E     -EI  33 107B   5 1101   82    YYFNSDD RDHY GG          DARNDP GE T             HFDLSLYIS GGG      
   100  100 A W  E >   -E   32   0B  89 1101   89    YYAWPGD GSeY SG          GSGYGP EW T             YDGRGMYGG WLG      
   101  101 A Y  T 3  S+     0   0  112  572   91    GGLDFDY ..gD TY          EYHYDL .. V             GYLNRIGNR FYG      
   102  102 A Y  T 3  S-     0   0  133  629   92    NSGGGHG NDND MS          YGYGYL A. V             SDGLGTSYG RVR      
   103  103 A G  S <  S+     0   0   38  705   79    YSRFNDs wYyH iG          DRYSDw YY E             SAAYLHsAL RvG      
   104  104 A T        -     0   0   32  784   66    .yG...y gGg. gy          .VGS.r gG D             yP...Sy.. dp.      
   105  105 A Y        +     0   0   81  679   93    .g....y .DaY yl          .....r .A .             w..Y.LW.. .fL      
   106  106 A Y        -     0   0   32  842   66    .Y..YWy .YWC yr          WWt.WY .W y             Y..y.yYW. .sW      
   107  107 A F  E     +I   99   0B   0  885   48    FFF.LFm FFFL vh          FFlYFF fF v             F..m.mFF. vfF      
   108  108 A D  E     +     0   0B  25  997   46    DDAVDVD GDVD DD          GAAPAD SA D             D..DDDDAD DDD      
   109  109 A Y  E     -J  168   0C 108 1059   61    YVYYYYY YDYY YY          YYYYYV YF Y             VLYYYYVYY YYP      
   110  110 A W  E     -I   97   0B  23 1092    2    WWWWWWW WWWW WW          WWWWWW WW W             WWWWWWWWW WWW      
   111  111 A G        -     0   0    3 1067   15    GGGGGGG GGGG GG          GGGGGG GG G             GGGGGGGGG GGG      
   112  112 A Q        -     0   0  141 1047   41    QAQQQQQ QQQQ QQ          QQQQQA QQ Q             AQQQQQAQQ QQQ      
   113  113 A G        -     0   0   20 1013   12    GGGGGGG GGGG GG          GGGGGG GG G             GGGGGGGGG GGG      
   114  114 A T  E     - H   0  94B   2  996   31    TTTTTTT TATT TT          TTTTTT TT T             TTTTTTTTT TTT      
   115  115 A T  E     - H   0  93B  60  979   76    TTLLTLS LTLT T           LLLSLT LL T             TTLSTSTLT SLL      
   116  116 A L  E     -dH  10  92B   1  972   19    LVVVLVV VVVV V           VVVVVV VV V             VLVVLVVVL VVV      
   117  117 A T  E     -d   11   0B  57  953   21    TTTTATT TTTT T           TTTTTT TT T             TTTTTTTTT TTT      
   118  118 A V  E     +d   12   0B   4  935    8    VVVVVVV VVVV V           VVVVVV VV V             VVVVVVVVV VVV      
   119  119 A S              0   0   64  917   10    SSSSSSS SSSS S           SSSSSS SS S             SSSSSSSSS SSS      
   120  120 A S              0   0  122  885   21    SSASSAS ASAS S           AAASAS AA S             SSASSSSAS SSS      
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32                                           Q      Q                   QQ
   123    2 B A        -     0   0   19  713   70                                           A      A                   AT
   124    3 B V        -     0   0   84  765   49                            M              V      V                   VV
   125    4 B V  E     -Q  145   0D  10  820   26                            V              V      V                   VV
   126    5 B T  E     +Q  144   0D  69  829   11                            T              T      T                   TT
   127    6 B Q  E     -Q  143   0D  18  832    2                            Q              Q      Q                   QQ
   128    7 B E        -     0   0   59  833   63                            E              E      E                   EE
   129    8 B S  S    S+     0   0  101  841   38                            I              P      P                   PP
   130    9 B A  E     -k  226   0C  59  842   50                            S              S      S                   SS
   131   10 B L  E     -k  227   0C  57  847   76                            L              A      L                   AM
   132   11 B T  E     +k  228   0C  84  848   77                            S              T      T                   TS
   133   12 B T  E     -k  229   0C  18  848   68                            T              V      V                   VV
   134   13 B S    >   -     0   0   55  849   70                            T              S      S                   SS
   135   14 B P  T 3  S+     0   0   61  848   65                            S              P      P                   PP
   136   15 B G  T 3  S+     0   0   46  850    7                            G              G      G                   GG
   137   16 B E    <   -     0   0  108  850   56                            E              V      G                   VG
   138   17 B T  E     - R   0 199D  88  850   66                            T              T      T                   TT
   139   18 B V  E     - R   0 198D  14  850   33                            V              V      V                   VV
   140   19 B T  E     - R   0 197D  53  849   41                            T              T      T                   TT
   141   20 B L  E     - R   0 196D   0  849   25                            L              L      L                   LL
   142   21 B T  E     - R   0 195D  22  849   52                            T              T      T                   TT
   143   22 B b  E     -QR 127 194D   0  850    2                            C              C      C                   CC
   144   23 B R  E     -Q  126   0D 133  850   77                            G              G      A                   GG
   145   24 B S  E >   -QS 125 148D  11  850   68                            S              S      S                   SL
   146   25 B S  T 3  S+     0   0   81  850   27                            S              S      S                   SS
   147   26 B T  T 3  S-     0   0   87  850   71                            A              T      T                   TS
   148   27 B G  B <  S+S  145   0D  39  850   55                            G              G      G                   GG
   149   28 B A        -     0   0   40  390   77                            A              A      A                   AS
   150   29 B V        -     0   0    3  620   45                            V              V      V                   VV
   151   30 B T    >   -     0   0   56  541   72                            T              T      T                   TS
   152   31 B T  G >  S+     0   0   94  694   78                            T              D      S                   DS
   153   32 B S  G 3  S+     0   0   84  802   62                            S              G      S                   GS
   154   33 B N  G <  S-     0   0   13  673   73                            N              L      N                   LN
   155   34 B Y    <   -     0   0   98  781   50                            Y              Y      Y                   YY
   156   35 B A        -     0   0    0  817   59                            A              P      P                   PP
   157   36 B N  E     -L  212   0C   0  827   79                            S              Q      Y                   QS
   158   37 B W  E     -LM 211 171C   0  849    0                            W              W      W                   WW
   159   38 B V  E     -LM 210 169C   0  849   25                            V              I      F                   IY
   160   39 B Q  E     -LM 209 168C  10  849   10                            Q              Q      Q                   QQ
   161   40 B E  E     -LM 208 167C  20  849    8                            Q              Q      Q                   QQ
   162   41 B K  E  >  - M   0 166C  68  849   50                            K              K      K                   KT
   163   42 B P  T  4 S+     0   0   98  843   23                            P              P      P                   PP
   164   43 B D  T  4 S-     0   0  148  846   16                            Y              G      G                   GG
   165   44 B H  T  4 S+     0   0   90  845   66                            E              Q      Q                   QK
   166   45 B L  E  <  - M   0 162C  92  846   57                            V              V      A                   VP
   167   46 B F  E     + M   0 161C   9  847   19                            L              L      P                   LP
   168   47 B T  E     -JM 109 160C  56  843   61                            W              T      R                   TR
   169   48 B G  E     + M   0 159C   1  848   64                            G              T      T                   TM
   170   49 B L  E     +     0   0C   4  848   24                            L              L      L                   LL
   171   50 B I  E     +NM 177 158C   0  848   19                            I              I      I                   II
   172   51 B G  E  >  +N  176   0C   0  849   33                            G              Q      Y                   QY
   173   52 B G  T  4 S-     0   0    9  848   87                            G              N      N                   NQ
   174   53 B T  T  4 S+     0   0    9  849   68                            T              T      T                   TT
   175   54 B N  T  4 S+     0   0  102  841   49                            S              N      N                   NN
   176   55 B N  E  <  -N  172   0C  77  849   69                            T              N      N                   KN
   177   56 B R  E     -N  171   0C 113  850   66                            Q              K      K                   KR
   178   57 B A    >   -     0   0    1  849   73                            I              H      H                   YP
   179   58 B P  T 3  S+     0   0   97  849   39                            P              S      S                   SS
   180   59 B G  T 3  S+     0   0   83  850   18                            G              W      W                   WG
   181   60 B V  S <  S-     0   0   13  848   23                            V              T      T                   TV
   182   61 B P    >   -     0   0   57  850    9                            P              P      P                   PP
   183   62 B A  T 3  S+     0   0   77  850   59                            A              A      A                   AA
   184   63 B R  T 3  S+     0   0   58  850    5                            R              R      R                   RR
   185   64 B F  E <   +T  198   0D   4  850    1                            F              F      F                   FF
   186   65 B S  E     -T  197   0D  51  849   17                            S              S      S                   SS
   187   66 B G  E     +T  196   0D   9  850    4                            G              G      G                   GG
   188   67 B S  E     -T  195   0D  41  850    7                            S              S      S                   SS
   189   68 B L  E     -T  194   0D  59  835   79                            L              I      L                   II
   190   69 B I  E >   -T  193   0D  86  842   31                            L              Q      L                   QS
   191   70 B G  T 3  S-     0   0   67  850   18                            G              G      G                   GG
   192   71 B N  T 3  S+     0   0  105  828   57                            D              G      G                   GN
   193   72 B K  E <  S- T   0 190D  68  833   67                            K              K      K                   KK
   194   73 B A  E     -RT 143 189D   0  838   81                            A              A      A                   AA
   195   74 B A  E     -RT 142 188D   0  849   57                            A              A      A                   AA
   196   75 B L  E     -RT 141 187D   0  850    2                            L              L      L                   LL
   197   76 B T  E     -RT 140 186D  19  850   33                            T              T      T                   TT
   198   77 B I  E     -RT 139 185D   0  849    5                            R              L      L                   LI
   199   78 B T  E    S+R  138   0D  78  850   46                            S              S      S                   ST
   200   79 B G  S    S-     0   0   15  850   57                            G              G      G                   GG
   201   80 B A        -     0   0    0  849   51                            A              A      A                   AA
   202   81 B Q    >   -     0   0   80  849   32                            Q              Q      Q                   QQ
   203   82 B T  G >  S+     0   0   84  850   59                            S              P      P                   PP
   204   83 B E  G 3  S+     0   0   99  850   17                            K              E      E                   EE
   205   84 B D  G <   +     0   0    1  850    2                            D              D      D                   DD
   206   85 B E    <   +     0   0   71  849   74                            E              E      E                   EE
   207   86 B A  E    S- O   0 227C   3  850   14                            A              A      A                   AA
   208   87 B I  E     -LO 161 226C  55  850   71                            D              E      E                   ED
   209   88 B Y  E     -LO 160 225C   0  850    0                            Y              Y      Y                   YY
   210   89 B F  E     -L  159   0C   5  848    8                            Y              Y      H                   YY
   211   90 B b  E     -L  158   0C   0  849    1                            Y              C      C                   CC
   212   91 B A  E     -LP 157 221C   0  848   73                            V              A      L                   AA
   213   92 B L  E     - P   0 220C   0  845   83                            L              L      L                   LL
   214   93 B W  E     + P   0 219C  21  834   71                            W              W      Y                   W 
   215   94 B Y  E >  S- P   0 218C  33  829   88                            F              Y      Y                   Y 
   216   95 B S  T 3  S-     0   0  106  829   66                            S              S      S                   S 
   217   96 B N  T 3  S+     0   0  105  824   81                            N              S      n                   S 
   218   97 B H  E <   -P  215   0C  39  647   66                            .                     q                     
   219   98 B L  E     -P  214   0C   1  382   85                            .                                           
   220   99 B V  E     -P  213   0C  12  489   66                            C                                           
   221  100 B F  E     -P  212   0C  17  540   30                            F                                           
   222  101 B G        -     0   0    1  481   35                                                                        
   223  102 B G        -     0   0   51  513   58                                                                        
   224  103 B G        -     0   0    8  528   33                                                                        
   225  104 B T  E     - O   0 209C   0  550   33                                                                        
   226  105 B K  E     -kO 130 208C  82  547   67                                                                        
   227  106 B L  E     -kO 131 207C   0  546   44                                                                        
   228  107 B T  E     -k  132   0C  34  614   65                                                                        
   229  108 B V  E     -k  133   0C   3  593   35                                                                        
   230  109 B L              0   0  120  399   31                                                                        
   231  110 B G              0   0   62  207   39                                                                        
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    1 A E              0   0  185  771   30  QQ  QQQ    E QQQ RQ QRQQ EQQE QQQEE QQQ   QQ Q E     Q    QQ   Q    Q 
     2    2 A V        +     0   0   18  834   19  VV  VEV    V VVV MV VVVV VVVV VVVIV EVV   VV V V     V    VV   V    V 
     3    3 A Q  E     -A   25   0A  90  836   34  QQ  QQQ    Q QQH QQ QQQQ QQLQ QQQQQ QQQ   QQ L Q     Q    QQ   L    Q 
     4    4 A L  E     -A   24   0A  13  881    3  LL  LLL    L LLL IL LLLL LLLL LLLLL LLL   LL L L     L    LL   L    L 
     5    5 A Q  E     -A   23   0A 107  882   70  VV  VVV    V VQQ VV GVVV VVVL LVVEV VVT   VV V V     V    VM   V    V 
     6    6 A Q  E     -A   22   0A  14  887   31  QQ  QQQ    Q QQQ QQ QQQQ QQQQ EQQQQ QQQ   QQ QQE     Q    QQ   Q    Q 
     7    7 A S        -     0   0   33  892   13  SS  SSS    S SSS SS SSSS SSSS SSSSS SSS   SS SSS     S    SS   S    S 
     8    8 A G        -     0   0   52  907   11  GG  GGG    G GGG GG GGGG GAGG GGGGG GGG   GG GGG     G    GG   G    G 
     9    9 A A        -     0   0   80 1179   51  AA  AAAAAA A ATP AA PAAAASAAT AAAAA AAAAAAAA AAA     A    AA   A    A 
    10   10 A E  E     -d  116   0B  68 1189   46  EE  EEEEEE E EVE EE QEEEEEEEE VEEEE EEEEEEEE EEE     E    EE   E    E 
    11   11 A L  E     +d  117   0B 130 1195   22  VV  VVVLLL V VLL VV VVVVLVVVL LVVVV VVILLLLL VVV     V    VV   V    V 
    12   12 A V  E     -d  118   0B  28 1197   47  RR  KKKVVV R RAV RK KKRKVRRRV ARRKK KKKVVVRR RKK     R    RR   R    R 
    13   13 A K    >   -     0   0  145 1201   50  KK  KKKKKK K KRK KK KKKKKKKKR RKKKK KKKRRKKK TKK     K    KK   K    K 
    14   14 A P  T 3  S+     0   0   70 1203    8  AP  PPPPPP P PPP PP PPPPPPPPP PPPPP PPPSSPPP PPP     P    PP   P    P 
    15   15 A G  T 3  S+     0   0   59 1209   28  GG  GGGGGG G GGG GG EGGGGGGGG GGGGG GGGGGGGG GGG     G    GG   E    G 
    16   16 A A    <   -     0   0   36 1213   63  AA  AAAAAA A ATP AS SAAAAAAAA TAAAA AAEAAAAA ASA     A    SA   A    A 
    17   17 A S        -     0   0   66 1210   29  SS  .SSSSS S SSS SS SSSSSSSSS SSSSS SSSSSSSS SSS     S    SS   S    S 
    18   18 A V  E     - B   0  83A  10 1213   32  VV  .VVVVL V VVV VV VVVVVVVVV VVVVV VVVVVVVV VVV     V    VV   V    V 
    19   19 A K  E     - B   0  82A 119 1211   53  KK  .KKKKK K KKK KK KKKKKKKKK KKKKK KKKKKKKK KKK     K    KQ   K    K 
    20   20 A L  E     - B   0  81A   0 1214   21  VV  .VVLLL I VMM VV VVVVLVVIL IGVII VVLLLLII IVV     V    VI   I    V 
    21   21 A S  E     - B   0  80A  31 1215   35  SS  SSSSSS S SSS SS SSSSSSSFS SSSSS SSTSSSSS FSS     S    SS   F    S 
    22   22 A a  E     -AB   6  79A   0 1216    0  CC  VCCCCC C CCC CC CCCCCCYCC CCCCC CCCCCCCC CCC     C    CC   C    C 
    23   23 A K  E     -AB   5  78A 113 1216   70  KK  KKKTTT K KKK KK KKKKTKKKT KKKKK KKKTTTKK KKK     K    KK   K    K 
    24   24 A A  E     +A    4   0A   2 1216   49  AA  AAAAAA A VTA AA AAAAAAAAA AAAVF AATAAAAA AAA     A    LA   A    A 
    25   25 A S  E     +A    3   0A  49 1216   12  SS  SSSSSS S SSS SS SSSSSSSSS SSSSS SSSSSSSS SSS     S    SS   S    S 
    26   26 A G  S    S+     0   0   56 1215    3  GG  GGGGGG G GDG GG GGGGGGRGG GGGGG GGGGGGGG GGG     G    GG   G    G 
    27   27 A Y  S    S-     0   0   39 1216   33  YY  YYYFFF Y YYY YG YYYYFYYYF YYYGD YYYFFFYY YGY     Y    GY   Y    Y 
    28   28 A T    >   -     0   0   90 1216   52  TT  TSTNNN T TTT TT TTTTNTTSS NTTDD ITTNNNTT GTT     T    TT   S    T 
    29   29 A F  G >  S+     0   0   13 1216   27  FF  FFFIII F FFF FF FFFIIFFFI FFFFF FFFIIIFF FFF     F    FF   F    F 
    30   30 A T  G 3  S+     0   0   40 1216   55  IT  TTTKKK T TTT TS TTTTKTTTK TTTIS TTTKKKTT TST     T    ST   T    T 
    31   31 A S  G <  S+     0   0   23 1216   57  DS  SSNDDD S SND SS SSSSDSSDd SSSSS SNSDDDDD DSG     S    SS   D    S 
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YY  NYYTTT Y YCY YY SYHYTYYYl YYYEY YYYYYTYY YYY     Y    YY   Y    Y 
    33   33 A W  E     -E   99   0B  40 1148   92  LA  FAYYYY N WWV WA ACGCYYWY. WYYYY VYYYYYYY YAY     Y    AF   Y    W 
    34   34 A M  E     -EF  98  51B   0 1206   49  MV  MIMIII M MIV MI MMIMIMMML MMMMM IMMMMIMM MIM     M    II   M    M 
    35   35 A H  E     -EF  97  50B   0 1212   72  HH  HSQHHH H HHS QS QHSHHHHHH LHHQQ SQHHNNYY HSH     H    SS   Y    H 
    36   36 A W  E     -EF  96  49B   0 1216    0  WW  WWWWWW W WWW WW WWWWWWWWW WWWWW WWWWWWWW WWW     W    WW   W    W 
    37   37 A V  E     -EF  95  47B   0 1216   17  VV  VVVVVV V VIM VV VVLVMVVLV VVVVV LVVVVVVV VVV     V    VV   V    V 
    38   38 A K  E     -EF  94  46B   7 1216   22  RR  RRRKKR R RKQ RR RRQHKRQRM KRRRR RQRKKKRR RRR     R    RR   R    R 
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQ  QQQQQQ Q QQQ QQ QQQQQQQQQ QQQQQ QQQQQQQQ QQQ     Q    QQ   Q    Q 
    40   40 A R    >   -     0   0   35 1216   71  AA  AAARRR A ARR AA AAAVRAVAR RAAAA AAARRRAA SAA     A    AS   A    T 
    41   41 A P  T 3  S+     0   0  130 1215   15  PP  PPPPPP P PPT PP PHPHPPPPP PPPSS PPPPPPPP PPP     P    PP   P    P 
    42   42 A G  T 3  S+     0   0   83 1216   22  GG  GGGEEE G GGG GG GAGAEGGEE GGGGG GGGEEEGG AGG     G    GG   A    G 
    43   43 A R  S <  S-     0   0  156 1216   43  QQ  QQQQQQ Q QQQ QQ QQQQQQQQQ QQQKK QQKQQQQQ QQQ     G    QQ   Q    Q 
    44   44 A G        -     0   0   16 1215   36  GG  GGGGGG G GGV GG GGGGGGGGG GGGGG GGGGGGGG GGG     A    GG   G    G 
    45   45 A L  E     -F   39   0B   8 1215   10  LL  LLLLLL L HLL LL LLLLLLLLL LLLLL FLLLLLLL LLL     .    LF   F    L 
    46   46 A E  E     -F   38   0B  34 1216    6  EE  EEEEEE E EEE EE EEEEEEEEE EEEEE EEEEEEEE EEE     E    EE   E    E 
    47   47 A W  E     -F   37   0B   3 1216   10  WW  WWWWWC W WWW WW WWLWWWWWW WWWWW WWWWWWWW WWW     W    WW   W    W 
    48   48 A I  E     -     0   0B   0 1215   31  MM  MMMIIF I VII MM IMVMIMVMI IVMII MMVIVIMM MMM     L    MM   M    V 
    49   49 A G  E     -FG  36  60B   0 1216   35  GG  GGAGGG G GGG GG GGGGGGGGG GGGGG GRGGGGGG GGG     G    GG   G    G 
    50   50 A R  E     -FG  35  59B  32 1216   94  WW  WVERRR Q WAE RV WLWLKRWRW ARRGA GERWWRYY SRW     S    GW   S    W 
    51   51 A I  E     -FG  34  58B   0 1207   17  VV  IIIIII I FII VI IVIVIVVII LVVYY IFIIIIII III     F    FI   I    V 
    52   52 A D     >  -     0   0   26 1212   86  DN  YINDDD Y YSY NI ICHCDRYDD FDDGD HNNDDDYY DIN     Y    IY   D    D 
    53   53 A P  T  4 S+     0   0    0 1212   83  PP  PPPPPP P PLP PP VPPPPPPPP PIPAP PTPPPPPP PPP     S    PP   P    P 
    54   54 A N  T  4 S-     0   0   96 1213   69  EY  GISAAA G NGG NA GSNSANNEE GTSTE GRYEEAGG EIN     G    IS   E    S 
    55   55 A G  T  4 S-     0   0   69 1216   57  DN  NVSNNK N SNS NA SDSDNSKDD NNDED YNSNNNNN DLS     D    LS   D    D 
    56   56 A G     <  +     0   0   25  915   61  GG  GGGAGN S GSG GD GGGGGGGGG S.GGG GGGGGGSS GGG     R    GG   G    G 
    57   57 A G        -     0   0   43 1195   77  EN  NVSNNN D DGS NL NSDSNGDSE D.NEE SNGDDNNN AIG     D    TR   S    E 
    58   58 A T  E     -G   51   0B  62 1209   46  TT  TTTAST T TAA TT TTTTTTTTT T.TAT TTTTTTTT TAT     T    AT   T    A 
    59   59 A K  E     -G   50   0B  89 1212   88  NK  NNNKKK D QWY NN NSGSKSKSK T.NKE SQDEERNN SNN     N    NN   S    N 
    60   60 A Y  E     -G   49   0B  46 1215    9  YY  YYYYYY Y YYY YY YHYYYYYYY YYYYY YYYYYYYY YYY     H    YY   Y    Y 
    61   61 A N    >>  -     0   0   12 1216   63  AA  AAADDD A SNN TA AAAADAAAV KAASS AIAAADAA AAA     T    AA   A    A 
    62   62 A E  G >4 S+     0   0  148 1216   64  QQ  QQQPPP Q QQE QQ QQQQPQQQP EQQQQ QQSPPPQQ QQQ     Q    QQ   Q    Q 
    63   63 A K  G 34 S+     0   0  109 1216   64  KK  KKKKKK E KKK KK KKKKKNKKK MKKKK KEAKNKKK KKK     K    KK   K    K 
    64   64 A F  G X> S+     0   0    5 1216   45  FF  FFFFFF F FFF FF FFFFFFFFF LFFFF FFFFFFFF FFV     F    FF   F    F 
    65   65 A K  T << S+     0   0  156 1216   40  QQ  QQQQQQ Q QKK QQ QQQQQQQQQ KQQQQ QQQQQQQQ QQQ     Q    QQ   Q    Q 
    66   66 A S  T 34 S+     0   0  108 1216   35  GG  GDGGGG G GDG GG GGGAGGGGD GGGGG GGGGGGGG GGG     G    GG   G    G 
    67   67 A K  T <4 S+     0   0   33 1214   21  RR  RRRKKK R RKK RR RRRRKRRRK RRRRR RRRKKKRR RRR     R    RR   R    R 
    68   68 A A  E  <  -C   83   0A   2 1216   69  VV  VVVATA V VAA VL VVVVAVVLA AIVAA VVVAAAVV LVV     V    VV   L    V 
    69   69 A T  E     -C   82   0A  58 1216   37  SS  TTTTTT T SKI ST TTTTTTSTT KSSTT TTTTTTTT TTT     S    TT   T    S 
    70   70 A L  E     +C   81   0A   7 1216   27  IM  MMMIIL I MLL MI IIMIIMMLL LIIII IIIMLIMM LIM     I    IM   L    I 
    71   71 A T  E     -C   80   0A  57 1213   47  TT  TTTTNT T TTT ST TTTTTTTTT TTTTT TTTTTTTT TTT     T    TT   T    T 
    72   72 A V  E     -C   79   0A  28 1216   71  GS  RARSTA A RAA RA RRRRPVRAA AGGSG ARRASAAA AAR     E    AS   A    R 
    73   73 A D  E   > -C   78   0A  69 1216    7  DD  DDDDDD D DVD DD DDDDDDEDA ADDDD DDDDDDDD DDD     D    DD   D    D 
    74   74 A K  T > 5S+     0   0  105 1216   62  TT  TTTTTT K ITK TT TTTTTRMTT TTTKT MTNTTTKK TKT     T    ET   T    M 
    75   75 A P  T 3 5S+     0   0  122 1215   37  SS  PSSSSS S SSS SS SSSSSSSSS SSSSS SSSSSSSS SST     S    SS   S    S 
    76   76 A S  T 3 5S-     0   0   37 1216   65  TM  MTTSSS T TTS MT TMAMSAMTS ATTTT TTISSSSS TTI     T    TT   T    R 
    77   77 A S  T < 5 +     0   0   24 1216   48  SS  SSSNNN S NNS NS SSSSNSSNN SNSSN SSTNNNSS NSS     S    SS   N    S 
    78   78 A T  E   < -BC  23  73A   8 1216   64  TT  TTTTTT T TTT TT TTTTTTTTT ITTTT TTTTTTTT TTT     T    TT   T    T 
    79   79 A A  E     -BC  22  72A   0 1207   67  AA  AAAAAA A AAA AA AAAAAGAAA AFAAV VAAAATAA AAA     A    AA   A    A 
    80   80 A Y  E     -BC  21  71A  61 1209   36  YY  YYYYYY Y YYY YY YYYYYYYYY YYYYY YYWYYYYY YYY     Y    YY   Y    Y 
    81   81 A M  E     -BC  20  70A   0 1212    9  MM  MMMLLL V MMM MM MMMMLMMML LMMLL MMLLLLMM MMM     M    MM   M    M 
    82   82 A Q  E     -BC  19  69A  69 1215   43  ED  EEEQQH E EEE EE EEEEQEEEQ EEEEE EEQRQHEE EEE     E    EE   E    E 
    83   83 A L  E     -BC  18  68A   0 1215   14  LL  LLLLLL L IVF LL LLLLLLLLL FLLLL LLLLLLLL LLL     L    LL   L    L 
    84   84 A S        +     0   0   32 1215   56  SS  SSSSNS N SSS SS SSSSSSSSS SSSSN SSGSSSSS SSS     S    SR   S    S 
    85   85 A S  S    S-     0   0   89 1216   25  SS  SSISSS S SSS SS SSSSSGSSS SSSSS SSSSSSSS SSR     S    SS   S    S 
    86   86 A L        +     0   0    2 1216   15  LL  LLLLLL L LLL LL LLLLLLLLL LLLLL LLLLLLLL LLL     L    LL   L    L 
    87   87 A T    >   -     0   0   61 1215   68  RS  RRRTTT R RTT RR RRRRSRRRT TRRSS RRRTTTRR RRR     R    RS   R    R 
    88   88 A S  G >  S+     0   0   72 1216   59  AA  PPPSSS A ANS AS SSPSFAASS NAASS SSASSSAA SSS     A    SP   S    A 
    89   89 A E  G 3  S+     0   0  107 1216   21  EE  EEEEEE E EEE EE EEEEEEQAG EEEEE EEDKEEEE AED     E    EE   T    E 
    90   90 A D  G <  S+     0   0    7 1216    3  DD  DDDDDD D DDD KD DDDDDDDDD DDDDD DDDDDDDD DDD     D    DD   D    D 
    91   91 A S    <   +     0   0   31 1216   34  TT  TTTTTT T SSS TT TMMTTTTTT STTTT MTTTTTTT TTT     M    TM   M    T 
    92   92 A A  E    S- H   0 116B  10 1214    5  AA  AAAAAA A AAA AA AAAAAAAAA AAAAA AAAAAAAA AAA     A    AA   A    A 
    93   93 A V  E     -EH  39 115B  21 1216   48  VL  VVVVVV V MVV VV VMRMVVMMT VMVVV VVTVVVMM MVV     V    VV   V    V 
    94   94 A Y  E     -EH  38 114B   0 1216    1  YY  YYYYYY Y YYF YY YYYYYYYYY YYYYY YYYYYYYY YYY     Y    YY   Y    Y 
    95   95 A Y  E     -E   37   0B   1 1216    3  YY  YYYYYY Y YYF YY YYYYYYYYY YYYYY YYYYYYYY YYY     Y    YY   Y    Y 
    96   96 A a  E     +E   36   0B   0 1216    1  CY  CCCCCC C CCC CC CCCCCCCCC CCCCC CCCCCCCC CCC     C    CC   C    C 
    97   97 A A  E     -EI  35 110B   0 1215   24  AA  AAASAV A ATA AA AVAVAAAAL AAGAA AVANNSAA AAA     A    AV   A    A 
    98   98 A R  E     -E   34   0B  13 1196   38  RR  RRRDRR R RRR RR  RRRRRRRF R R    R AGTSS RSR     R    RK   R    R 
    99   99 A M  E     -EI  33 107B   5 1101   82         LEG A  ER        ED  Y G D      RYGHH  SS                    H 
   100  100 A W  E >   -E   32   0B  89 1101   89         GYW K  DG        Dl  G D T      GGDWW  NQ                    S 
   101  101 A Y  T 3  S+     0   0  112  572   91         PDD Y  YD        Yt  . F V      QNGGG  WG                    E 
   102  102 A Y  T 3  S-     0   0  133  629   92         YYH I  YG        GG  . G R      VSYRR  GG                    A 
   103  103 A G  S <  S+     0   0   38  705   79         WGW i  gs        Ng  y A G      TLDYY  Pg                    S 
   104  104 A T        -     0   0   32  784   66         .P. .  gg        ..  d . s      TAG..  Ya                    . 
   105  105 A Y        +     0   0   81  679   93         ... t  ..        .y  d . c      S.N..  Wg                    . 
   106  106 A Y        -     0   0   32  842   66         .WY L  ..        .Y  Y . H      WWR..  Yd                    . 
   107  107 A F  E     +I   99   0B   0  885   48         .FF F  FF        YL  F M .      FFF..  Ff                    . 
   108  108 A D  E     +     0   0B  25  997   46         .AD D  PA        VD  D D R      ALA..  DD                    . 
   109  109 A Y  E     -J  168   0C 108 1059   61         .YV V  YH        YQ  Y Y T      YYY..  LI                    Y 
   110  110 A W  E     -I   97   0B  23 1092    2         .WW W  WW        WW  W W W      WWWWW  WW                    W 
   111  111 A G        -     0   0    3 1067   15         GGG G  GG        GG  G G S      GGGGG  GG                    G 
   112  112 A Q        -     0   0  141 1047   41         QQA P  QQ        QQ  Q Q Q      QQQQQ  RQ                    K 
   113  113 A G        -     0   0   20 1013   12         GGG G  GG        GG  G G G      GGGGG  GG                    G 
   114  114 A T  E     - H   0  94B   2  996   31         TAT T  TT        TT  T T T      TTTTT  TT                    Q 
   115  115 A T  E     - H   0  93B  60  979   76         TLT L  TL        LL  T L        LLLLL  LM                    E 
   116  116 A L  E     -dH  10  92B   1  972   19         LVV V  VV        VV  I V        VVVVV  VV                    V 
   117  117 A T  E     -d   11   0B  57  953   21         TTT T  TS        TT  T T        TTTTT  TT                    A 
   118  118 A V  E     +d   12   0B   4  935    8         VVV V  VV        VV  V V        VVVVV  VV                    V 
   119  119 A S              0   0   64  917   10         SSS S  SA        SS  S S        SSSSS  SS                      
   120  120 A S              0   0  122  885   21         SA  S  SA        AP  S S        AAASS  SS                      
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32    QQ      Q Q   Q  Q         Q     Q        Q    EQQE QQQQ  QQQ QQQQ Q
   123    2 B A        -     0   0   19  713   70    AA      T T   A  A         T     A        A    AAAA AAAA  ATT ATTT T
   124    3 B V        -     0   0   84  765   49    VV      V V   V  V         V     V        V    VVVV VVVV  VVV VVVV V
   125    4 B V  E     -Q  145   0D  10  820   26    VV      V V   V  V         V     V        V   VVVVV VVVV  VVV VVVV V
   126    5 B T  E     +Q  144   0D  69  829   11    TT      T T   T  T         T     T        T   ITTTT TTTT  TTT TTTT T
   127    6 B Q  E     -Q  143   0D  18  832    2    QQ      Q Q   Q  Q         Q     Q        Q   QQQQQ QQQQ  QQQ QQQQ Q
   128    7 B E        -     0   0   59  833   63    EE      E E   E  E         E     E        E   QEEEE EEEE  EEE EEEE D
   129    8 B S  S    S+     0   0  101  841   38    PP      P P   P  P         P     P        P   APPPP PPPP  PPP PPPP P
   130    9 B A  E     -k  226   0C  59  842   50    SS      T S   S  S         S     S        S   SSSSS SESS  STL SSSS S
   131   10 B L  E     -k  227   0C  57  847   76    LL      L L   A  L         V     L        L   LLMLL EMAL  LLV LLLL L
   132   11 B T  E     +k  228   0C  84  848   77    TT      S S   T  T         S     T        S   ITTTT STTT  TSS TTTT S
   133   12 B T  E     -k  229   0C  18  848   68    VV      V V   V  V         I     V        M   TVVVV VVVV  VVI VVVV V
   134   13 B S    >   -     0   0   55  849   70    IS      S S   S  S         S     I        T   NSSSS SSSS  SSS SSSS S
   135   14 B P  T 3  S+     0   0   61  848   65    PP      P P   P  P         P     P        P   PPPPP PPPP  PPP PPPP P
   136   15 B G  T 3  S+     0   0   46  850    7    GG      G G   G  G         G     G        G   GGGGG GGGG  GGG GGGG G
   137   16 B E    <   -     0   0  108  850   56    GG      G G   V  G         G     G        G   GGGGG GGGG  GGG GGGG G
   138   17 B T  E     - R   0 199D  88  850   66    TT      T T   T  T         T     T        T   TTTTT TTTT  TTT TTTT T
   139   18 B V  E     - R   0 198D  14  850   33    VV      A V   V  V         V     V        V   AVVVV VVVV  VVV VVVV V
   140   19 B T  E     - R   0 197D  53  849   41    TT      T T   T  T         T     T        T   ITTTT TTTT  TTT TTTT T
   141   20 B L  E     - R   0 196D   0  849   25    LL      L L   L  L         L     L        L   LLLLL LLLL  LLL LLLL L
   142   21 B T  E     - R   0 195D  22  849   52    TT      T T   T  T         T     T        T   TTTTT TTTT  TTT TTTT T
   143   22 B b  E     -QR 127 194D   0  850    2    CC      C C   C  C         C     C        C   CCCCC CCCC  CCC CCCC C
   144   23 B R  E     -Q  126   0D 133  850   77    SG      G G   G  G         G     S        G   GAAGA GGGG  GGG GAAA G
   145   24 B S  E >   -QS 125 148D  11  850   68    SS      S L   S  S         L     S        S   ASSSS SSSS  SSL SSSS L
   146   25 B S  T 3  S+     0   0   81  850   27    SS      S S   S  S         S     S        S   SNSSN SSSS  SSS SSSS S
   147   26 B T  T 3  S-     0   0   87  850   71    TT      A S   T  T         S     T        A   TTTAT TTTT  ASS TTTT S
   148   27 B G  B <  S+S  145   0D  39  850   55    GG      G G   G  G         G     G        G   gGGGG GGGG  GGG GGGG G
   149   28 B A        -     0   0   40  390   77    AA      S S   A  A         A     A        S   aTAAT AAAA  ASA AAAA A
   150   29 B V        -     0   0    3  620   45    VV      V V   V  V         V     V        V   VVVVV VVVV  VVV VVVV V
   151   30 B T    >   -     0   0   56  541   72    TT      T S   T  T         S     T        T   TTTTT TTTT  T.S TTTT S
   152   31 B T  G >  S+     0   0   94  694   78    SS      S T   D  S         T     S        T   TNSGN DDDS  GTS SSSS S
   153   32 B S  G 3  S+     0   0   84  802   62    GG      S S   G  G         G     G        S   SAGSA GGGG  SsS GDGG G
   154   33 B N  G <  S-     0   0   13  673   73    HN      N N   L  N         N     H        N   NHHHH HHIH  HnN HYNY N
   155   34 B Y    <   -     0   0   98  781   50    YY      E Y   Y  Y         Y     Y        Y   YYSYY YYYY  YYY YFYY Y
   156   35 B A        -     0   0    0  817   59    PP      P P   P  P         P     P        T   APPPP PPPP  PPP PPAP P
   157   36 B N  E     -L  212   0C   0  827   79    AH      N G   Q  H         A     A        A   SYHYY HYHY  YGS YNNN S
   158   37 B W  E     -LM 211 171C   0  849    0    WW      W W   W  W         W     W        W   WWWWW WWWW  WWW WWWW W
   159   38 B V  E     -LM 210 169C   0  849   25    IF      L Y   I  F         Y     I        V   IFFFF IFIF  FFY FFFF Y
   160   39 B Q  E     -LM 209 168C  10  849   10    QQ      Q Q   Q  Q         Q     Q        Q   QQQQQ QQQQ  QQQ QQQQ Q
   161   40 B E  E     -LM 208 167C  20  849    8    QQ      Q Q   Q  Q         Q     Q        Q   QQQQQ QQQQ  QQQ QQQQ Q
   162   41 B K  E  >  - M   0 166C  68  849   50    KK      T T   K  K         K     K        M   KKKKK KKKK  KTT KKHK T
   163   42 B P  T  4 S+     0   0   98  843   23    FP      P P   P  P         P     S        P   PPPPP PPPP  PPP PPPP P
   164   43 B D  T  4 S-     0   0  148  846   16    GG      G G   G  G         G     G        Y   YGGGG GGGG  GGG GGGG G
   165   44 B H  T  4 S+     0   0   90  845   66    QQ      Q Q   Q  Q         K     Q        Q   QQQQQ QQQQ  QKK QQQQ K
   166   45 B L  E  <  - M   0 162C  92  846   57    SA      A A   V  A         A     S        V   VSAAS VAVA  AAP AAAA P
   167   46 B F  E     + M   0 161C   9  847   19    PP      P P   L  P         P     P        P   PPPPP PPPP  PPP PPPP P
   168   47 B T  E     -JM 109 160C  56  843   61    RR      G R   T  R         H     R        W   KRKRR MRMR  RQR RRRR R
   169   48 B G  E     + M   0 159C   1  848   64    GG      T T   T  G         M     G        G   GTTTT GTAT  TMT TAGA P
   170   49 B L  E     +     0   0C   4  848   24    LL      L L   L  L         L     L        L   ILLLL LLLL  LLL LLLL L
   171   50 B I  E     +NM 177 158C   0  848   19    II      I I   I  I         I     I        I   IIIII IIII  III IIII I
   172   51 B G  E  >  +N  176   0C   0  849   33    YY      Y Y   Q  Y         Y     Y        G   GFYYF YYYY  YYY YYYY Y
   173   52 B G  T  4 S-     0   0    9  848   87    DN      N Q   N  N         S     N        E   GNNDN DNDD  DSN DHRS Q
   174   53 B T  T  4 S+     0   0    9  849   68    TT      P T   T  T         T     T        T   TTTTT TTTT  TTT TTTT T
   175   54 B N  T  4 S+     0   0  102  841   49    NN      N N   N  N         N     N        S   TNNSN NNNS  SNN SGDS N
   176   55 B N  E  <  -N  172   0C  77  849   69    NS      R N   K  S         N     S        N   NSYNS KNKN  NNS NKKN S
   177   56 B R  E     -N  171   0C 113  850   66    LK      R R   K  K         R     L        W   RKKKK KRKK  KRR KKKK R
   178   57 B A    >   -     0   0    1  849   73    IH      P P   Y  H         P     V        Y   VLHLL YHLH  LPP HHHH P
   179   58 B P  T 3  S+     0   0   97  849   39    PS      S S   S  S         S     A        P   PSSSS SSSS  SSS SSSS S
   180   59 B G  T 3  S+     0   0   83  850   18    GW      G G   W  W         G     G        G   GWWWW WWWW  WGG WWWW G
   181   60 B V  S <  S-     0   0   13  848   23    VT      V I   T  T         V     V        L   VTTTT TTTT  TVV TTTT V
   182   61 B P    >   -     0   0   57  850    9    PP      P P   P  P         P     P        P   PPPPP PPPP  PPP PPHP P
   183   62 B A  T 3  S+     0   0   77  850   59    AA      E G   A  A         D     A        A   VAAAA AAAA  AED AAAA D
   184   63 B R  T 3  S+     0   0   58  850    5    RR      R R   R  R         R     R        Q   RRRRR RRRR  RRR RRRR R
   185   64 B F  E <   +T  198   0D   4  850    1    FF      F F   F  F         F     F        F   FFFFF FFFF  FFF FFFF F
   186   65 B S  E     -T  197   0D  51  849   17    LS      S S   S  S         S     S        S   SSSSS SSSS  SSS SSSS S
   187   66 B G  E     +T  196   0D   9  850    4    GG      G G   G  G         G     G        G   GGGGG GGGG  GGG GGGG G
   188   67 B S  E     -T  195   0D  41  850    7    SS      S S   S  S         S     S        S   ASSSS SSSS  SSS SssS S
   189   68 B L  E     -T  194   0D  59  835   79    IL      I I   I  L         I     L        L   LLLLL IIIL  LII LllL I
   190   69 B I  E >   -T  193   0D  86  842   31    FA      S S   Q  A         S     L        L   ALLLL QQQL  LSS LGGL S
   191   70 B G  T 3  S-     0   0   67  850   18    GG      G G   G  G         G     G        G   GGGGG GGGG  GEG GGGG G
   192   71 B N  T 3  S+     0   0  105  828   57    GG      N N   G  G         N     D        G   GGGGG GGGG  GNN G..G N
   193   72 B K  E <  S- T   0 190D  68  833   67    KK      K K   K  K         K     K        K   KKKKK KKKK  KKK KKKK K
   194   73 B A  E     -RT 143 189D   0  838   81    AA      A A   A  A         A     A        A   AAAAA AAAA  AAA AAAA A
   195   74 B A  E     -RT 142 188D   0  849   57    AA      V A   A  A         A     A        A   TAAAA AAAA  AAA AAAA A
   196   75 B L  E     -RT 141 187D   0  850    2    LL      L L   L  L         L     L        L   LLLLL LLLL  LLL LLLL L
   197   76 B T  E     -RT 140 186D  19  850   33    TT      T T   T  T         T     T        T   TTTTT TTTT  TTT TTTT T
   198   77 B I  E     -RT 139 185D   0  849    5    IL      I I   L  L         I     I        I   ILLLL LLLL  LII LLLL I
   199   78 B T  E    S+R  138   0D  78  850   46    KS      A T   S  S         S     K        M   TTSST SASS  STS LSSS S
   200   79 B G  S    S-     0   0   15  850   57    GG      G G   G  G         G     G        G   GGGGG GGGG  GGG GGGG G
   201   80 B A        -     0   0    0  849   51    AA      A A   A  A         A     A        T   AAAAA AAAA  AAA AVAV A
   202   81 B Q    >   -     0   0   80  849   32    QQ      R Q   Q  Q         Q     Q        Q   QQQQQ QQQQ  QQQ QQRQ Q
   203   82 B T  G >  S+     0   0   84  850   59    AP      P P   P  P         P     P        P   PPPPP PPPP  PPP PPPP P
   204   83 B E  G 3  S+     0   0   99  850   17    EE      E E   E  E         E     E        K   EEEEE EEEE  EEE EEEE E
   205   84 B D  G <   +     0   0    1  850    2    ED      D D   D  D         D     D        D   DDDDD DDDD  DDD DDDD D
   206   85 B E    <   +     0   0   71  849   74    EE      E E   E  E         E     E        E   EEEEE EEEE  EEE EEEE E
   207   86 B A  E    S- O   0 227C   3  850   14    AA      A A   A  A         A     A        S   AAAAA AAAA  AGD AAAA A
   208   87 B I  E     -LO 161 226C  55  850   71    HE      D D   E  E         D     H        V   EEEEE EEEE  EDN EEDE D
   209   88 B Y  E     -LO 160 225C   0  850    0    YY      Y Y   Y  Y         Y     Y        Y   YYYYY YYYY  YYY YYYY Y
   210   89 B F  E     -L  159   0C   5  848    8    HY      Y     Y  Y         Y     Y        F   YHYYH YHYY  YYY YYYY Y
   211   90 B b  E     -L  158   0C   0  849    1    CC      C     C  C         C     C        C   CCCCC CCCC  CCC CCCC C
   212   91 B A  E     -LP 157 221C   0  848   73    VL      A     A  L         G     L        S   AWWWW VWVW  WCA LLLL I
   213   92 B L  E     - P   0 220C   0  845   83    LL      L     L  L         L     L        L   LLLLL LLLL  LLL LLLL L
   214   93 B W  E     + P   0 219C  21  834   71    WY      W     W  Y               Y        W   W YH  WVWH  HY  SYYY  
   215   94 B Y  E >  S- P   0 218C  33  829   88    YY      H     Y  Y               Y        H   F YY  YYYY  YY  YHRY  
   216   95 B S  T 3  S-     0   0  106  829   66    GS      S     S  S               S        G   S DS  SSSS  SS  SVDG  
   217   96 B N  T 3  S+     0   0  105  824   81    Sg      N     s  g               g        D   N Gg  ggSG  gG  gdgG  
   218   97 B H  E <   -P  215   0C  39  647   66     h      H     h  q               r        H   h Vq  hrRA  qp  rh.   
   219   98 B L  E     -P  214   0C   1  382   85            W                        H        Y   t G      W   y   Lv   
   220   99 B V  E     -P  213   0C  12  489   66            V                        R            V L          V   VV   
   221  100 B F  E     -P  212   0C  17  540   30            F                        L            T F          F   FF   
   222  101 B G        -     0   0    1  481   35            G                        G            D G          G   GG   
   223  102 B G        -     0   0   51  513   58            G                        L            A G          S   GG   
   224  103 B G        -     0   0    8  528   33            G                        G            G G          G   GG   
   225  104 B T  E     - O   0 209C   0  550   33            T                                     G T          T   TT   
   226  105 B K  E     -kO 130 208C  82  547   67            Q                                     E R          H   KK   
   227  106 B L  E     -kO 131 207C   0  546   44            L                                     V L          L   LL   
   228  107 B T  E     -k  132   0C  34  614   65            T                                       T          S   TT   
   229  108 B V  E     -k  133   0C   3  593   35            V                                       V          V   VV   
   230  109 B L              0   0  120  399   31            L                                       L          L   LL   
   231  110 B G              0   0   62  207   39            G                                       G          G   SS   
## ALIGNMENTS  421 -  490
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    1 A E              0   0  185  771   30     Q QE     Q    E   Q Q Q QQQE    QQQQ Q Q QQQ QQ     QQ Q  QQ QEE   
     2    2 A V        +     0   0   18  834   19     V VV     V    V   V V V VVVV    VVVV V V VVV VV     VV V  VV TVV   
     3    3 A Q  E     -A   25   0A  90  836   34     Q QQ     Q    Q   Q Q Q QQQQ    QQQQ Q Q QHH QQ     HQ Q  QQ QKK   
     4    4 A L  E     -A   24   0A  13  881    3     L LL     L    F   L L L LLLL    LLLL L L LLL LL     LL L  LL LLL   
     5    5 A Q  E     -A   23   0A 107  882   70     V VL     V    V   V V V VVVQ    VVVV V V VVV VV     VV I  VV VLL   
     6    6 A Q  E     -A   22   0A  14  887   31     Q QQ     Q    Q   Q Q Q QQQQ    QQQQ Q Q QQQ QQ     QQ Q  QQ QEE   
     7    7 A S        -     0   0   33  892   13     F SS     S    S   S S S SSSS    SSSS S S SSS SS     SS S  SS SSS   
     8    8 A G        -     0   0   52  907   11     G GG     G    G   G G G GGGG    GGGG G G GGG GG     GG G  GG GGG   
     9    9 A A        -     0   0   80 1179   51     AAAA     A GAAA   A A A APAA    AAAA A A SAA AA GG  AA S  AA AGGG  
    10   10 A E  E     -d  116   0B  68 1189   46     EEEE     E DEEE   D E E EEEE    EEEE E E EEE EE GD  EE E  EE EGGD  
    11   11 A L  E     +d  117   0B 130 1195   22     VLLV     V LLLV   V V V VVVL    VVVV V V LVV VV LL  VV L  VV VLLL  
    12   12 A V  E     -d  118   0B  28 1197   47     KVRK     R VVVR   K R R KKKV    KKKK K R KKK RR VV  KE R  RR RVVV  
    13   13 A K    >   -     0   0  145 1201   50     KRKK     K KRRK   K K K KKKK    KKKK K K KKK KK KK  KK K  KK KQQK  
    14   14 A P  T 3  S+     0   0   70 1203    8     PPPP     P PPSP   P P P PPPA    PTPP P P PPP PP PP  PP P  PP PPPP  
    15   15 A G  T 3  S+     0   0   59 1209   28     GGGG     G GGGG   G G G GGGG    GGGG G G GGG GG GG  GG G  GG GGGG  
    16   16 A A    <   -     0   0   36 1213   63     ATAA     A GAAA   A A A SASS    DAAS A A AAA AA GG  AS A  AA AGGG  
    17   17 A S        -     0   0   66 1210   29     SLSS     S SLSS   S S S LSSS    SSSS S S SSS SS SS  SS S  SS SSSS  
    18   18 A V  E     - B   0  83A  10 1213   32     VVVV     V LVVV   V V V VVVV    VVVV V V VVV VL LL  VV V  VV VLLL  
    19   19 A K  E     - B   0  82A 119 1211   53     KKKK     K KKKK   K K K KKKK    KKKR K K KKK KK KK  KK K  KK RK.K  
    20   20 A L  E     - B   0  81A   0 1214   21     VLIV     V LLLV   V V V AVVM    VVVV V V VVV VV LL  VV V  VV VLLL  
    21   21 A S  E     - B   0  80A  31 1215   35     SSSS     S SSSS   S S S SSSS    SSSS S S SSS SS SS  SS S  SS SSSS  
    22   22 A a  E     -AB   6  79A   0 1216    0     CCCC     C CCCC   C C C CCCC    CCCC C C CCC CC CC  CC C  CC CCCC  
    23   23 A K  E     -AB   5  78A 113 1216   70     KKKK     K AKTK   K K K KKKK    KKKK K K KKK KK AA  TK K  KK KAAS  
    24   24 A A  E     +A    4   0A   2 1216   49     AAAA     A AATA   A A A AAAA    AAAA A A AAA AA AA  AA A  AA AAAA  
    25   25 A S  E     +A    3   0A  49 1216   12     SSPS     S SSSS   S S S SSST    SSSS S S SSS SS SS  SS S  SS SSSS  
    26   26 A G  S    S+     0   0   56 1215    3     GGGG     G GGGG   G G G GGGG    GGGG G G GGG GG GG  GG G  GG GGGG  
    27   27 A Y  S    S-     0   0   39 1216   33     YFYY     Y FFVY   Y Y Y YYGY    YYYG Y Y YYD YY FF  YD Y  YY YFFF  
    28   28 A T    >   -     0   0   90 1216   52     TNTT     T TNNT   T T T TTTT    TSTT T T TTS TT TT  PT T  TT TDDT  
    29   29 A F  G >  S+     0   0   13 1216   27     FIFF     F FIIF   F F F FFFF    FIFF F F FFF FF FF  FF F  FF FFFF  
    30   30 A T  G 3  S+     0   0   40 1216   55     TKTT     T SKKT   T T T TTSS    SSSR T T TTS TT SS  TS T  TI ISSN  
    31   31 A S  G <  S+     0   0   23 1216   57     SDRS     S SDDD   N D S SSRS    ddNN S S TSS DS SS  nK N  SS DRRS  
    32   32 A Y  E <  S-E  100   0B  40 1139   28     YYYY     Y YYYY   Y Y H NYSY    yyYY N Y YYY YY YY  fY Y  YY SYYY  
    33   33 A W  E     -E   99   0B  40 1148   92     TYWY     Y GYYW   F Y Y AIAE    ..YA F A PGA YW AG  .A A  AY YWWG  
    34   34 A M  E     -EF  98  51B   0 1206   49     MIMI     M MLMM   F M M MIIL    MIMI M V MVI MM MM  II L  VM IMMM  
    35   35 A H  E     -EF  97  50B   0 1212   72     HHHH     H SHNH   H H H HSIY    HHNS H H NSH HH SS  NN N  HH HSSS  
    36   36 A W  E     -EF  96  49B   0 1216    0     WWWW     W WWWW   W W W WWWW    WWWW W W WWW WW WW  WW W  WW WWWW  
    37   37 A V  E     -EF  95  47B   0 1216   17     VVVV     V VVVV   V V V VVVV    VVVV V V VVV VV VV  VV L  VV IVAI  
    38   38 A K  E     -EF  94  46B   7 1216   22     RKRR     R RRKR   R R R RRRR    RRRR R R RRR RQ RR  RR R  RR RRRR  
    39   39 A Q  E     +EF  93  45B  20 1216    5     QQQQ     Q QQQQ   Q Q Q QQQQ    QQQQ Q Q QQQ QQ QQ  QQ Q  QQ QQQQ  
    40   40 A R    >   -     0   0   35 1216   71     TRAA     A TRRA   A A A AAAA    AAAA A A AAA AT TT  AA A  AA AAAT  
    41   41 A P  T 3  S+     0   0  130 1215   15     PPPP     P PPPP   P P P PPPP    PPPP P P PPP PP PP  PP P  PP PPPP  
    42   42 A G  T 3  S+     0   0   83 1216   22     GEGE     G DEEG   G G G GGGG    GGGG G G GGG GG ED  GG G  GG GGGD  
    43   43 A R  S <  S-     0   0  156 1216   43     QQQQ     Q KQQQ   Q Q Q QQQQ    QQQQ Q Q QQQ QQ KK  QQ Q  QQ HKKM  
    44   44 A G        -     0   0   16 1215   36     GGGG     G RGGA   G G G GGGG    GGGG G G GGR GG RR  SG G  GG GGGR  
    45   45 A L  E     -F   39   0B   8 1215   10     LLLL     L LLLL   P L L LLLL    LLPL L L LLL LH LL  LL L  LL LLQL  
    46   46 A E  E     -F   38   0B  34 1216    6     EEEE     E EEEE   E E E EQEE    EEEE E E EEA EE EE  ED E  EE EEEE  
    47   47 A W  E     -F   37   0B   3 1216   10     WWWW     W WWWW   W W W WWWD    WWWW W W WWW WW WW  WW W  WW WWWW  
    48   48 A I  E     -     0   0B   0 1215   31     MIVM     V VIVM   M M M MMML    MMMM M M MMM MM VV  MM M  MV VIIV  
    49   49 A G  E     -FG  36  60B   0 1216   35     GGGG     G AGGG   G G G EGGG    GAGG G G GGG GG AA  GG G  GG GGGA  
    50   50 A R  E     -FG  35  59B  32 1216   94     GWTK     T TLWS   M W R WWGY    WWVG G W WWW EW TT  WG W  WT WEET  
    51   51 A I  E     -FG  34  58B   0 1207   17     IIVI     F IIII   I V I IIII    IIIV I V III VF II  II I  VI IIII  
    52   52 A D     >  -     0   0   26 1212   86     YDNF     H SDDH   N Y Y NYVS    DRNI Y N DSI NY SS  NI N  NH NNNS  
    53   53 A P  T  4 S+     0   0    0 1212   83     PPAP     P SPPP   P P P PPPS    PPPP L P TAA PP SS  TP T  PP PPPS  
    54   54 A N  T  4 S-     0   0   96 1213   69     GENG     L GEEE   R G G GGMS    NQST G Y NYD NN GG  GI N  YL NDGG  
    55   55 A G  T  4 S-     0   0   69 1216   57     NSND     H GNNY   D S S NNFS    NNGL N N TNN NN GG  NL T  NL SSSG  
    56   56 A G     <  +     0   0   25  915   61     GGGS     E SGGS   G G G .GGA    GGGH G G GGG GG SS  GT G  GG GSSG  
    57   57 A G        -     0   0   43 1195   77     NDKD     I YNDN   S N N GNPY    DGST N N NDN NN YY  NT K  NS GTTF  
    58   58 A T  E     -G   51   0B  62 1209   46     TVTT     T TKTM   T T T NTPP    TTAT T T PTT TT TT  TT A  TT TIIT  
    59   59 A K  E     -G   50   0B  89 1212   88     NIIK     N YMEN   K N N TKNN    RVRN N K TNK NK YY  KT T  KN NNNH  
    60   60 A Y  E     -G   49   0B  46 1215    9     YYDY     Y YYYY   Y Y Y KYYY    FSYY Y Y YFY YY YY  YY Y  YY YYYY  
    61   61 A N    >>  -     0   0   12 1216   63     ADAA     A PDAA   A A A YTAA    AASV A A AAS AA PP  SA A  AA ATTP  
    62   62 A E  G >4 S+     0   0  148 1216   64     QPQQ     Q DPPQ   Q Q Q VQQQ    QEQE Q Q QQQ QQ DD  QQ Q  QQ PPPD  
    63   63 A K  G 34 S+     0   0  109 1216   64     KKKK     K SKNK   R K K QKKK    RKKR K K AKK KK SS  KR A  KK RSSS  
    64   64 A F  G X> S+     0   0    5 1216   45     FFFF     F VFFF   F F F FFFF    FFFF F F FFF FF VV  FF F  FF FLLV  
    65   65 A K  T << S+     0   0  156 1216   40     QQQQ     Q KRQR   Q Q Q QQQQ    QQQQ Q Q TQQ QQ KK  QQ T  QQ QKKK  
    66   66 A S  T 34 S+     0   0  108 1216   35     GGDG     G GAGD   G G G GGGG    GGGG G G GGG GG GG  GG G  GS GDDG  
    67   67 A K  T <4 S+     0   0   33 1214   21     RKRR     R RKKR   R R R RRRR    RRRR R R RRR RR RR  RR R  RR RKKR  
    68   68 A A  E  <  -C   83   0A   2 1216   69     VAAV     V FAAV   V V V VVVV    VVLI V V FLV VV FF  VV F  VV VFFF  
    69   69 A T  E     -C   82   0A  58 1216   37     TSTA     S TSSA   S S S TTTT    TTTT T S VTT SS TT  TT V  SS TIIT  
    70   70 A L  E     +C   81   0A   7 1216   27     MIMM     I IIMM   M M I MMII    MIMI M M FVI MM II  II F  MI MIIV  
    71   71 A T  E     -C   80   0A  57 1213   47     TTTI     T STTT   T T T TTTT    TTTT T T STT TT SS  TT S  TT TSSS  
    72   72 A V  E     -C   79   0A  28 1216   71     ASAV     E RASA   R R G SAAA    RIRA A S LTR RR RR  RA L  SE RRRR  
    73   73 A D  E   > -C   78   0A  69 1216    7     DDDD     D DDDD   D D D DDDD    DDDD D D DDD DD DD  DD D  DD DDDD  
    74   74 A K  T > 5S+     0   0  105 1216   62     TTKK     T NTTK   T T T TKEE    TTTE T T TTT TT NN  TK T  TT ANNN  
    75   75 A P  T 3 5S+     0   0  122 1215   37     SSSS     Y ASSS   S S S SSSS    SSSS S S SSS SS AA  WS S  SY SAAA  
    76   76 A S  T 3 5S-     0   0   37 1216   65     TSTT     A KSSA   T T T TTTT    ILTT T M VTA TT KK  TT V  MA FKKG  
    77   77 A S  T < 5 +     0   0   24 1216   48     SNNN     S NNNS   S S S RSNN    SNSS S S SNS SN NN  TN S  SS SNNS  
    78   78 A T  E   < -BC  23  73A   8 1216   64     TTTT     T TTTT   T T T TTTT    ATTT T T TTT TT TT  TT T  TT TTTT  
    79   79 A A  E     -BC  22  72A   0 1207   67     AAAA     A LTAA   I A A AAAA    AAVA A A AAA AA LL  AA T  AA ALLL  
    80   80 A Y  E     -BC  21  71A  61 1209   36     YYYY     Y YNYY   Y Y Y YYYY    YYYY Y Y YYY YY YY  YY Y  YY YYYF  
    81   81 A M  E     -BC  20  70A   0 1212    9     MLMM     M LLLM   M M L MMMM    MMMM M M LML MM LL  MM L  MM MLLL  
    82   82 A Q  E     -BC  19  69A  69 1215   43     EQEE     E QQQE   E E E EEEE    EEDE E D QEE EE QQ  DE Q  DE DQQQ  
    83   83 A L  E     -BC  18  68A   0 1215   14     LFLL     L MLLL   L L L LLLL    VLLL L L ILL LL MM  LL I  LL LMMM  
    84   84 A S        +     0   0   32 1215   56     SSTS     S SISR   S S S SSSS    STSS S S SRS SS SS  SR S  SS RSSS  
    85   85 A S  S    S-     0   0   89 1216   25     SSSS     S SSSS   S S S TSSS    RSSS S S SSS SS SS  SS S  SS SKKS  
    86   86 A L        +     0   0    2 1216   15     LLLL     L LLLL   L L L LLLL    LLLL L L LLL LL LL  LL L  LL LVVL  
    87   87 A T    >   -     0   0   61 1215   68     RTRR     R KTTR   R R R RRRR    RKRR R S KRT RR RK  RR K  SR RRRK  
    88   88 A S  G >  S+     0   0   72 1216   59     PSAA     A SSSD   S A A PHSS    SSSS P A ASS AA SS  SF A  AA SSSS  
    89   89 A E  G 3  S+     0   0  107 1216   21     EEEE     E EEEE   E E E EEEE    DDDE E E EDE EE EE  ED E  EE DEEE  
    90   90 A D  G <  S+     0   0    7 1216    3     DDDD     D DDDD   D D D DDDD    DDDD D D DDD DD DD  DD D  DD DDDD  
    91   91 A S    <   +     0   0   31 1216   34     TTTT     T TTTT   T T M MTTT    TTTT T T TTT TT TT  TT T  TT STTT  
    92   92 A A  E    S- H   0 116B  10 1214    5     AAAA     A AAAA   A A A AAAA    AAAA A A AAA AA AA  AA A  AA AAAA  
    93   93 A V  E     -EH  39 115B  21 1216   48     VVIV     V MVVM   M M V VVFV    VLVV V L VMM MM MM  VV V  LV VLLM  
    94   94 A Y  E     -EH  38 114B   0 1216    1     YYYY     Y YYYY   F Y Y YYYY    YYYY Y Y YYY YH YY  YY Y  YY FYYY  
    95   95 A Y  E     -E   37   0B   1 1216    3     YYYY     Y YYYY   F Y Y YYFF    YYFY Y Y YYY YY YY  WY F  YY YYYY  
    96   96 A a  E     +E   36   0B   0 1216    1     CCCC     C CCCC   C C C CCCC    CCCC C Y CCC CC CC  CC C  YC CCCC  
    97   97 A A  E     -EI  35 110B   0 1215   24     AAAG     A AANA   A A A VAAA    AAAA V A TAA AA AA  AA A  AA AAAG  
    98   98 A R  E     -E   34   0B  13 1196   38     RSSS     R RRGR   R R R RR V    RRRR R R TRR RR RR  RR R  RR KRRR  
    99   99 A M  E     -EI  33 107B   5 1101   82     HYDD     H HLYD   A D D  D R    EGES D D LGA YD RH  DS D  DH SLLH  
   100  100 A W  E >   -E   32   0B  89 1101   89     TGpS     S GDGy   G T T  T V    ghmR T T SPL Tt DY  aT R  Ts DGGR  
   101  101 A Y  T 3  S+     0   0  112  572   91     VNv.     E YYN.   P V V  V I    ..fY V V ..T .. GG  .Y W  Vg PYYD  
   102  102 A Y  T 3  S-     0   0  133  629   92     FIH.     D YWS.   G R R  E S    ..GY E R GDI .. KS  .Y N  RA FYYY  
   103  103 A G  S <  S+     0   0   38  705   79     LLF.     D GGL.   Y G C  K R    ..gY N D YYn .. vS  .y D  gg wGGG  
   104  104 A T        -     0   0   32  784   66     ...g     . ...g   g S P  . .    gdsd . . seg vp q.  gg .  rg y..t  
   105  105 A Y        +     0   0   81  679   93     .A.g     . Y.As   y . .  . .    iyyn . . dpt qe YY  tt .  wp s..f  
   106  106 A Y        -     0   0   32  842   66     .WYf     . Y.Wh   Y . .  W Y    yYyy W . wWe LS YY  Yy .  aS yYYY  
   107  107 A F  E     +I   99   0B   0  885   48     .FLf     . F.Ff   F . .  . F    mFmm . . eFf L. FF  Fm .  f. lFFF  
   108  108 A D  E     +     0   0B  25  997   46     .ADN     . D.IN   D . .  G D    DDDD G . DDD NG DD  DD .  N. DDDD  
   109  109 A Y  E     -J  168   0C 108 1059   61     MHHY     M Y.YC   Y Q .  P G    VYVV P Y YYI YL YY  YV Y  FC VVYY  
   110  110 A W  E     -I   97   0B  23 1092    2     WWWW     W W.WW   W W W  W W    WWWW W G WWW YW WW  WW W  RW WWWW  
   111  111 A G        -     0   0    3 1067   15     VGGG     A G.GG   G E G  S G    GGGG S G GGG TG GG  GG G  GA GGGG  
   112  112 A Q        -     0   0  141 1047   41     PQQQ       QQQQ   Q P S  R Q    QQQQ R S QQQ K  QQ  QQ Q  SQ QAQQ  
   113  113 A G        -     0   0   20 1013   12     GGGG       GGGG   G   S  G G    GGGG G A GGG G  GG  GG G  AG GGGG  
   114  114 A T  E     - H   0  94B   2  996   31      TTT       TTTT   T   S  T T    TTTT T T TTT A  TT  TT T  TF TTTT  
   115  115 A T  E     - H   0  93B  60  979   76      LLL       TSLL   L   S  S L    LLTT S E LLM K  TT  LT Q  EP TTTN  
   116  116 A L  E     -dH  10  92B   1  972   19      VVV       LVVV   V   F  C V    VVVV C L VVV L  LL  VV V  LL VVLL  
   117  117 A T  E     -d   11   0B  57  953   21      TTT       TTTT   T   F  V      TTTT V T TTT S  TT  TT T  TK TTTT  
   118  118 A V  E     +d   12   0B   4  935    8      VVV       VVVV   V   V  I      VVVV I E VVV    VV  VV V  EL VVVV  
   119  119 A S              0   0   64  917   10       SS       SSSS   S   S  S      SSSS S S SSS    SS  SS S  SS SSSS  
   120  120 A S              0   0  122  885   21       SS       SSAS   S             SSSS   P SSS    SS  SS S  PA SSSS  
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32  QQQ    QQQQQ Q    QQQ   Q Q    QQQQ    Q Q Q   Q  Q  QQ  Q QQ  E    QQ
   123    2 B A        -     0   0   19  713   70  TAA    TTTTA A    APT   A T    PTTP    A T A   T  A  TT  T TT  T    II
   124    3 B V        -     0   0   84  765   49  VVV    VVVVV V    VVV   V V    VVVV    V V V   V  V  VV  V VV  V    VV
   125    4 B V  E     -Q  145   0D  10  820   26  VVV    VVVVV V    VVV   V V    VVVV    V V V   V  V  VV  V VV  V    VV
   126    5 B T  E     +Q  144   0D  69  829   11  TTM    TTTTT T    TTT   T T    TITT    I T T   T  T  TI  T TT  T    TT
   127    6 B Q  E     -Q  143   0D  18  832    2  QQQ    QQQQQ Q    QQQ   Q Q    QQQQ    Q Q Q   Q  Q  QQ  Q QQ  Q    QQ
   128    7 B E        -     0   0   59  833   63  EEE    EEEEE E    EEE   E E    EEEE    D E E   E  E  EE  E ED  E    EE
   129    8 B S  S    S+     0   0  101  841   38  PPP    PPPSP P    PPP   P P    PPPP    P P P   S  P  PP  P PP  P    PP
   130    9 B A  E     -k  226   0C  59  842   50  SSS    SSSSS S    SSS   S S    SSSS    S S S   S  S  SS  S SS  S    SS
   131   10 B L  E     -k  227   0C  57  847   76  MLL    LLLLL L    LML M A L    MLVM    F M E   L  E  LL  M ML  L    LL
   132   11 B T  E     +k  228   0C  84  848   77  STT    TTTTT T    TST S T T    SSSS    S S S   T  S  SW  S SS  S    SS
   133   12 B T  E     -k  229   0C  18  848   68  VVV    VVVVV V    DVV V V V    VVIV    V V V   V  V  VV  V VV  V    VV
   134   13 B S    >   -     0   0   55  849   70  SIS    SSSIS I    rAS S S S    TSST    S S V   I  V  PS  S SS  S    SS
   135   14 B P  T 3  S+     0   0   61  848   65  PPP    PPPPP P    pPP P P P    PPAP    L V P   P  P  SP  P PP  P    PP
   136   15 B G  T 3  S+     0   0   46  850    7  GGG    GGGGG G    GGG G G G    GGGG    G G G   G  G  GG  G GG  G    GG
   137   16 B E    <   -     0   0  108  850   56  GGE    GGGGG G    GGG G G G    GGGG    G G V   G  V  GG  G GG  G    VV
   138   17 B T  E     - R   0 199D  88  850   66  TTT    TTTTT T    TAT T T T    STTA    T T T   T  T  TT  T TT  T    TT
   139   18 B V  E     - R   0 198D  14  850   33  VVV    VVVIV V    VVV V V V    VVVV    V V V   I  V  VV  V VV  V    VV
   140   19 B T  E     - R   0 197D  53  849   41  TTT    TTTTT T    TTT T T T    TTTT    I T T   T  T  TT  T TT  T    TT
   141   20 B L  E     - R   0 196D   0  849   25  LLL    LLLML L    LLL L L L    LLLL    L L L   M  L  LL  L LL  L    LL
   142   21 B T  E     - R   0 195D  22  849   52  TTT    TTTTT T    TST T T T    STTS    T T T   T  T  TT  T TT  T    TT
   143   22 B b  E     -QR 127 194D   0  850    2  CCC    CCCGC C    CCC C C C    CCCC    C C C   G  C  CC  C CC  C    CC
   144   23 B R  E     -Q  126   0D 133  850   77  GSG    AAASA S    GSA G G A    SGGS    G G S   S  S  GG  G GG  G    GG
   145   24 B S  E >   -QS 125 148D  11  850   68  LSS    SSSSS S    SLS L S S    QLLL    L L T   S  T  LL  L LL  L    PP
   146   25 B S  T 3  S+     0   0   81  850   27  SSS    SSSSS S    SSS S S S    SSSS    R S N   S  N  TS  S SS  S    TT
   147   26 B T  T 3  S-     0   0   87  850   71  STT    TTTTT T    TTT S T T    TSST    T S T   T  T  SS  S SS  S    SS
   148   27 B G  B <  S+S  145   0D  39  850   55  GGG    GGGGG G    GGG G G G    GGGG    G G G   G  G  GG  G GG  G    GG
   149   28 B A        -     0   0   40  390   77  AAA    AAAAA A    AAA A A A    ASAA    S A E   A  E  SS  S AA  S    SS
   150   29 B V        -     0   0    3  620   45  IVV    VVVVV V    VVV V V V    IVVV    V V V   V  V  VV  V VV  V    II
   151   30 B T    >   -     0   0   56  541   72  STT    TTTIT T    TTT S T T    TSST    S S T   I  T  TS  T ST  S    SS
   152   31 B T  G >  S+     0   0   94  694   78  SCT    SSSTS S    DTS T D S    STST    T S S   T  S  SS  T TS  T    RR
   153   32 B S  G 3  S+     0   0   84  802   62  GGG    GGGGG G    SSG S G G    SSGS    S G G   G  G  TN  S GG  S    SS
   154   33 B N  G <  S-     0   0   13  673   73  NHH    YYHHH H    HNY N H Y    ITNN    N N H   H  H  NN  N NN  N    NN
   155   34 B Y    <   -     0   0   98  781   50  YYY    YYYYS Y    YYY Y Y Y    YYHY    Y Y Y   Y  Y  YY  Y YY  Y    YY
   156   35 B A        -     0   0    0  817   59  PPP    PPAPP P    PPP P P P    PPPP    P P P   P  P  PP  P PP  P    PP
   157   36 B N  E     -L  212   0C   0  827   79  SRY    NNNVH R    YSN A Y N    GKSA    R G Y   V  Y  SY  G GS  S    GG
   158   37 B W  E     -LM 211 171C   0  849    0  WWW    WWWWW W    WWW W W R    WWWW    W W W   W  W  WW  W WW  W    WW
   159   38 B V  E     -LM 210 169C   0  849   25  YMF    FFFLC M    FYF Y I F    FFFF    Y Y I   L  I  YY  I FY  Y    YY
   160   39 B Q  E     -LM 209 168C  10  849   10  QQQ    QQQQQ Q    QHQ Q Q Q    QQQQ    Q Q Q   Q  Q  QQ  Q QQ  Q    QQ
   161   40 B E  E     -LM 208 167C  20  849    8  QQQ    QQQQQ Q    QQQ Q Q Q    QQQQ    Q Q Q   Q  Q  QQ  Q QQ  Q    QQ
   162   41 B K  E  >  - M   0 166C  68  849   50  TKK    KKHKK K    KKK T K K    KTTK    T T K   K  K  TT  T TT  T    TT
   163   42 B P  T  4 S+     0   0   98  843   23  PSS    PPPPP S    PPP P P P    PPPP    P P P   P  P  PP  P PP  P    PP
   164   43 B D  T  4 S-     0   0  148  846   16  GGG    GGGSG G    GGG G G G    GGGG    G G G   S  G  GG  G GG  G    GG
   165   44 B H  T  4 S+     0   0   90  845   66  KQQ    QQQQQ Q    ASQ K Q Q    SKKT    K K Q   Q  Q  KK  Q KK  Q    KK
   166   45 B L  E  <  - M   0 162C  92  846   57  PSA    AAAPA S    PAA P V A    AAPV    A P V   P  V  TT  A PP  A    AA
   167   46 B F  E     + M   0 161C   9  847   19  PPP    PPPPP P    .PP P P P    PPPP    P P P   P  P  PP  P PP  P    PP
   168   47 B T  E     -JM 109 160C  56  843   61  RRR    RRRRR R    RQR R R R    RRRQ    R R R   R  R  RR  S RR  R    RR
   169   48 B G  E     + M   0 159C   1  848   64  QGT    AAGQT G    TLA Q T A    QTMK    T T T   Q  T  RL  T TP  T    LL
   170   49 B L  E     +     0   0C   4  848   24  LLL    LLLLL L    LLL L L L    LLLL    L L L   L  L  LL  L VL  L    LL
   171   50 B I  E     +NM 177 158C   0  848   19  III    IIILI I    III I I I    IIII    T I I   L  I  II  I II  I    II
   172   51 B G  E  >  +N  176   0C   0  849   33  YYY    YYYYY Y    YYY Y Y Y    HYYY    Y Y Y   Y  Y  YY  Y YY  Y    YY
   173   52 B G  T  4 S-     0   0    9  848   87  QRD    SSRNN R    .ES S N S    GNSS    S G D   N  D  ND  R EQ  S    NN
   174   53 B T  T  4 S+     0   0    9  849   68  TTT    TtTAT T    NTT T T T    TTTT    T T T   A  T  TT  T TT  T    TT
   175   54 B N  T  4 S+     0   0  102  841   49  NNS    SsDNS N    TNS N D S    SSNN    N N S   N  S  NN  S NN  N    DD
   176   55 B N  E  <  -N  172   0C  77  849   69  NSN    NKKNF S    NKN N K N    THTS    N S N   N  N  SN  N TS  T    SS
   177   56 B R  E     -N  171   0C 113  850   66  RLK    KHKLK L    SSK R K K    RRRR    R R K   L  K  RR  R RR  R    RR
   178   57 B A    >   -     0   0    1  849   73  PVL    HSHAH V    KPH P H H    PPPP    P P L   A  L  PL  L PP  P    PP
   179   58 B P  T 3  S+     0   0   97  849   39  SAS    SWSSS A    HAS S S S    SSSS    S S S   S  S  SP  S SS  S    SS
   180   59 B G  T 3  S+     0   0   83  850   18  GGW    WTWGW G    SGW G W W    GGGG    G G W   G  W  GG  G GG  G    GG
   181   60 B V  S <  S-     0   0   13  848   23  VVT    T.TVT V    WIT V T T    IVVI    I V T   V  T  VV  V VV  V    VV
   182   61 B P    >   -     0   0   57  850    9  PPP    PPHPP P    PPP P P P    PPPP    P P P   P  P  PP  P PP  P    PP
   183   62 B A  T 3  S+     0   0   77  850   59  DAA    AAAAA A    CAA G A A    AEDA    E D A   A  A  EG  S DD  D    EE
   184   63 B R  T 3  S+     0   0   58  850    5  RRR    RRRWR R    RRR R R G    RRRR    R R R   W  R  RR  R RR  R    RR
   185   64 B F  E <   +T  198   0D   4  850    1  FFF    FFFFF F    FFF F F F    FFFF    F F F   F  F  FF  F FF  F    FF
   186   65 B S  E     -T  197   0D  51  849   17  SSS    SSSSS S    SSS S S S    SSSS    S S S   S  S  SS  S SS  S    SS
   187   66 B G  E     +T  196   0D   9  850    4  GGG    GGGGG G    GGG G G G    GGGG    G G G   G  G  GG  G GG  G    GG
   188   67 B S  E     -T  195   0D  41  850    7  SSS    SssSS S    SSS S S S    ASSS    S S S   S  S  YS  S SS  S    SS
   189   68 B L  E     -T  194   0D  59  835   79  ILL    LllLL L    LIL I I L    IIII    I I I   L  I  II  I II  I    II
   190   69 B I  E >   -T  193   0D  86  842   31  SLL    LGGLL L    FSL S Q L    SSSS    S S Q   L  Q  SS  S SS  L    SS
   191   70 B G  T 3  S-     0   0   67  850   18  GGG    GGGGG G    GGG G G G    GGGG    G G G   G  G  GG  G GG  G    GG
   192   71 B N  T 3  S+     0   0  105  828   57  NDG    G..DG D    GNG N G G    NNNN    N N G   D  G  NN  N NN  N    NN
   193   72 B K  E <  S- T   0 190D  68  833   67  KKK    KKKKK K    KKK K K K    KKKN    K K K   K  K  KK  K KK  K    KK
   194   73 B A  E     -RT 143 189D   0  838   81  AAA    AAAAA A    AAA A A A    AAAA    A A A   A  A  AA  A AA  A    AA
   195   74 B A  E     -RT 142 188D   0  849   57  AAA    AAAAA A    AAA A A A    AAAA    A A A   A  A  AA  A AA  A    TT
   196   75 B L  E     -RT 141 187D   0  850    2  LLL    LLLLL L    LLL L L L    LLLL    L L L   L  L  LL  L LL  L    LL
   197   76 B T  E     -RT 140 186D  19  850   33  TTT    TTTTI T    TTT T T T    TTTT    T T T   T  T  TT  T TT  T    TT
   198   77 B I  E     -RT 139 185D   0  849    5  IIL    LLLIL I    .IL I L L    IIII    I I L   I  L  II  I II  I    II
   199   78 B T  E    S+R  138   0D  78  850   46  SKS    SSSAS K    LTS T S S    TTST    T S S   A  S  TT  T SS  T    TT
   200   79 B G  S    S-     0   0   15  850   57  GGG    GGGGG G    GGG G G G    GGGG    G G G   G  G  GG  G GG  G    GG
   201   80 B A        -     0   0    0  849   51  AAA    VVAAA A    AVV A A A    VAAV    A A A   A  A  AA  A AA  A    AA
   202   81 B Q    >   -     0   0   80  849   32  QQQ    QQRQQ Q    QQQ Q Q Q    QQQQ    Q Q Q   Q  Q  QQ  Q QQ  Q    QQ
   203   82 B T  G >  S+     0   0   84  850   59  PPP    PPPAP P    PAP P P P    AAPA    P P P   A  P  PL  P PP  T    PP
   204   83 B E  G 3  S+     0   0   99  850   17  EEE    EEEEE E    EEE E E E    EEEE    E E E   E  E  EE  E EE  D    EE
   205   84 B D  G <   +     0   0    1  850    2  DDD    DDDDD D    DDD D D D    DDDD    D D D   D  D  DD  D DD  D    DD
   206   85 B E    <   +     0   0   71  849   74  EEE    EEEEE E    HEE E E E    EEEE    E E E   E  E  EE  E EE  E    EE
   207   86 B A  E    S- O   0 227C   3  850   14  AAA    AAAAA A    AAA A A A    AGAA    A A A   A  A  AA  A AA  S    GG
   208   87 B I  E     -LO 161 226C  55  850   71  DHE    EDDDE H    EDE D E E    DDDD    D D E   D  E  DD  D ED  D    DD
   209   88 B Y  E     -LO 160 225C   0  850    0  YYY    YYYYY Y    YYY Y Y Y    YYYY    Y Y Y   Y  Y  YY  Y YY  Y    YY
   210   89 B F  E     -L  159   0C   5  848    8  YYY    YYYYY Y    YYY Y F Y    YYHY    Y H Y   Y  Y  YH  Y YY  Y    YY
   211   90 B b  E     -L  158   0C   0  849    1  CCC    CCCRC C    CCC C C C    CCCC    C C C   R  C  CC  C CC  C    CC
   212   91 B A  E     -LP 157 221C   0  848   73  GLW    LLLVL S    WAL A W L    AC I    D N A   V  A  AL  A AI  M    SS
   213   92 B L  E     - P   0 220C   0  845   83  LLL    LLLLL L    LVL L L L    EL V    L L L   L  L  LL  V LL  L    II
   214   93 B W  E     + P   0 219C  21  834   71   YL    YYYYH L    VWY D Y Y    WY W    Y Y W   Y  G  YY  Y HY  Y      
   215   94 B Y  E >  S- P   0 218C  33  829   88   YH    YYRYY Y    YAY I F Y     F I      M Y   Y  Y  TM  M LN  M      
   216   95 B S  T 3  S-     0   0  106  829   66   SS    GRDSS N    SSG G S R     S G      G S   T  S  AN  G DV  G      
   217   96 B N  T 3  S+     0   0  105  824   81   gg    GggGG g    Gsg g g g     G s      S S   S  G  kI  S GG  S      
   218   97 B H  E <   -P  215   0C  39  647   66   rq     ..   w     hq s q q     P h        R   .  R  d.  . ..  .      
   219   98 B L  E     -P  214   0C   1  382   85   H      vv   Y        S         Y              .     wS  . AD  .      
   220   99 B V  E     -P  213   0C  12  489   66   R      VV   I        I         V              .     VA  . TV  .      
   221  100 B F  E     -P  212   0C  17  540   30   L      FF   F        Y         F              .     FL  . YY  .      
   222  101 B G        -     0   0    1  481   35   G      GG   H                  G              G     GE  . ST  .      
   223  102 B G        -     0   0   51  513   58   L      GG   S                  S                    AA  G HV  .      
   224  103 B G        -     0   0    8  528   33   G      GG   Q                  G                    GG  S GI  G      
   225  104 B T  E     - O   0 209C   0  550   33   L      TT   L                  T                    TE  Y  K         
   226  105 B K  E     -kO 130 208C  82  547   67   K      KK   K                  H                    HK  T  S         
   227  106 B L  E     -kO 131 207C   0  546   44   R      LL   L                  L                    LV  N  L         
   228  107 B T  E     -k  132   0C  34  614   65   E      TT   C                  S                    TC  T  K         
   229  108 B V  E     -k  133   0C   3  593   35   R      VV   I                  V                    VV  V  V         
   230  109 B L              0   0  120  399   31   L      LL   L                  L                    L   M            
   231  110 B G              0   0   62  207   39          SS   G                  G                    S                
## ALIGNMENTS  491 -  560
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1    1 A E              0   0  185  771   30  QQQQ E Q Q                QQEEEEEEEQQ E EEEE        Q   EEEEQ  EEE EEQ
     2    2 A V        +     0   0   18  834   19  VVVV V V V                VEVVVVVVVVV V VVVV        VVVVVVVVV  VVV VVV
     3    3 A Q  E     -A   25   0A  90  836   34  QQKQ Q Q Q                QQQQQQQQQKK Q KKKQ        QQQQQQHQQ  QQQ QQK
     4    4 A L  E     -A   24   0A  13  881    3  LLLL L L L                LLLLLLLLLLL L LLLL        LLLLLLLLL  LLLLLLL
     5    5 A Q  E     -A   23   0A 107  882   70  VQQV L V Q                VELLLLLLLQL V LLLV        VVVVVVVVM  LLLELVL
     6    6 A Q  E     -A   22   0A  14  887   31  QQQQ E Q Q                QQEEEEEEEEE E EEEQ        QEEEEEEEQ  EEEQEEE
     7    7 A S        -     0   0   33  892   13  SSSS S S S                SSSSSSSSSSS S SSSS        SSSSTSSSS  SSSSSSS
     8    8 A G        -     0   0   52  907   11  GGGG G G G                GGGGGGGGGGG G GGGG        GGGGGGGGG  GGGGGGG
     9    9 A A        -     0   0   80 1179   51  AGPA G A PGGGGGGGGGGG     AAGGGGGGGGG G GGGA GG GG  AGGGGGGGP  GGGGGGG
    10   10 A E  E     -d  116   0B  68 1189   46  EDEE G E EGDDDGGDDGGG     EEGGGGGGGGG D GGGE DD GD  EGGGGGGDE  GGGGGGG
    11   11 A L  E     +d  117   0B 130 1195   22  VLLV L V LLLLLLLLLLLL     VVLLLLLLLLL L LLLI LL LL  ILVLLLLLV  LLLVLLL
    12   12 A V  E     -d  118   0B  28 1197   47  KVKK V R KVVVVVVVVVVV     KTVVVVVVVVV V VVVK VV VV  KVVVVVVVK  VVVVVVV
    13   13 A K    >   -     0   0  145 1201   50  KKKK Q K KKKKKQQKKKKQ     KKQQQQQQQQK K QQQK KK QK  RQQQQKKKK  QQQQQKK
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPP P P PPPPPPPPPPPP     PPPPPPPPPPP P PPPP PP PP  PPPPPPPPP  PPPPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28  GGGG G G GGGGGGGGGGGG     GGGGGGGGGGG G GGGG GGGGG  GGGGGGGGG  GGGGGGG
    16   16 A A    <   -     0   0   36 1213   63  AGEA G A EGGGGGGGGGGG     AAGGGGGGGGG G GGGE GGGGG  AGRGRGGGS  GGGKGGG
    17   17 A S        -     0   0   66 1210   29  SSTS S S TSSSSSSSSSSS     SSSSSSSSSSS S SSSS SSSSS  SSSSSSSSS  SSSSSSS
    18   18 A V  E     - B   0  83A  10 1213   32  VLVV L V VLLLLLLLLLLL     VVLLLLLLLLL L LLLV LLLLL  VLLLLLLLM  LLLLLLL
    19   19 A K  E     - B   0  82A 119 1211   53  KKKK R K KKKKKKKKKKKK     KKRRRRRRRKK R KKKK KKKKK  KRRRKKKKK  RRRRRRK
    20   20 A L  E     - B   0  81A   0 1214   21  VVIV L V ILLLLLLLLLLL     VVLLLLLLLLL L LLLI LLLVL  VLLLLVLLV  LLLLLLL
    21   21 A S  E     - B   0  80A  31 1215   35  SSSS S S SSSSSSSSSSSS     SSSSSSSSSSS S SSSS SSSSS  HSSSSSSSS  SSSSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCC C C CCCCCCCCCCCC     CCCCCCCCCCC C CCCC CCCCC  CCCCCCCCC  CCCCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70  EAKK A K KAAAAAAAAAAA     KKAAAAAAAAA V AAAK AAAVA  KVAAVAVAK  AAAAAAA
    24   24 A A  E     +A    4   0A   2 1216   49  VAAV A A AAAAAAAAAAAA     AAAAAAAAAAA A AAAT AAAAA  TAAAAAVAA  AAAAAAA
    25   25 A S  E     +A    3   0A  49 1216   12  SSSS S S SSSSSSSSSSSS     SSSSSSSSSSS S SSSS SSSSS  SSSSSSSSS  SSSSSSS
    26   26 A G  S    S+     0   0   56 1215    3  GGGG G G GGGGGGGGGGGG     GGGGGGGGGGG G GGGG GGGGG  GGGGGGGGG  GGGGGGG
    27   27 A Y  S    S-     0   0   39 1216   33  HFYY F Y YFFFFFFFFFFF     YYFFFFFFFFF F FFFF FFFFF  YFFFFLFFG  FFFFFFF
    28   28 A T    >   -     0   0   90 1216   52  TTTT T T PTTTTTDTTTTD     TTTTTTTTTTT T DDDT TTTTT  VTTTTTSTT  TTTTTTT
    29   29 A F  G >  S+     0   0   13 1216   27  LFFL F F FFFFFFFFFFFF     FFFFFFFFFFF F FFFL FFFFF  FFFFFFFFL  FFFFFFF
    30   30 A T  G 3  S+     0   0   40 1216   55  TSTT S T TSSSSSSSSSSS     SISSSSSSSSS S SSST SSSSS  TSRSSSTSR  SSSRSSS
    31   31 A S  G <  S+     0   0   23 1216   57  ESDe S S NDSSSSRSSSDR     DASSSSSSSNR S RKGD SSSSS  SSSSSNSSS  SSSNTnT
    32   32 A Y  E <  S-E  100   0B  40 1139   28  LYY. Y Y YYYYYYYYYYYY     HYYYYYYYYYY Y YYYY YYYYY  YYYYYYYYY  FFYYY.Y
    33   33 A W  E     -E   99   0B  40 1148   92  SGGp A S GYGGGGWGGGYW     SDAAAAAAAGV Y WWWY GGGGG  YWGWWADGS  SSAGAwT
    34   34 A M  E     -EF  98  51B   0 1206   49  RMMV M M MMMMMMMMMMMM     IIMMMMMMMMM M MMMM MMMMM  IMMMMMMMI  MMMMMMM
    35   35 A H  E     -EF  97  50B   0 1212   72  HSNH S N NYSSSSSSSSYS     TNSSSSSSSSS D SSSS SSSSS  HSHSYSSSS  SSSHSSS
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWW W W WWWWWWWWWWWW     WWWWWWWWWWW W WWWW WWWWW  WWWWWWWWW  WWWWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17  VVVV V V VVVVVVVVVVVV     LVVVVVVVVVV V VVVV VVVVV  VVVVIVVVV  VVVVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22  RRKG R R KRRRRRRRRRRR     RRRRRRRRRRR R RRRR RRRRR  RRRRRRRRR  RRRRRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQ Q Q QQQQQQQQQQQQ     QQQQQQQQQQQ Q QQQQ QQQQQ  QQQQQQQQQ  QQQQQQQ
    40   40 A R    >   -     0   0   35 1216   71  ATAA A S ATTTTTATTTTA     AAAAAAAAATT A AAAA TTTTT  PAAAASTTA  AAAAAAT
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPP P P PPPPPPPPPPPP     PPPPPPPPPPP P PPPP PPPPP  RPPPPPPPP  PPPPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22  GDGG G G GEDDDDGDDDEG     GGGGGGGGGDE G GGGG DDDDD  GGGGGEEDG  GGGGGGE
    43   43 A R  S <  S-     0   0  156 1216   43  KKKK K K QKKKKKKKKKKK     QQKKKKKKKKK K KKKG RKKKK  QKKKKKRKQ  KKKKKKK
    44   44 A G        -     0   0   16 1215   36  GRGG G G GRRRRRGRRRRG     GGGGGGGGGRR G GGGR RRRRR  GGGGGRRRG  GGGGGGR
    45   45 A L  E     -F   39   0B   8 1215   10  LLLL L L LLLLLLLLLLLL     LLLLLLLLLLL L LLLL LLLLL  LLLLLLLLL  LLLLLLL
    46   46 A E  E     -F   38   0B  34 1216    6  EEKE E Q KEEEEEEEEEEE     EEEEEEEEEEE Q EEEV EEEEE  EEEEEEEEE  EEEEEEE
    47   47 A W  E     -F   37   0B   3 1216   10  WWWW W Y WWWWWLWWWWWW     WWWWWWWWWFW W WWWW WWWLW  WWWWWWWWW  WWWWWWW
    48   48 A I  E     -     0   0B   0 1215   31  MVMV V M MVVVVVIVVVVI     IMVVVVVVVVV L IIIL VVVVV  MVVVVVVVM  VVVVVVV
    49   49 A G  E     -FG  36  60B   0 1216   35  GAGG S G GAAAAAGAAAAG     GGSSSSSSSAA S GGGG AAAAA  GAAASAAAG  SSSASGA
    50   50 A R  E     -FG  35  59B  32 1216   94  GTWS A W WTTTTTETTTTE     WWAAAAAAANT E EEEY TTTTT  GNFNSAATg  SSAGART
    51   51 A I  E     -FG  34  58B   0 1207   17  FIIF I I IIIIIIIIIIII     IMIIIIIIIII I IIII IIIII  IIIIIIIIi  IIIIIII
    52   52 A D     >  -     0   0   26 1212   86  DTND S N NSSSSNNSSSSN     SNSSSSSSSNS S NHND SSSNS  GKWKNNTSP  SSSSSKS
    53   53 A P  T  4 S+     0   0    0 1212   83  PSTP G T TDSSSSPSSSDP     APGGGGGGGGS S PPPP GSSHG  PQYQTSSSF  GGGSGSS
    54   54 A N  T  4 S-     0   0   96 1213   69  EGYE S E SGGGGNDGGGGD     YQSSSSSSSNG S DDDE GGGKG  GDDDDNGGF  SSSDSKG
    55   55 A G  T  4 S-     0   0   69 1216   57  DGTS G T TGGGGGSGGGGS     STGGGGGGGGG G SSSD GGGGG  VGGGGGGGG  SSGGGtG
    56   56 A G     <  +     0   0   25  915   61  GSGG G G GSSSSGSSSSSS     GGGGGGGGGGS S SGSG SSSDS  GSSSGG.S.  GGGRGgS
    57   57 A G        -     0   0   43 1195   77  EYEE S K EYYYYSTYYYYT     QNSSSSSSSKY S TTTT YYYSY  SENGSNNYR  TTSKSTY
    58   58 A T  E     -G   51   0B  62 1209   46  TTPS T P STTTTTITTTTI     TTTTTTTTTTT T IIIT TTTTT  TKKKTTTTA  TTTKTTT
    59   59 A K  E     -G   50   0B  89 1212   88  VYTI Y T TYYYYYNYYYYN     YEYYYYYYYYY Y NNND YYYYY  MYYYYYYYS  YYYKYDY
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYY Y Y FYYYYYYYYYYY     YFYYYYYYYYF Y YYYY YYYYY  CYYYYYYYY  YYYYYYY
    61   61 A N    >>  -     0   0   12 1216   63  APAA A A APPPPPTPPPPT     AAAAAAAAAPP A TTTA PPPSP  AVAVPSPPA  AAAVAAS
    62   62 A E  G >4 S+     0   0  148 1216   64  QDDR D Q DDDDDDPDDDDP     QQDDDDDDDGD D PPPE DDDDD  EDDDDDDDQ  DDDDDAD
    63   63 A K  G 34 S+     0   0  109 1216   64  TSDE S G DSSSSSSSSSSS     NKSSSSSSSSS A SSFS SSSSS  KSSSSTNSK  SSSSSPS
    64   64 A F  G X> S+     0   0    5 1216   45  FVFF V F FVVVVVLVVVVL     LFVVVVVVVVV V LLLV VVVVV  FVVVVMVVF  VVVVVVV
    65   65 A K  T << S+     0   0  156 1216   40  QKKQ K S KKKKKKKKKKKK     QQKKKKKKKKK K KKKK KKKKK  QKKKKKKKQ  KKKKKKK
    66   66 A S  T 34 S+     0   0  108 1216   35  GGGG G E GGGGGGDGGGGD     GGGGGGGGGGG G DDDS GGGGG  GGGGGGGGG  GGGGGGG
    67   67 A K  T <4 S+     0   0   33 1214   21  RRRS R R RRRRRRKRRRRK     RRRRRRRRRRR R KKKR RRRRR  RRRRRRRRR  RRRRRRR
    68   68 A A  E  <  -C   83   0A   2 1216   69  VFFV F F FFFFFFFFFFFF     VLFFFFFFFFF F FFFV FFFFF  LFFFFFFFV  FFFFFFF
    69   69 A T  E     -C   82   0A  58 1216   37  TTAT T V DTTTTTITTTTI     TTTTTTTTTTT T IIIT TTTTT  TTTTTTTTT  TTTTTTT
    70   70 A L  E     +C   81   0A   7 1216   27  MIFM I F FIIIIIIIIIII     MFIIIIIIIII I IIII IIIII  MIVIIIVII  IIIIIII
    71   71 A T  E     -C   80   0A  57 1213   47  TSST S S SSSSSSSSSSSS     TSSSSSSSSSS S SSST SSSSS  TSSSSSSST  SSSSSSS
    72   72 A V  E     -C   79   0A  28 1216   71  ERLA R M LRRRRRRRRRRR     TRRRRRRRRRR R RRRT RRRRR  RRRRRRRRA  RRRRRRR
    73   73 A D  E   > -C   78   0A  69 1216    7  DDED D D EDDDDDDDDDDD     DDDDDDDDDDD D DDDD DDDDD  NDDDDDDDD  DDDDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62  TNTT N T TNNNNNNNNNNN     TTNNNNNNNNN N NNNN NNNNN  TNSNNNNNE  NNNKNDN
    75   75 A P  T 3 5S+     0   0  122 1215   37  SASS S S SAAAAAAAAAAA     SSSSSSSSSAA A AAAA AAAAA  SAAAAAAAA  SSSSSSA
    76   76 A S  T 3 5S-     0   0   37 1216   65  TKAT K V AKKKKKKKKKKK     TIKKKKKKKKK K KKKI KKKKK  TKKKEKKKT  KKKKKKK
    77   77 A S  T < 5 +     0   0   24 1216   48  DNSD N S NNNNNNNNNNNN     SNNNNNNNNNN N NNNS NNNNN  TNNNNSYNS  NNNNNNN
    78   78 A T  E   < -BC  23  73A   8 1216   64  TTTI T T TNTTTTTTTTNT     TTTTTTTTTTT T TSTT TTTTT  TSTSTTTTT  TTTTTTT
    79   79 A A  E     -BC  22  72A   0 1207   67  ALAA L A ALLLLLLLLLLL     AALLLLLLLLL L LLLM LLLLL  VLLLVLLLA  LLLLLLL
    80   80 A Y  E     -BC  21  71A  61 1209   36  YYYY Y Y YYYYYYYYYYYY     YYYYYYYYYYY Y YYFY YYYYY  YYYYYYYYF  YYYYYYY
    81   81 A M  E     -BC  20  70A   0 1212    9  MLLM L M LLLLLLLLLLLL     MMLLLLLLLLL L LLLV LLLLL  MLLLLLLLM  LLLLLLL
    82   82 A Q  E     -BC  19  69A  69 1215   43  DQQE Q Q QQQQQQQQQQQQ     EVQQQQQQQQQ Q QQQQ QQQQQ  EQQQQQQQE  QQQQQQQ
    83   83 A L  E     -BC  18  68A   0 1215   14  LMIL M I IMMMMMMMMMMM     LLMMMMMMMMM M MMML MMMMM  LMMMMMMML  MMMMMMM
    84   84 A S        +     0   0   32 1215   56  SSNS N N NSSSSSSSSSSS     RSNNNNNNNSS N SSSR SSSSS  SNGNNSSSS  NNNNNNS
    85   85 A S  S    S-     0   0   89 1216   25  NSNS S G NSSSSSKSSSSK     SSSSSSSSSSS S KKKS SSSSS  RSSSSSSSS  SSSSSSS
    86   86 A L        +     0   0    2 1216   15  LLLL L L LLLLLLVLLLLV     LLLLLLLLLLL L VVVL LLLLL  LLLLLLLLL  LLLLLLL
    87   87 A T    >   -     0   0   61 1215   68  RKKR R K KRKKKKRKKKKR     RSRRRRRRRKR R RRRT KKKKK  RRRRRRKKS  RRRRRKK
    88   88 A S  G >  S+     0   0   72 1216   59  SSNS A S SSSSSSSSSSSS     STAAAAAAASS A SSSP SSSSS  FAAASSSSS  AAAAATS
    89   89 A E  G 3  S+     0   0  107 1216   21  DEED E E EEEEEEEEEEEE     DEEEEEEEEEE E EEED EEEEE  EEEEEEEEE  EEEEEEE
    90   90 A D  G <  S+     0   0    7 1216    3  DDDD D D DDDDDDDDDDDD     DDDDDDDDDDD D DDDD DDDDD  DDDDDDDDD  DDDDDDD
    91   91 A S    <   +     0   0   31 1216   34  TTTT T T MTTTTTTTTTTT     TSTTTTTTTTT T TTTT TTTTT  TTTTTTTTT  TTTTTTT
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAA A A AAAAAAAAAAAA     AAAAAAAAAAA A AAAA AAAAA  AAAAAAAAA  AAAAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48  VMTV V V TMMMMMLMMMML     VIVVVVVVVMM V LLLV MMMMV  VVVVTFMMV  VVVVVVM
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYY Y Y YYYYYYYYYYYY     YYYYYYYYYYY Y YYYY YYYYY  YYYYYYYYY  YYYYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3  YYFY Y Y FYYYYYYYYYYY     YFYYYYYYYYY Y YYFY YYYYY  FYYYYYYYF  YYYYYYY
    96   96 A a  E     +E   36   0B   0 1216    1  CCCC C C CCCCCCCCCCCC     CCCCCCCCCCC C CCCC CCCCC  CCCCCCCCC  CCCCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAA A A AAAAAAAAAAAA     AAAAAAAAAVV A AAAA AAAVA  GAAAAVVAA  AAAAATT
    98   98 A R  E     -E   34   0B  13 1196   38  TRRV K R RRRRRRRRRRRR     KRKKKKKKKRR R RRRR RSRRR  RRRRKRRRR  KKKKKTR
    99   99 A M  E     -EI  33 107B   5 1101   82  GHKP P H WSHHLAPHGHSY     DGGSRFTRSVL G LLNG QPEDQ  GEDDGGPHA  PPGLANG
   100  100 A W  E >   -E   32   0B  89 1101   89  Vidd F R EWDDYEERESWY     QnLFfPaALAG P HHWt GYRPG  GTRPGGeGG  FFESvpG
   101  101 A Y  T 3  S+     0   0  112  572   91  .y.. . . VGGYDTGYYYGR     .r.......FF . YYD. FYYYF  .YGPE.yD.  ..RRsyN
   102  102 A Y  T 3  S-     0   0  133  629   92  .R.. . . YYHYGVLDGYYY     SG.......DD . YYV. TRRYT  RLYYY.YY.  ..WAYYY
   103  103 A G  S <  S+     0   0   38  705   79  Yy.. . . HYFYYYEWNYYY     yF...C...GG w GGG. TyYgT  wSSDY.yd.  ..LGYYG
   104  104 A T        -     0   0   32  784   66  dg.d P . G..A..N.....     .gSSp.ap..s c ...p vyDyv  s.psg.ggp  PPpG...
   105  105 A Y        +     0   0   81  679   93  y.r. . . ........W...     dn......LYy D ...p .YYp.  n.eyn.S.q  ..y.Y..
   106  106 A Y        -     0   0   32  842   66  s.Y. Y . Y...Y.YYY...     AWIF.F..LYY N YY.A .yyY.  Y.YpyYY.y  YYY.yy.
   107  107 A F  E     +I   99   0B   0  885   48  ffFf F . VF.MGFFFF.FF     FFFFFFFfFDF F ANF. vmmFv  NFFffFFFm  FFMFmm.
   108  108 A D  E     +     0   0B  25  997   46  DDDD D N PDDDGDDDD.DD     HDDDDDDDDDD D AAD. DDDDD  GDDDDDDAD  DDDDDDI
   109  109 A Y  E     -J  168   0C 108 1059   61  YYYI Y L YYYYYYYVV.YY     IPYYYYYYYFY Y YYY. YYYYY  HYYYYVSYV  YYVIVVY
   110  110 A W  E     -I   97   0B  23 1092    2  WWWW W W WWWWWWWWWWWW     WWWWWWWWWWW W WWWW WWWWW  WWWWWWWWW  WWWWWWW
   111  111 A G        -     0   0    3 1067   15  GGGG G   GGGGGGGGGGGG     GGGGGGGGGGG G GGG  GGGGG  GGGGGGGGG  GGGGGGG
   112  112 A Q        -     0   0  141 1047   41  QQQQ Q   QQQQQQQAAQQQ     QHQQQQQQQQR Q QQQ  QQQQQ  QQQQQAQQQ  QQQQQQQ
   113  113 A G        -     0   0   20 1013   12  GGGG G   GGGGGGGGGGGG     GGGGGGGGGGG G GGV  DGGGD  GGGGGGGGG  GGGGGGG
   114  114 A T  E     - H   0  94B   2  996   31  TTTT T   TTTTTTTTTTTT     TTTTTTTTTTT T TTT  TTTTT  TTTTVTTTT  TTTTTTT
   115  115 A T  E     - H   0  93B  60  979   76  QTTM L   TTTSTTTTTTTT     MLLLLLLLLTT L LLT  TSSFT  PLLLMATLT  LLLMTTT
   116  116 A L  E     -dH  10  92B   1  972   19  VLVV V   VLLVLLLVVLLL     VVVVVVVVVVL V VVL  LVVLL  VVVVVVIVV  VVVVVVL
   117  117 A T  E     -d   11   0B  57  953   21  TTTT T   TTTTTTTTTTTT     TTTTTTTTTTT T TTT  TTTTT  TTTTTTTTT  TTSTTTT
   118  118 A V  E     +d   12   0B   4  935    8  VVVV V   VVVVVVVVVVVV     VVVVVVVVVVV V VVV  VVVVV  VVVVVVVVV  VVVVVVV
   119  119 A S              0   0   64  917   10  SSSS S   SSSSSSSSSSSS     SSSSSSSSSSS S SSS  SSSSS  SSSSSSSSS  SSSSSSS
   120  120 A S              0   0  122  885   21  SSSS S   SSSSSSSSSSSS     SSSSSSSSSSS S AAS  SSSSS  SSSSSSSAS  SSSSSSS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32      Q E Q            QQQQQ           Q Q    Q     QQ                  
   123    2 B A        -     0   0   19  713   70      T T T            TTTPT           T M    P     TT                  
   124    3 B V        -     0   0   84  765   49      V V V            VVVVV           V V    V     VV                  
   125    4 B V  E     -Q  145   0D  10  820   26      V V V            VVVVV           V V    V     VV                  
   126    5 B T  E     +Q  144   0D  69  829   11      T T T            ITTTT           T T    T     TT                  
   127    6 B Q  E     -Q  143   0D  18  832    2      Q Q Q            QQQQQ           Q Q    Q     QQ                  
   128    7 B E        -     0   0   59  833   63      E E E            EEEEE           E E    E     EE                  
   129    8 B S  S    S+     0   0  101  841   38      P P P            PPPPP           P P    P     PP                  
   130    9 B A  E     -k  226   0C  59  842   50      S S S            SSSSS           S S    S     SS                  
   131   10 B L  E     -k  227   0C  57  847   76      M L M            LLLMF           L L    M     LL          M       
   132   11 B T  E     +k  228   0C  84  848   77      S S S            SSSSS           S S    S     SS          S       
   133   12 B T  E     -k  229   0C  18  848   68      V V V            VVVVV           V L    V     VV          V       
   134   13 B S    >   -     0   0   55  849   70      S Y S            SSSAS           S S    T     SS          S       
   135   14 B P  T 3  S+     0   0   61  848   65      P P A            SPLPP           P S    P     PP          P       
   136   15 B G  T 3  S+     0   0   46  850    7      G G G            GGGGG           G G    G     GG         GG       
   137   16 B E    <   -     0   0  108  850   56      G G G            GGGGG           G G    G     GG         GG       
   138   17 B T  E     - R   0 199D  88  850   66      T T T            TTTAT           T M    A     TT         TT       
   139   18 B V  E     - R   0 198D  14  850   33      V V V            VVVVV           V V    V     VV         VV       
   140   19 B T  E     - R   0 197D  53  849   41      T T T            TTTTT           T T    T     TT         TT       
   141   20 B L  E     - R   0 196D   0  849   25      L L L            LLLLL           L L    L     LL         LL       
   142   21 B T  E     - R   0 195D  22  849   52      T T T            TTTST           T T    S     TT         TT       
   143   22 B b  E     -QR 127 194D   0  850    2      C C C            CCCCC           C C    C     CC         CC       
   144   23 B R  E     -Q  126   0D 133  850   77      G G G            GGGSG           G G    S     GG         GG       
   145   24 B S  E >   -QS 125 148D  11  850   68      L L L            LLLLL           L L    L     LL         LL       
   146   25 B S  T 3  S+     0   0   81  850   27      S S S            TSSSS           S S    S     SS         SS       
   147   26 B T  T 3  S-     0   0   87  850   71      S S S            SSSTS           S S    T     SS         SS       
   148   27 B G  B <  S+S  145   0D  39  850   55      G G G            GGGGG           G G    G     GG         GG       
   149   28 B A        -     0   0   40  390   77      A S S            SSSAS           S S    A     SS         SA       
   150   29 B V        -     0   0    3  620   45      I V V            VVVIV           V V    I     VV         VV       
   151   30 B T    >   -     0   0   56  541   72      S S S            TSSTS           S S    T     SS         SS       
   152   31 B T  G >  S+     0   0   94  694   78      T T T            STTTT           T S    S     TT         TR       
   153   32 B S  G 3  S+     0   0   84  802   62      S S S            YGSSS           S G    S     SS         GS       
   154   33 B N  G <  S-     0   0   13  673   73      N N N            NNNNY           N Y    N     NN         NK       
   155   34 B Y    <   -     0   0   98  781   50      Y Y Y            YKYYY           Y D    Y     YY         YL       
   156   35 B A        -     0   0    0  817   59      P P P            PPPPP           P P    P     PP         PP       
   157   36 B N  E     -L  212   0C   0  827   79      G S G            SGNSS           G S    T     GG         GS       
   158   37 B W  E     -LM 211 171C   0  849    0      W W W            WWWWW           W W    W     WW         WW       
   159   38 B V  E     -LM 210 169C   0  849   25      Y Y Y            YYSYY           Y Y    V     HY         FY       
   160   39 B Q  E     -LM 209 168C  10  849   10      Q Q Q            QQQQQ           Q Q    Q     QQ         QQ       
   161   40 B E  E     -LM 208 167C  20  849    8      Q Q Q            QHQQQ           Q Q    Q     QQ         QQ       
   162   41 B K  E  >  - M   0 166C  68  849   50      T T T            STTKT           T T    K     TT         TT       
   163   42 B P  T  4 S+     0   0   98  843   23      P P P            PPPPP           L P    P     PQ         PP       
   164   43 B D  T  4 S-     0   0  148  846   16      G G G            GGGGG           G G    G     GG         GG       
   165   44 B H  T  4 S+     0   0   90  845   66      K Q K            KQQSQ           R Q    S     QR         KK       
   166   45 B L  E  <  - M   0 162C  92  846   57      P A P            PAAAA           A V    A     AA         PP       
   167   46 B F  E     + M   0 161C   9  847   19      P P P            PPPPP           P R    P     PP         PP       
   168   47 B T  E     -JM 109 160C  56  843   61      R R R            RRRKR           R C    R     RR         RR       
   169   48 B G  E     + M   0 159C   1  848   64      Q T M            MRTLT           T T    T     RT         KM       
   170   49 B L  E     +     0   0C   4  848   24      L L L            IIILL           I L    L     LI         LL       
   171   50 B I  E     +NM 177 158C   0  848   19      I I I            IIIII           I I    I     II         II       
   172   51 B G  E  >  +N  176   0C   0  849   33      Y Y Y            QYYHY           Y Y    Y     YY         YY       
   173   52 B G  T  4 S-     0   0    9  848   87      Y S H            YDNSS           R S    N     NN         SS       
   174   53 B T  T  4 S+     0   0    9  849   68      T T T            TTTTT           T T    T     TT         TT       
   175   54 B N  T  4 S+     0   0  102  841   49      N N N            NSNNN           S N    N     NS         NN       
   176   55 B N  E  <  -N  172   0C  77  849   69      N T N            TSSST           S S    S     NS         NN       
   177   56 B R  E     -N  171   0C 113  850   66      R R R            RRRRR           R R    R     RR         RR       
   178   57 B A    >   -     0   0    1  849   73      P P T            PPPPS           P L    P     PP         PP       
   179   58 B P  T 3  S+     0   0   97  849   39      S S S            SSSSS           S S    S     SS         SS       
   180   59 B G  T 3  S+     0   0   83  850   18      G G G            GGGGG           G G    G     GG         GG       
   181   60 B V  S <  S-     0   0   13  848   23      V V V            VVVIV           V V    I     IV         VV       
   182   61 B P    >   -     0   0   57  850    9      P P P            PPPPP           P P    P     PP         PP       
   183   62 B A  T 3  S+     0   0   77  850   59      A D D            DDNTD           N N    A     GN         DD       
   184   63 B R  T 3  S+     0   0   58  850    5      R R R            RRRRR           R H    R     RR         RR       
   185   64 B F  E <   +T  198   0D   4  850    1      F F F            FFFFF           F F    F     FF         FF       
   186   65 B S  E     -T  197   0D  51  849   17      S S S            ASTSS           S P    S     SS         SS       
   187   66 B G  E     +T  196   0D   9  850    4      G G G            GGGGG           G G    G     GG         GG       
   188   67 B S  E     -T  195   0D  41  850    7      S S S            SSSSS           S S    A     SS         SS       
   189   68 B L  E     -T  194   0D  59  835   79      I I I            IIIII           I I    I     II         II       
   190   69 B I  E >   -T  193   0D  86  842   31      S L S            SSSSL           S S    S     SS         SS       
   191   70 B G  T 3  S-     0   0   67  850   18      G G G            GEGGG           G G    S     GG         GG       
   192   71 B N  T 3  S+     0   0  105  828   57      N N N            NNNNN           N N    N     SN         NN       
   193   72 B K  E <  S- T   0 190D  68  833   67      K K K            KKKKK           K K    D     KK         KK       
   194   73 B A  E     -RT 143 189D   0  838   81      A A A            ATAAA           A A    A     AA         AA       
   195   74 B A  E     -RT 142 188D   0  849   57      A A A            AAAAA           A T    A     AA         AA       
   196   75 B L  E     -RT 141 187D   0  850    2      L L L            LLLLL           L L    L     LL         LL       
   197   76 B T  E     -RT 140 186D  19  850   33      T T T            TTTTT           T T    T     TT         TT       
   198   77 B I  E     -RT 139 185D   0  849    5      I I I            IIIII           I T    I     II         II       
   199   78 B T  E    S+R  138   0D  78  850   46      S T S            KTTTT           T T    T     TT         LT       
   200   79 B G  S    S-     0   0   15  850   57      G G G            GEGGG           G G    G     GG         GG       
   201   80 B A        -     0   0    0  849   51      A A A            AAAVA           A A    V     AA         AA       
   202   81 B Q    >   -     0   0   80  849   32      Q Q Q            QQQQQ           Q Q    Q     QQ         QQ       
   203   82 B T  G >  S+     0   0   84  850   59      P A P            PPPAA           P P    A     PP         PP       
   204   83 B E  G 3  S+     0   0   99  850   17      D D E            EEEED           E E    E     EE         EE       
   205   84 B D  G <   +     0   0    1  850    2      D D D            DDDDD           D D    D     DD         DD       
   206   85 B E    <   +     0   0   71  849   74      E E E            EEEEE           E E    E     EE         EE       
   207   86 B A  E    S- O   0 227C   3  850   14      A S A            AAAAS           A A    A     SA         AA       
   208   87 B I  E     -LO 161 226C  55  850   71      D D E            DDDDD           D D    D     DD         DD       
   209   88 B Y  E     -LO 160 225C   0  850    0      Y Y Y            YYYYY           Y Y    Y     YY         YY       
   210   89 B F  E     -L  159   0C   5  848    8      Y Y Y            HIYYY           Y Y    Y     YY         YH       
   211   90 B b  E     -L  158   0C   0  849    1      C C C            CICCC           C C    C     CC         CC       
   212   91 B A  E     -LP 157 221C   0  848   73      A T A            AYAAV           S A    V     SS         VA       
   213   92 B L  E     - P   0 220C   0  845   83      L L L            LELVL           L L    V     LL         LL       
   214   93 B W  E     + P   0 219C  21  834   71      Y Y Y            YWGWY           Y      Y     DY         YY       
   215   94 B Y  E >  S- P   0 218C  33  829   88      N M T            A LAM           M      T     MT         TM       
   216   95 B S  T 3  S-     0   0  106  829   66      V G G            D SSG           G      G     GG         GG       
   217   96 B N  T 3  S+     0   0  105  824   81      G S S            s ssS           S      s     SS         SS       
   218   97 B H  E <   -P  215   0C  39  647   66      . . .            d sh.           .      g     ..         ..       
   219   98 B L  E     -P  214   0C   1  382   85      . . .            i ...           .      S     ..         ..       
   220   99 B V  E     -P  213   0C  12  489   66      . . .            L S..           .      V     ..         ..       
   221  100 B F  E     -P  212   0C  17  540   30      . . .            F Y..           Y      F     .Y         ..       
   222  101 B G        -     0   0    1  481   35      . G .            G .SG           T            .T         ..       
   223  102 B G        -     0   0   51  513   58      .   S            G .D            D            .D         S.       
   224  103 B G        -     0   0    8  528   33      .   T            G .P            T            .T         T.       
   225  104 B T  E     - O   0 209C   0  550   33      A   D            T TA                         Y          DG       
   226  105 B K  E     -kO 130 208C  82  547   67      L   T            Q VR                         T          TI       
   227  106 B L  E     -kO 131 207C   0  546   44      Y   Y            V I                          Y          YY       
   228  107 B T  E     -k  132   0C  34  614   65      T   T            T S                          T          TT       
   229  108 B V  E     -k  133   0C   3  593   35      V   V            V I                          V          VV       
   230  109 B L              0   0  120  399   31      M   M            L S                          M          MM       
   231  110 B G              0   0   62  207   39                       G G                                              
## ALIGNMENTS  561 -  630
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....7....:....8....:....9....:....0....:....1....:....2....:....3
     1    1 A E              0   0  185  771   30     E              EDQQQQE  EEEQ Q Q D E              E   Q EQ QQ EQQ E
     2    2 A V        +     0   0   18  834   19     V           VVVVIVVVVV  VVVV V VVV V              VVVVVVVI VV VVV V
     3    3 A Q  E     -A   25   0A  90  836   34     K           QQQQQQQKHQ  QQIQ Q QQQ Q              QQQQQQQQ QH KQQ Q
     4    4 A L  E     -A   24   0A  13  881    3     L           LLLLLLLLLL  LLLL L LLL L              LLLLLLLL LL LLL L
     5    5 A Q  E     -A   23   0A 107  882   70     L           VVVVVVAQVV  VVVQ V MVV V              VVVVVVVV QV VVV V
     6    6 A Q  E     -A   22   0A  14  887   31     E           EEEEQQQQQE  EEEE Q QQE E              EEEEEEEQ EQ EQQ Q
     7    7 A S        -     0   0   33  892   13     S           SSSSSSSSSS  SSSS S SSS S              SSSSSSSS SS SSS S
     8    8 A G        -     0   0   52  907   11     G           GGGGGGGGGG  GGGG G GGG G              GGGGGGGG GGGGGG G
     9    9 A A        -     0   0   80 1179   51     GGGGGGG GG  GGGGAGPPAG  GGGG H AVG G GGGGGGGG GGG GGGGGGGP PSGGGG A
    10   10 A E  E     -d  116   0B  68 1189   46     PDGGDGG GG  GGGGEGEEEG  GGGG E EEG D DGDGDGGD GGG GGGGGGGE GEGGGG E
    11   11 A L  E     +d  117   0B 130 1195   22     LLLLLLL LL  VLLLVLVLLL  VLLL V VRL L LLLLLLLL LLL LVLVVLLL LVVLLL V
    12   12 A V  E     -d  118   0B  28 1197   47     VVVVVVV VV  VVVVKVKKKV  VVVV K KKV V VVVVVVVV VVV VVVVVVVK VKVVVV K
    13   13 A K    >   -     0   0  145 1201   50     QKQQKQQ KQ  QKQKRQKKMK  QQKQ Q KVQ K KQKQKKQK QQQ KQQQQKKK KKQQQR R
    14   14 A P  T 3  S+     0   0   70 1203    8     LPPPPPP PP  PPPPPPPPPP  PPPP P PPP P PPPPPPPP PPP PPPPPPPP PPPPHP P
    15   15 A G  T 3  S+     0   0   59 1209   28     GGGGGGGGGG  GGGGGGGGGG  GGGG G GGG G GGGGGGGGGGGG GGGGGGGG SGGGGG G
    16   16 A A    <   -     0   0   36 1213   63     GGGGGGGGGG  RGGGEGSESG  RGGG A SAG G GGGGGGGGGGGGGGRGGRGGE EARGGG E
    17   17 A S        -     0   0   66 1210   29     SSSSSSSSSS  SSSSSSSTSS  SSSS S SSS S SSSSSSSSSSSSSSSSSSSST TSSSSS S
    18   18 A V  E     - B   0  83A  10 1213   32     LLLLLLLLLL  LVLLLLVVVL  LLLL V VVR L LLLLLLLLLLLRLLLLLLLRV LVLLLL L
    19   19 A K  E     - B   0  82A 119 1211   53     KKKKKKKKKK  RRRKRRRRKK  RKKR K RRK R KKKKKKKKRRKKKRRRRRRKK SKRKRS K
    20   20 A L  E     - B   0  81A   0 1214   21     LLLLLLLLLL  LLLLILVIVL  LLLL V VIL L LLLLLLLLLLLLLLLLLLLLI LVLLLL I
    21   21 A S  E     - B   0  80A  31 1215   35     SSSSSSSSSS  SSSSSSSSSS  SSSS S SSS S SSSSSSSSSSSSSSSSSSSSS TSSSSS S
    22   22 A a  E     -AB   6  79A   0 1216    0     CCCCCCCCCC  CCCCCCCCCC  CCCC C CCC C CCCCCCCCCCCCCCCCCCCCC CCCCCC C
    23   23 A K  E     -AB   5  78A 113 1216   70     AAAAAAAAAA  AAAAKAKKKA  AAAA K KKA V AAAAAAAAAAAAAVAAAAAAK TQAAAA K
    24   24 A A  E     +A    4   0A   2 1216   49     AAAAAAAAAA  AAAAGAVAAA  ATAA A TAA A AAAAAAAATTAAAGAAAAAAA VAAAAV T
    25   25 A S  E     +A    3   0A  49 1216   12     SSSSSSSSSS  SSSSSSSSSS  SSSS S SSS S SSSSSSSPSSSSSSSSSSSSS SSSSSS S
    26   26 A G  S    S+     0   0   56 1215    3     GGGGGGGGGG  GGGGGGGGAG  GGGG G GGG G GGGGGGGGGGGGGGGGGGGGG GGGGGG G
    27   27 A Y  S    S-     0   0   39 1216   33     FFFFFFFFFF  FFFFYFDYNF  FFFF Y GYF F FFFFFFFFFFFFFFFFFFFFY GYFFFI Y
    28   28 A T    >   -     0   0   90 1216   52     DTTTTDTAAT  TTTSTTTTMT  TTTM S TAT T TTTDTTTTTTTTTTTTTTTTT SPTTTT S
    29   29 A F  G >  S+     0   0   13 1216   27     FFLFFFLFFL  FFFFFFFFFF  FFFF F FFF F FFFFFFFFFFFFFFFFFFFFF IFFFFL F
    30   30 A T  G 3  S+     0   0   40 1216   55     SSSSSSSSSS  STSNTSSTRS  SSSS T VES S SSSSSSSSTTSSSSSSSSSST CTSSSR T
    31   31 A S  G <  S+     0   0   23 1216   57     RSHSSRHSSH  SNSNDSNtSS  NDSR S DNS s SSSRSDSSDDSSDNSSSSNDD SRHSST S
    32   32 A Y  E <  S-E  100   0B  40 1139   28     YYCYYYCYYC  YAYYYYY.YY  YYYY Y YYF y YYYYYFYYYYYFYYYYYYAYY YYYYYY Y
    33   33 A W  E     -E   99   0B  40 1148   92     WGGGGWGDDG  GWWDWGAgAA  GYTA G KYG . GGGWGYGGYYGGYYGEWGWGS YIATEG W
    34   34 A M  E     -EF  98  51B   0 1206   49     MMMMMMMMMM  MMMMIMLMFM  MMMM M GIM M MMMMMMMMMMMMMMMMMMMMM WMMMMM I
    35   35 A H  E     -EF  97  50B   0 1212   72     SSSSSSSSSS  HNSSGHSQTS  HYSS N LHH S SSSSSYSSSSSHYNHSSHSHH SNHSNH S
    36   36 A W  E     -EF  96  49B   0 1216    0     WWWWWWWWWW  WWWWWWWWWW  WWWW W WWW W WWWWWWWWWWWWWWWWWWWWW WWWWWW W
    37   37 A V  E     -EF  95  47B   0 1216   17     VVVVVVVVVV  VVVVVVVVVV  VVVV V VVV I VVVVVVVVVVVVVVVVVVVVV IVVIVV V
    38   38 A K  E     -EF  94  46B   7 1216   22     RRRRRRRRRR  RRRRRRRQRR  RRRR R RRR R RRRRRRRRRRRRRRRRRRRRK RRRRRR R
    39   39 A Q  E     +EF  93  45B  20 1216    5     QQQQQQQQQQ  QQQQQQQKQQ  QQQQ Q QQQ Q QQQQQQQQQQQQQQQQQQQQQ QQQQQQ Q
    40   40 A R    >   -     0   0   35 1216   71     ATTTTATTTT  AAATMAAMAT  ATTA A AAA A TTTATTTTPPTATAAAAAAAA PAATAA M
    41   41 A P  T 3  S+     0   0  130 1215   15     PPPPPPPPPP  PPPPPPRPPP  PPPP P PPP P PPPPPPPPPPPPPPPPPPPPP PPPPPP P
    42   42 A G  T 3  S+     0   0   83 1216   22     GDDDDGDEED  GGGEGGGGGE  GDEG G GGE G DDDGDEDDGGDEEGGGGGGEG GGGEGG G
    43   43 A R  S <  S-     0   0  156 1216   43     KKKKKKKKKK  KKKKKKHKQK  KKKK Q KLK K KKKKKKKKKKKKKKKKKKKKK KQKKKK K
    44   44 A G        -     0   0   16 1215   36     GRRRRGRRRR  GGGRGGGGGR  GRRG G GGG G RRRGRRRRAARGRGGGGGGGG GGGRGG G
    45   45 A L  E     -F   39   0B   8 1215   10     LLLLLLLLLL  LLLLLLLLLL  LLLP L LLL L LLLLLLLLLLLLLLPLLLLLL LLLLLL L
    46   46 A E  E     -F   38   0B  34 1216    6     EEEEEEEEEE  EEEEEEEKQE  EEEE E EEE Q EEEEEEEEEEEEEEEEEEEEK EEEEEE E
    47   47 A W  E     -F   37   0B   3 1216   10     WWLLWWLWWL  WWWWLWWWWW  WWWW W WWW W WLWWWWLWWWLWWWWWWWWWW WWWWWW W
    48   48 A I  E     -     0   0B   0 1215   31     IVVVVIVVVV  VVVVMVMIMV  VVVV M VMV V VVVIVVVVLLVVVVVVVVVVM IMVVVV M
    49   49 A G  E     -FG  36  60B   0 1216   35     GAAAAGAAAA  AGAAGAGGGA  AAAS G GGA S AAAGAAAAGGAAASAAAAGAG GGAASA G
    50   50 A R  E     -FG  35  59B  32 1216   94     ETTTTETYYT  VRNYMVGWGT  IYTG W QIY Q TTTETTTTFFTYTYVNNVRYw YWVYGG T
    51   51 A I  E     -FG  34  58B   0 1207   17     IIIIIIIIII  IIIIIIIIII  IIII F IFI I IIIIIIIIIIIIIIIIIIIIi IIIIII I
    52   52 A D     >  -     0   0   26 1212   86     DSNNSNYSSY  SKKSDSINIS  WSSS N PNS S NNSNSSDSRRNSSNSKKWKNE YDASSS D
    53   53 A P  T  4 S+     0   0    0 1212   83     PSHSGPHSSH  YTQTPYPTPD  YISG T LPS S NSSPSDSSNNSSDSYQQYSST YTSDGF P
    54   54 A N  T  4 S-     0   0   96 1213   69     NGGNGDGGGG  DKDGSDVHNG  DGGS Y RVG D GNGDGGYGKKNGGDDDDDKGG SKDGSD S
    55   55 A G  T  4 S-     0   0   69 1216   57     SGGGGSGGGG  GsGDNGFSFG  GGGG T FAS G GGGSGGGGaaGSGGGGGGtSE GTGGGG D
    56   56 A G     <  +     0   0   25  915   61     SSGGSSGGGG  SgSGSSGGGS  NGGG G N.S S SGSSSSFSyyGSSSSSSSgT. .GNGGR S
    57   57 A G        -     0   0   43 1195   77     TYDSYTGSSG  NTENGNTVAY  DSNS N GGT S YSYTYYTYTTSTYSNEENTT. SNNSSS D
    58   58 A T  E     -G   51   0B  62 1209   46     ITTTTITTTT  KAKTTKTPPT  ETTT P EAL T TTTITTTTTTTITTKKKKTIS TPDTTE T
    59   59 A K  E     -G   50   0B  89 1212   88     NYYYYNYYYY  YDYYKYNKNY  YYYY T VVH S YYYNYSYYEEYYYYYYYYDYV NTYYYY R
    60   60 A Y  E     -G   49   0B  46 1215    9     YYYYYYYYYY  YYYYYYYYYY  YYYY Y KSY Y YYYYYYYYYYYYYYYYYYYYY YYYYYY Y
    61   61 A N    >>  -     0   0   12 1216   63     TPPPPTPPPP  AAVPNAAAAP  APPA A NSA A PPPTPPPPSSPAPAAVVAAAA TAIPAA S
    62   62 A E  G >4 S+     0   0  148 1216   64     PDDDDPDDDD  DADDRDQEQD  DDDD Q PED D DDDPDDDDAADDDDDDDDADD PQDDDD P
    63   63 A K  G 34 S+     0   0  109 1216   64     SSSSSSSTTS  SPSTSSKENN  STSS G GKT A SSSSSSSSSSSTSSSSSSPTD SASTSS S
    64   64 A F  G X> S+     0   0    5 1216   45     LVVVVLVVVV  VVVVFVLFFV  VVVV F SFV V VVVLVVMVVVVVVVVVVVVVF LFLLVV F
    65   65 A K  T << S+     0   0  156 1216   40     KKKKKKKKKK  KKKKEKQKQK  KKKK T VRK K KKKKKKKKKKKKKKKKKKKKK KTKKKQ Q
    66   66 A S  T 34 S+     0   0  108 1216   35     DGGGGDGGGG  GGGGGGGGDG  GGGG G VDG G GGGDGGGGGGGGGGGGGGGGG SGGGGG G
    67   67 A K  T <4 S+     0   0   33 1214   21     KRRRRKRRRR  RRRRHRRRRR  RRRR R RRR R RRRKRRRRRRRRRRRRRRRRR RRRRRR Q
    68   68 A A  E  <  -C   83   0A   2 1216   69     FFFFFFFFFF  FFFFIFVFVF  FFFF F VLF F FFFFFFFFFFFFFFFFFFFFF VFFFFF V
    69   69 A T  E     -C   82   0A  58 1216   37     ITTTTITTTT  TTTTTTTATT  TTTT V SVT T TTTITTTTTTTTTTTTTTTTA TVTTTT T
    70   70 A L  E     +C   81   0A   7 1216   27     IIIIIIIIII  IIIIIIIFII  IIIV F VMI I IIIIIIIIIIIIIIIIIIIIF IFIVII I
    71   71 A T  E     -C   80   0A  57 1213   47     SSSSSSSSSS  SSSSSSTSSS  SSSS S SSS S SSSSSSSSSSSSSSSSSSSSS SSSSSS S
    72   72 A V  E     -C   79   0A  28 1216   71     RRRRRRRRRR  RRRRARALAR  RRRR M LSR R RRRRRRRRRRRRRRRRRRRRL VLRRRR A
    73   73 A D  E   > -C   78   0A  69 1216    7     NDDDDDDDVD  DDDDDDDEDD  DDDD D KDD D DDDDDDDDDDDDDDDDDDDDE DDDDDD D
    74   74 A K  T > 5S+     0   0  105 1216   62     DNNNNNNNNN  NDNNMNSTDN  NNNN T PTN N NNNNNNNNNNNNNNNNNNDNT RTNNNS K
    75   75 A P  T 3 5S+     0   0  122 1215   37     AAAAAAAAAA  SSAASSSSSA  SAAS S SSP A AAAAAAAASSAPASSAASSAS SSSASS S
    76   76 A S  T 3 5S-     0   0   37 1216   65     KKNKKKNKKN  KKKKIKRATK  KKKK V FAK K KKKKKKRKQQKKKKKKKKKKA KVNKKK I
    77   77 A S  T < 5 +     0   0   24 1216   48     NNNNNNNNNN  NNNNSNTSTN  NNNN S NNN N NNNNNNNNSSNNNSNNNNNNS NSNNNN N
    78   78 A T  E   < -BC  23  73A   8 1216   64     TTTTTTTTTT  TTSTTTTTTN  TTNT T QTT T TTTTTNTTIITTNETSSTTTT QTTTTT T
    79   79 A A  E     -BC  22  72A   0 1207   67     LLLLLLLLLL  LLLLALVAVL  LLLL A AVL L LLLLLLLLLLLLLLLLLLLLI FALLLL A
    80   80 A Y  E     -BC  21  71A  61 1209   36     YYYYYYYYYY  YYYYYYYYYY  YYYY Y HSF Y YYYYYYYYYYYFYYYYYYYFH SYYYYY Y
    81   81 A M  E     -BC  20  70A   0 1212    9     LLLLLLLLLL  LLLLLLMLML  LLLL L MML L LLLLLLLLLLLLLLLLLLLLL LLLLLL L
    82   82 A Q  E     -BC  19  69A  69 1215   43     QQQQQQQQQQ  QQQQQQEQEQ  QQQQ Q EQQ Q QQQQQLQQQQQQQQQQQQQQQ KQQQQQ Q
    83   83 A L  E     -BC  18  68A   0 1215   14     MMMMMMMMMM  MMMMWMVILM  MMMM I LLM M MMMMMMMMMMMMMMMMMMMMI LILMMM W
    84   84 A S        +     0   0   32 1215   56     SSSSSSSSSS  NNNNTNNSTS  NSSN S SRT N SSSSSSSSNNSTSNNNNNNTN TNSSNN S
    85   85 A S  S    S-     0   0   89 1216   25     KSSSSKSSSS  SSSSSSSNSH  SRSS S SNS S SSSKSSSSTTSSSNSSSSSSN SRSSRS S
    86   86 A L        +     0   0    2 1216   15     VLLLLVLLLL  LLLLLLLLLL  LLLL L LLL L LLLVLLLLLLLLLLLLLLLLL LLLLLL L
    87   87 A T    >   -     0   0   61 1215   68     RKRKKRRKKR  RKRKKRTKTK  RKRR K FRR R KKKRKKKKRRKRKRRRRRKRK TKRKRR K
    88   88 A S  G >  S+     0   0   72 1216   59     SSSSSSSSSS  ATASAASNFS  ASSA A SSS D SSSSSSSSAASSSAAAAATSN AAISAA A
    89   89 A E  G 3  S+     0   0  107 1216   21     EEEEEEEEEE  EEEESEEEEE  EEEE E EDE E EEEEEEEEEEEEEEEEEEEEE AEEEEE S
    90   90 A D  G <  S+     0   0    7 1216    3     DDDDDDDDDD  DDDDDDDDDD  DDDD D DDD D DDDDDDDDDDDDDDDDDDDDD DDDDDD D
    91   91 A S    <   +     0   0   31 1216   34     TTTTTTTTTT  TTTTSTTTTT  TTTT T TTT T TTTTTTTTSSTTTSTTTTTTT TTTTTT S
    92   92 A A  E    S- H   0 116B  10 1214    5     AAAAAAAAAA  AAAAAAAAAA  AAAA A AGA A AAAAAAAAAAAAAAAAAAAAA AAAAAA A
    93   93 A V  E     -EH  39 115B  21 1216   48     LMTMMLTMMT  VVVMIVITFM  VMLV M VRM V MMMLMMMMTTMMMVVVVVVMT VVVMVV T
    94   94 A Y  E     -EH  38 114B   0 1216    1     YYYYYYYYYY  YYYYYYYYYY  YYYY Y YYY Y YYYYYYYYYYYYYYYYYYYYY YYYYYY Y
    95   95 A Y  E     -E   37   0B   1 1216    3     YYYYYYYYYY  YFYYYYYFYY  YYYY Y YFY Y YYYYYYYYYYYYYYYYYYYYF FFYYYY Y
    96   96 A a  E     +E   36   0B   0 1216    1     CCCCCCCCCC  CCCCCCCCCC  CCCC C CCC C CCCCCCCCCCCCCCCCCCCCC CCCCCC C
    97   97 A A  E     -EI  35 110B   0 1215   24     AAAAAATAAA  AAAAAAAMGA  AAAA A AAA A AAAAAAAAAAAAAAAAAATAA ATAAAA A
    98   98 A R  E     -E   34   0B  13 1196   38     RRRLRRRRRR  RTRRRRRRRR  RARK R RRR R RRRRRRRRRRRRRSKTRRTRR RTRIRR K
    99   99 A M  E     -EI  33 107B   5 1101   82     SHELQLEHQE  SDDQLDEWGD  DRYD Y EVW D QVHPHDDHYYDIVDDDDARES LLGNDG D
   100  100 A W  E >   -E   32   0B  89 1101   89     PYARGYAyVA  YSPArWVDLm  PeYl T YSg t RGeEgRgYnNYWWwVQPGVLD SSLFNA d
   101  101 A Y  T 3  S+     0   0  112  572   91     YGC.FYC.RC  SRPYn...Ts  Vl.y . GYy . F......G.A....QTPSG.Y N..... k
   102  102 A Y  T 3  S-     0   0  133  629   92     YSY.TRY.RY  SEYGS...YP  TFRY . FDP . YD.....S.P....GGYDA.D WG.... Y
   103  103 A G  S <  S+     0   0   38  705   79     ASsYTSs.Ys  GEDSY.YyYY  gYYg . dFY . DY.....S.Y....YGDyIwY GY.... y
   104  104 A T        -     0   0   32  784   66     ..y.v.yy.y  .YsShGgggg  wdEg . sS. . .D.ggGp....D.gG.swp.D Pss.gH d
   105  105 A Y        +     0   0   81  679   93     ..yW..yYYy  WGyYsDn.yy  yvAq . yQ. n ...rYYY.y...Y.D.yyyrI Ydt.w. v
   106  106 A Y        -     0   0   32  842   66     .yYY.yYyyF  yHpWYSW.Ys  yYWP . Yyy C yW.YWgfyYYy.yfy.pYvRy YwhyYy g
   107  107 A F  E     +I   99   0B   0  885   48     MmFFvmFmmF  wFfFFLFfLf  mFFF . Ymm F vFmFFflmFFfVmffFfFvIm FefmFf l
   108  108 A D  E     +     0   0B  25  997   46     NDDDDDDDDD  DDDPQDDAQD  DDAE . YDD D AADDADDDDDAGDYDDDDDDD DDDDDD E
   109  109 A Y  E     -J  168   0C 108 1059   61     YYYVYYYYYY  YYYYFPPYHY  VYSY M YVY Y YYYVYYYYYYYYYYYYYYYYY YYISLI S
   110  110 A W  E     -I   97   0B  23 1092    2     WWWWWWWWWW  WWWWWWWWWW  WWWW W WWW W WWWWWWWWWWWWWWWWWWWWW WWWWWW W
   111  111 A G        -     0   0    3 1067   15     GGGGGGGGGG  GGGGGGGGGG  GGGG   GGG G GGGGGGGGGGGGGGGGGGGGG GGGGGG G
   112  112 A Q        -     0   0  141 1047   41     QQQAQQQQQQ  QQQQQKQQQQ  QQQQ   QQQ Q QQQAQQQQQQQQQQQQQQQQQ QQQQRQ Q
   113  113 A G        -     0   0   20 1013   12     GGGGDGGGGG  GGGGGGGGGG  GGGG   GGG G GGGGGGGGGGGGGGGGGGGGG GGGGGG G
   114  114 A T  E     - H   0  94B   2  996   31     TTTTTTTTTT  TITTTTTTTT  TTTT   TTT T TTTTTTTTTTTTTTTTTTTTT TTTTTT V
   115  115 A T  E     - H   0  93B  60  979   76     SSTTTSTSST  LLLLLLLTLT  TTLL   LTS L LLSTLTSSTTLTSLLLLLLTS LLMSMM V
   116  116 A L  E     -dH  10  92B   1  972   19     VVLVLVLVVL  VVVVVVVVVI  VVVV   VVV V VVVVVLVVLLVLVVVVVVVIV VVVVVV V
   117  117 A T  E     -d   11   0B  57  953   21     TTTTTTTTTT  TTTTITTTTT  TTTT   TIT T TTTTTTTTTTTTTTTTTTTTT TTTTTT T
   118  118 A V  E     +d   12   0B   4  935    8     VVVVVVVVVV  VVVVVVVVVV  VVVV   VVV V VVVVVVVVVVVVVVVVVVVVV VVVVVV V
   119  119 A S              0   0   64  917   10     SSSSSSSSSS  SSSSSSSSSS  SSSS   SSS S SSSSSSSSSSSSSSSSSSSSS SSSSSS S
   120  120 A S              0   0  122  885   21     SSSSSSSSSS  SSS  SSSSS   SAS   SSS S AASSASSSSSASSSSSSSSSS SSSSSS S
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32  QQQ          QQ          QQ      E     Q                            Q 
   123    2 B A        -     0   0   19  713   70  TST          TP          TT      T     P                            T 
   124    3 B V        -     0   0   84  765   49  VVV          VV          VV    V V     V                            V 
   125    4 B V  E     -Q  145   0D  10  820   26  VVV          VV          VV    T V   V V                     L      V 
   126    5 B T  E     +Q  144   0D  69  829   11  TTT          TT          TT    Q T   I T                     T      T 
   127    6 B Q  E     -Q  143   0D  18  832    2  QQQ          QQ          QQ    E Q   Q Q                     Q      Q 
   128    7 B E        -     0   0   59  833   63  EEE          EE          EE    E E   E E                     D      E 
   129    8 B S  S    S+     0   0  101  841   38  PPP          PP          PP    P P   P P                     P      P 
   130    9 B A  E     -k  226   0C  59  842   50  SSS          SS          RS    S S   S S                     V      S 
   131   10 B L  E     -k  227   0C  57  847   76  LLF          VM          MV    L L   L M                     V      L 
   132   11 B T  E     +k  228   0C  84  848   77  SSS          SS          SS    T S   S S                     S      S 
   133   12 B T  E     -k  229   0C  18  848   68  VVV          VV          VV    V V   V V                     V      V 
   134   13 B S    >   -     0   0   55  849   70  SSS          SA          SS    S S   S T                     A      S 
   135   14 B P  T 3  S+     0   0   61  848   65  PSP          PP          AA    P S   P P                     L      P 
   136   15 B G  T 3  S+     0   0   46  850    7  GGG          GG          GG    G G   G G                     G      G 
   137   16 B E    <   -     0   0  108  850   56  GGG          GG          GG    R G   G G                     Q      G 
   138   17 B T  E     - R   0 199D  88  850   66  TTT          TA          TT    T T   T A                     T      T 
   139   18 B V  E     - R   0 198D  14  850   33  VVV          VV          VV    V V   V V                     V      V 
   140   19 B T  E     - R   0 197D  53  849   41  TTT          TT          TT    I T   T T                     R      T 
   141   20 B L  E     - R   0 196D   0  849   25  LLL          LL          LL    L L   L L                     I      L 
   142   21 B T  E     - R   0 195D  22  849   52  TTT          TS          TT    T T   T S                     T      T 
   143   22 B b  E     -QR 127 194D   0  850    2  CCC          CC          CC    C C   C C                     C      C 
   144   23 B R  E     -Q  126   0D 133  850   77  GGG          GS          GG    C G   G S                     Q      G 
   145   24 B S  E >   -QS 125 148D  11  850   68  LLL          TL          LL    S L   L L                     G      L 
   146   25 B S  T 3  S+     0   0   81  850   27  SNS          SS          SS    S S   S S                     D      S 
   147   26 B T  T 3  S-     0   0   87  850   71  SSS          ST          SS    T S   S T                     S      S 
   148   27 B G  B <  S+S  145   0D  39  850   55  GGG          GG          GG    G G   G G                     L      G 
   149   28 B A        -     0   0   40  390   77  SSS          AA          AA    E L   S A                     .      S 
   150   29 B V        -     0   0    3  620   45  VVV          VV          VV    V V   V I                     .      V 
   151   30 B T    >   -     0   0   56  541   72  SSS          ST          SS    T S   S T                     .      S 
   152   31 B T  G >  S+     0   0   94  694   78  TST          ST          SS    N T   T S                     R      T 
   153   32 B S  G 3  S+     0   0   84  802   62  SSS          GS          SS    G S   G G                     S      G 
   154   33 B N  G <  S-     0   0   13  673   73  NNY          NN          NN    H N   H N                     Y      N 
   155   34 B Y    <   -     0   0   98  781   50  HHY          HY          YY    Y Y   Y Y                     Y      K 
   156   35 B A        -     0   0    0  817   59  PPP          PP          PP    P P   P P                     A      P 
   157   36 B N  E     -L  212   0C   0  827   79  SSS          SG          GS    C S   G G                     S      G 
   158   37 B W  E     -LM 211 171C   0  849    0  WWW          WW          WW    W W   W W                     W      W 
   159   38 B V  E     -LM 210 169C   0  849   25  YHY          YF          YY    W Y   Y F                     Y      Y 
   160   39 B Q  E     -LM 209 168C  10  849   10  QQQ          QQ          QQ    Q Q   Q Q                     Q      Q 
   161   40 B E  E     -LM 208 167C  20  849    8  QQQ          QQ          QQ    K Q   Q Q                     Q      H 
   162   41 B K  E  >  - M   0 166C  68  849   50  TTT          TK          TT    K T   N K                     K      T 
   163   42 B P  T  4 S+     0   0   98  843   23  QPP          PP          PP    S P   P P                     P      P 
   164   43 B D  T  4 S-     0   0  148  846   16  GGG          GG          GG    V G   G G                     G      G 
   165   44 B H  T  4 S+     0   0   90  845   66  KQQ          RS          KK    Q Q   L S                     Q      Q 
   166   45 B L  E  <  - M   0 162C  92  846   57  AAA          AS          PP    A A   S A                     A      A 
   167   46 B F  E     + M   0 161C   9  847   19  PPL          TP          PP    F P   P P                     P      P 
   168   47 B T  E     -JM 109 160C  56  843   61  RRR          RW          RR    S R   R R                     V      R 
   169   48 B G  E     + M   0 159C   1  848   64  MTM          RQ          MM    T T   Q L                     L      R 
   170   49 B L  E     +     0   0C   4  848   24  LLL          LL          LL    L L   L L                     V      I 
   171   50 B I  E     +NM 177 158C   0  848   19  III          II          II    I I   I I                     I      I 
   172   51 B G  E  >  +N  176   0C   0  849   33  YYY          YY          YY    Y Y   Y Y                     Y      Y 
   173   52 B G  T  4 S-     0   0    9  848   87  NYS          ES          YY    N S   Y S                     G      D 
   174   53 B T  T  4 S+     0   0    9  849   68  TTT          TT          TT    T T   T T                     K      T 
   175   54 B N  T  4 S+     0   0  102  841   49  NNN          NN          NT    N N   N N                     N      S 
   176   55 B N  E  <  -N  172   0C  77  849   69  NTT          KS          SQ    S T   N N                     N      S 
   177   56 B R  E     -N  171   0C 113  850   66  RRR          RR          RR    R R   R R                     R      R 
   178   57 B A    >   -     0   0    1  849   73  PAT          PP          PP    H P   P P                     P      P 
   179   58 B P  T 3  S+     0   0   97  849   39  SSS          SS          SS    S S   S S                     S      S 
   180   59 B G  T 3  S+     0   0   83  850   18  GGG          GG          GG    W G   G G                     G      G 
   181   60 B V  S <  S-     0   0   13  848   23  IVV          VI          IV    T V   V I                     I      V 
   182   61 B P    >   -     0   0   57  850    9  PPP          PP          PP    P P   P P                     P      P 
   183   62 B A  T 3  S+     0   0   77  850   59  NND          DA          AA    S D   D A                     D      D 
   184   63 B R  T 3  S+     0   0   58  850    5  CLC          RR          RR    Q R   R R                     R      R 
   185   64 B F  E <   +T  198   0D   4  850    1  FFF          FF          FF    F F   F F                     F      F 
   186   65 B S  E     -T  197   0D  51  849   17  SSS          SS          SS    S S   S S                     S      S 
   187   66 B G  E     +T  196   0D   9  850    4  GGG          GG          GG    G G   G G                     G      G 
   188   67 B S  E     -T  195   0D  41  850    7  SSS          SS          SS    S S   S A                     S      S 
   189   68 B L  E     -T  194   0D  59  835   79  III          II          II    L I   I I                     S      I 
   190   69 B I  E >   -T  193   0D  86  842   31  SSL          SS          SS    F L   L S                     S      S 
   191   70 B G  T 3  S-     0   0   67  850   18  GGG          GS          GG    E G   G S                     G      E 
   192   71 B N  T 3  S+     0   0  105  828   57  NNN          NN          NN    G N   N N                     N      N 
   193   72 B K  E <  S- T   0 190D  68  833   67  KRK          KN          KK    K K   K D                     T      K 
   194   73 B A  E     -RT 143 189D   0  838   81  AAA          AA          AA    A A   A A                     A      A 
   195   74 B A  E     -RT 142 188D   0  849   57  STA          AA          AA    A A   A A                     S      A 
   196   75 B L  E     -RT 141 187D   0  850    2  LLL          LL          LL    L L   L L                     L      L 
   197   76 B T  E     -RT 140 186D  19  850   33  TTT          TT          TT    T T   T T                     T      T 
   198   77 B I  E     -RT 139 185D   0  849    5  III          II          II    L I   I I                     I      I 
   199   78 B T  E    S+R  138   0D  78  850   46  TTT          ST          ST    S T   T T                     T      T 
   200   79 B G  S    S-     0   0   15  850   57  GGG          GG          GG    G G   R G                     G      E 
   201   80 B A        -     0   0    0  849   51  AAA          AV          AA    A A   A V                     A      A 
   202   81 B Q    >   -     0   0   80  849   32  QQQ          QQ          QQ    Q Q   Q Q                     Q      Q 
   203   82 B T  G >  S+     0   0   84  850   59  PRA          PA          PP    L A   T A                     A      P 
   204   83 B E  G 3  S+     0   0   99  850   17  EED          EE          EE    E D   D E                     E      E 
   205   84 B D  G <   +     0   0    1  850    2  DDD          DD          DD    D D   D D                     D      D 
   206   85 B E    <   +     0   0   71  849   74  EEE          EE          EE    K E   E E                     E      E 
   207   86 B A  E    S- O   0 227C   3  850   14  TAS          AA          AA    A S   A A                     A      A 
   208   87 B I  E     -LO 161 226C  55  850   71  DDD          ND          ED    E D   D D                     D      A 
   209   88 B Y  E     -LO 160 225C   0  850    0  YYY          YY          YY    C Y   Y Y                     Y      Y 
   210   89 B F  E     -L  159   0C   5  848    8  YYY          YY          YH    Y Y   Y Y                     Y      H 
   211   90 B b  E     -L  158   0C   0  849    1  CCC          CC          CF    C C   C C                     C      C 
   212   91 B A  E     -LP 157 221C   0  848   73  LAV          AI          SN    W M   S I                     N      S 
   213   92 B L  E     - P   0 220C   0  845   83  LLL          LV          LL    L L   L I                     S      L 
   214   93 B W  E     + P   0 219C  21  834   71  YYY          YW          YY    V Y   Y W                     R      Y 
   215   94 B Y  E >  S- P   0 218C  33  829   88  MTM          NT          FV    Y M   M T                     D      M 
   216   95 B S  T 3  S-     0   0  106  829   66  GGG          AG          GG    S G   G G                     S      S 
   217   96 B N  T 3  S+     0   0  105  824   81  SSS          Gs          GS    g S   S s                     s      G 
   218   97 B H  E <   -P  215   0C  39  647   66  N..          .h          ..    q .   . h                     h      . 
   219   98 B L  E     -P  214   0C   1  382   85  ...          ..          ..      .   . p                     A      . 
   220   99 B V  E     -P  213   0C  12  489   66  I..          ..          ..      .   . V                     V      . 
   221  100 B F  E     -P  212   0C  17  540   30  YY.          ..          ..      .   . R                     F      . 
   222  101 B G        -     0   0    1  481   35  TT.          .S          ..      .   . G                     G      . 
   223  102 B G        -     0   0   51  513   58   D.          .D          S.      .   . G                     G      . 
   224  103 B G        -     0   0    8  528   33    G          .P          T.      G   G S                     G      . 
   225  104 B T  E     - O   0 209C   0  550   33               AA          DD      I   I E                     T      G 
   226  105 B K  E     -kO 130 208C  82  547   67               LR          TV      S   H T                     K      A 
   227  106 B L  E     -kO 131 207C   0  546   44               Y           YY      T   T                       L      Y 
   228  107 B T  E     -k  132   0C  34  614   65               T           TT      A   V                       T      T 
   229  108 B V  E     -k  133   0C   3  593   35               V           VV      I   I                       V      V 
   230  109 B L              0   0  120  399   31               M           MM                                  L      I 
   231  110 B G              0   0   62  207   39                                                               G        
## ALIGNMENTS  631 -  700
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....4....:....5....:....6....:....7....:....8....:....9....:....0
     1    1 A E              0   0  185  771   30   DEQ           EQ    E  EEQEEEEQ  Q QQEEEQ  E                  EEQQDQE
     2    2 A V        +     0   0   18  834   19   IVV           VV VVVVVVVVVVVVVV  I VVVVVV  V               VVVVVVVVVV
     3    3 A Q  E     -A   25   0A  90  836   34   QQK           QQ QQQQQQQQQQQQQH  Q QQQQQQ  K               QQQKQQQQQK
     4    4 A L  E     -A   24   0A  13  881    3   LLL           LL LLLLLLLLLLLLLL  LLLLLLVLL L               LLLLLLLLLL
     5    5 A Q  E     -A   23   0A 107  882   70   IVV           VV VVVVVVVVQVVVLV  VVQVVVVVT V               VVVLVLVVVV
     6    6 A Q  E     -A   22   0A  14  887   31   QEQ           EQ EEEEEEEEEEEEEQ  QEEEQEEEQEE               EEEEEQQEEE
     7    7 A S        -     0   0   33  892   13   PSA  S        SS SSSSSSSSSSSSSS  SSSSSSSSSSS               SSSSSSSSSS
     8    8 A G        -     0   0   52  907   11   GGG  G        GG GGGGGGGGGGGGGE  GGGGGGDGEGG               GGGGGGGGGG
     9    9 A A        -     0   0   80 1179   51   SGG GGGGGGGGGGGA GGGGGGGGPGGGGS  PGGGAGGGAGGGGGGGGGG GGGGG GGGGGAAGGG
    10   10 A E  E     -d  116   0B  68 1189   46   EGG GDGGGGGGGDGE GGGGGGGGGGGGDE  EGEGEGGGVGGGGGGGGGS GGDGG GGGGGEEGGG
    11   11 A L  E     +d  117   0B 130 1195   22   MLV LLLLLLLLLLLV LLVLVLLLLLLVLV  LLLVVLLVILLLLLLLLLL LLLLL LLVLLVLLVL
    12   12 A V  E     -d  118   0B  28 1197   47   KVV VVVVVVVVVVVR VIVVVVVVVVVVVK  KVVVKVVVKVVVVVVVVVV VVVVL VVVVVKKVVV
    13   13 A K    >   -     0   0  145 1201   50   KQQ QKKQQKQQQKKK QQQQQQQQKQQRQK  TKQQRQQQRQQQQQQKQQQ QKKQK QQQQKTRPLQ
    14   14 A P  T 3  S+     0   0   70 1203    8   PPP PPPPPPPPPPPP PPPPPPPPPPPPPP  PPPPPPPPPPPPPPPPPPP PPPPP PPPPPPPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28   GGG GGGGGGGGGGGG GGGGGGGGSGGGGG  GGGGGGGGEGGGGGGGGGG GGGGG GGGGGGGGGG
    16   16 A A    <   -     0   0   36 1213   63   EGR GGGGGGGGGGGA GGRGRGRRERGGGA  EGGREGRREGGGGGGGGGGGGGGGG GRRGGAAGGT
    17   17 A S        -     0   0   66 1210   29   TSS SSSSSSSSSSSS SSSSSSSSTSSSSS  TSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSS
    18   18 A V  E     - B   0  83A  10 1213   32   VLL LLLLRLLLLLLV LLLLLLMLLLLLLV  VLLLLLLLHMLRRRRLRRRLLLLLL LLLLLVVRLL
    19   19 A K  E     - B   0  82A 119 1211   53   KRR KKKKKKRKKKRK RRRRRRKKSRKRRK  KRKRRRKRRKSKKKKKKKKKRKKRT RRRKRKTKRT
    20   20 A L  E     - B   0  81A   0 1214   21   LLL LLLLLLLLLLLV LLLLLLLLLLLILV  ILLLILLLLLLLLILLLLLLLLLLL LLLLLLILLL
    21   21 A S  E     - B   0  80A  31 1215   35   TSS SSSSSSSSSSSS SSSSSSSSTSSSSS  SSSSSSPSTSSSSSSSSSSSSSSSS SSSSSSSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0   CCC CCCCCCCCCCCC CCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70   KAI AAAAAAAAAATK AAAAAAAATAAAAQ  KAAAKTAATVAAAAAAAAAAAAAAA AAAAAKRAAA
    24   24 A A  E     +A    4   0A   2 1216   49   TAA AAAAAATAAAAA AAAAAAAAVAAAAA  AAAATGAATATAAAAAAAAATAATA VAAAAPAAAT
    25   25 A S  E     +A    3   0A  49 1216   12   SSS SSSSSSSSSSSS SSSSSSSSSSSSSS  SSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSS
    26   26 A G  S    S+     0   0   56 1215    3   GGG GGGGGGGGGGGG GGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGG
    27   27 A Y  S    S-     0   0   39 1216   33   YFF FFFFFFFFFFFY FFFFFFFFGFFFFY  YFLFYFFFFFFFFIFFFFFFFFFFF FFFFFNYFFF
    28   28 A T    >   -     0   0   90 1216   52   DTT TTTTTTTTTTTT TTTTTTTTSTTTTP  TTTTSTTTTTTTTTTTTTTPTTTTT TTTDTTSTRT
    29   29 A F  G >  S+     0   0   13 1216   27   FFF FFFFFFFFFFFF FVFFFFFFIFVFFF  FFFFFFFFFFFFFFFFFFFFFFFFF FFFFFVFFFF
    30   30 A T  G 3  S+     0   0   40 1216   55   GGS SSSSSSTSSSST SSSSSSSSSDNDST  TSTSTSSSSSISSSSSSSSSTSSTS TSSSSNSSRT
    31   31 A S  G <  S+     0   0   23 1216   57   SSN SSDSSDDSSSTS DSSSSSNDGDNDTR  DNNSsSDSSNDSTGSNTSSSDDSDD TSSkSITNDE
    32   32 A Y  E <  S-E  100   0B  40 1139   28   YYY YYYYFYYYYYYY HNYYYYYYYYYYYY  YAYY.YYYYYYFFFFYFFFYYYYYY YYY.YYYYYY
    33   33 A W  E     -E   99   0B  40 1148   92   YTG GAYGGYYGGAGA YYGWGWGNYAWGAI  SWSGwYYGWWYGGGGAGGGAYYGYY EGGwSAHGDY
    34   34 A M  E     -EF  98  51B   0 1206   49   MMM MMMMMMMMMMMI MMMMMMMMWMMMMM  IMMMIMMMMMMMMMMMMMMMMMMMM MMMMMLIMMM
    35   35 A H  E     -EF  97  50B   0 1212   72   HHH SSYSHYSSSSHH DSHSHSAASHHSSN  HSGHSYAHHNSHHHHSHHHSSYPSY NHHSNHHHHS
    36   36 A W  E     -EF  96  49B   0 1216    0   WWW WWWWWWWWWWWW WWWWWWWWWWRWWW  WWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17   VVV VVVVVVVVVVVV VVVVVVVVIVVVVV  VVFVVVVVIVFVVVVVVVVVVVVVV VVVVVLVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22   QRR RRRRRRRRRRRR RRRRRRRRRRRRRR  KRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5   QQQ QQQQQQQQQQQQ QQQQQQQQQQQQQQ  QQPQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQ
    40   40 A R    >   -     0   0   35 1216   71   VAA TSTTATPTTSAA AAAAAAAAPAAAAA  AAGAMAAAASPAAAATGAATPTTPT AAAAAAAASP
    41   41 A P  T 3  S+     0   0  130 1215   15   QPP PPPPPPPPPPPP PPPPPPPPAPPPPP  PPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22   GGG DEEDEEGDDEEG GGGGGGKKGGGGGG  GGGGGGTGGEGEEEEEEEEEGEDGE GGGGGGGEGG
    43   43 A R  S <  S-     0   0  156 1216   43   KKK KKKKKKKKKKKE KKKKKKKKKKKKKQ  KKVKKKKKKKKKKKKKKKKKKKKKK KKKKKHQKER
    44   44 A G        -     0   0   16 1215   36   SGG RRRRGRARRRGR GGGGGGGGGGGGGG  DGDGGGGGGGAGGGGRGGGRARRAR GGGGGGRGGA
    45   45 A L  E     -F   39   0B   8 1215   10   LLL LLLLLLLLLLLL LLLLLLLLLLLLLL  LLRLLLLLLLLLLLLLLLLLLLLFL LLLLLPLLLL
    46   46 A E  E     -F   38   0B  34 1216    6   QEE EEEEEEEEEEEK EEEEEEEEEEVEEE  KEEEEEEEEEEEEEEEKEEEEEEEE EEEEEEEEEE
    47   47 A W  E     -F   37   0B   3 1216   10   WWW LWWLWWWLLWWY WWWWWWWWWWWWWW  WWAWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWW
    48   48 A I  E     -     0   0B   0 1215   31   VIV VVVVVVLVVVVM VVVVVVVVIVVVVM  MVVVMVVVIVLVVVVVVVVVLVVLV VVVIVMMVVL
    49   49 A G  E     -FG  36  60B   0 1216   35   GSA AAAAAAGAAASG ASAAAAAAGSSSSG  GGAAGSAAAAGAAAAAAAAAGAAGA SAAGSTGAAG
    50   50 A R  E     -FG  35  59B  32 1216   94   RRV TETTYTFTTETW VVVNVNYtRGLGGW  WRAVSASVYELYYYYTYYYTFTTFT YVVESwIYLF
    51   51 A I  E     -FG  34  58B   0 1207   17   III IIIIIIIIIIII IIIIIIIiIIMIII  IIIIIIIIIIIIIIIFIIIIIIIII IIIIFvMIII
    52   52 A D     >  -     0   0   26 1212   86   NSW NSSNSSRNNSSN SYSKWKSYYSRNGD  NKSWYNSSGRRSSNSSSSSIRSSRS SWSNSENSWR
    53   53 A P  T  4 S+     0   0    0 1212   83   PSY SNDSSDNSSNIT YSYQYQYDTWDWDT  TSWYPTYYTLNSSSSSSSSSNDSND SYYPSNPSYN
    54   54 A N  T  4 S-     0   0   96 1213   69   ASN NGGNGGKNNGGN DGDDDDDGSNDNSK  EKSDGGDDSKKGGDGDGGGGKGGKG SDDDRGRSDR
    55   55 A G  T  4 S-     0   0   69 1216   57   SGG GGGGSGaGGGGT GGGGGGGSGSAGGT  TaGGDGGGSsgSSSSGGSSGaGGaG gGGSgNSSGa
    56   56 A G     <  +     0   0   25  915   61   GGS GGSGSSyGGGGG S.SSSSG..GSGHG  GgDSSGSSSyySSTSSGGSVySSyS sSSSs.DGTy
    57   57 A G        -     0   0   43 1195   77   DTR SYYSTYTSSYSK NSNENEYRSSESSN  ETNNDSSNPATTTTTYITTYTYYTY TNNTY.STKT
    58   58 A T  E     -G   51   0B  62 1209   46   TIT TTTTITTTTTTP KTKRKKTTTITTIP  PTTKTTTKITMIIIITIIITTTTTT KKKIEMKITP
    59   59 A K  E     -G   50   0B  89 1212   88   DSY YYYYYYEYYYYT YYYYYYYYNAAGYT  TDYYKWYYYHEYYYYYKYYYEYYEY YYYNYMTFYE
    60   60 A Y  E     -G   49   0B  46 1215    9   YYY YYYYYYYYYYYY YYYYYYYYYYYYYY  YYYYYYYYYYYYYYYYYYYYYYYYY YYYYYSYYYY
    61   61 A N    >>  -     0   0   12 1216   63   TAG PPPPAPSPPPAA AAAVAVRRNAAAAA  AAVANTRASASAAAAPVAAPSPPSP AAAAASAASS
    62   62 A E  G >4 S+     0   0  148 1216   64   SED DDDDDDADDDNQ DDDDDDDDPDEDDQ  DASDPDDDPEADDDDDDDDDADDAD DDDPDHQDDA
    63   63 A K  G 34 S+     0   0  109 1216   64   SSS STSSTSSSSTSG SSSSSSPSSSFSSA  DPSSSSSSSSSTTTTSTTTSSSSSS SSSSSYTTSS
    64   64 A F  G X> S+     0   0    5 1216   45   FVV VMVVVVVVVMVF VVVVVVVVLVVVVF  FVVVFVVVVVLVVVVVVVVVVVVVV VVVLVFFVVV
    65   65 A K  T << S+     0   0  156 1216   40   KKK KTKKKKKKKTKS KKKRKKKKKKQKKT  TKKKQKKKKKKKKKKKKKKKKKKKK KKKKKRQKKQ
    66   66 A S  T 34 S+     0   0  108 1216   35   GGG GGGGGGGGGGGE GGGGGGGGSGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGG GGGDGPGGGG
    67   67 A K  T <4 S+     0   0   33 1214   21   RRR RRRRRRRRRRRR RRRRLRRRRRRRRR  RRRRHRRRRRRRRRRRRRRRRRRRR RRRKRRRRRR
    68   68 A A  E  <  -C   83   0A   2 1216   69   FFF FFFFFFFFFFFF FFFFFFFFVFFFFF  FFFFVFFFFFFFFFFFFFFFFFFFF FFFFFLMFLF
    69   69 A T  E     -C   82   0A  58 1216   37   TTT TTTTTTTTTTTV TTTTTTTTTTTTTV  ATTTTTTTTTTTTTTTATTTTTTTT TTTITTTTTT
    70   70 A L  E     +C   81   0A   7 1216   27   III IVIIIIIIIVIF IIIITIIIMIIIIF  FIIIIIIIIIIIIIIIIIIIIIIII IIIIIVMIVI
    71   71 A T  E     -C   80   0A  57 1213   47   TSS SSSSSSSSSSSS SSSSSSSSSSSSSS  SSSSSSSSSSSSSSSSSSSSSSSSS SSSSSTTSSS
    72   72 A V  E     -C   79   0A  28 1216   71   KRR RRRRRRRRRRRM RRRRRRRRVRRRRL  LRRRAKRRRRRRRRRRRRRRRRRRR RRRRRRRRRR
    73   73 A D  E   > -C   78   0A  69 1216    7   DDD DDDDDDDDDDDD DDDDDDDDDDDDDD  EDDDDEDDDDDDDDDDDDDDDDDDD DDDEDDDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62   NNN NNNNNNNNNNNT NNNNNNNNTNNNNT  TDNNKNNNDDNNNNNNDNNNNNNNN NNNNNATNNN
    75   75 A P  T 3 5S+     0   0  122 1215   37   STS AAAAPASAAAAS SSSASAAASGAASS  SSASSAASSSSPPPPAPPPASAASA ASSAASSAYS
    76   76 A S  T 3 5S-     0   0   37 1216   65   IKK RKKKKKQKKKKV KKKKKKKKKKKKKV  AKKKIKKKSKQKKEKKKKKKQKKQK KKKKKATKKQ
    77   77 A S  T < 5 +     0   0   24 1216   48   SNR NNNNNNSNNNNS NNNNNNNSNNNNNS  SNNNSNSNSSSNNNNNNNNNSNNSN DNNNNNSNNN
    78   78 A T  E   < -BC  23  73A   8 1216   64   TTT TINTTNITTIET TTTSTSTTQSTSTT  TTTTTTTTKSITTTTTTTTIINTIN SSTTSTTTTI
    79   79 A A  E     -BC  22  72A   0 1207   67   ALL LLLLLLLLLLLA LLLLLLLLFLLLLA  ALVLTLLLLVVLLLLLLLLLLLLLL LLLLLVVLLL
    80   80 A Y  E     -BC  21  71A  61 1209   36   YSY YYYYFYYYYYYY YYYYYYYYSYFYYY  YYYYFYYYYYYFFFFYFFFYYYYYY FYYYYYFFYY
    81   81 A M  E     -BC  20  70A   0 1212    9   LLM LLLLLLLLLLLL LLLLLLLLLLLLLL  LLLLLLLLLLLLLLLLLLLLLLLLL LLLLLMMLLL
    82   82 A Q  E     -BC  19  69A  69 1215   43   EQZ QEQQQQQQQEQQ QQQQQQQQKQQQQQ  QQQQHQQQQQHQQQQQQQQQQQQQQ QQQQQEEQEQ
    83   83 A L  E     -BC  18  68A   0 1215   14   IMM MMMMMMMMMMMI MMMMMMMMLMLMMI  IMMMWMMMMMMMMMMMMMMMMMMMM MMMMMLLMMM
    84   84 A S        +     0   0   32 1215   56   SSN SSSSTSNSSSNN NNNNNNDDSNSNNN  NNNNSDDNNNNTTTTSTTTSNSSNS HNNSNTNTKN
    85   85 A S  S    S-     0   0   89 1216   25   SSS SSSSSSTSSSSG SSSSSSSSSSSSSN  NSSSSSSSSNTSSSSSSSSSTSSTS SSSKSSSSST
    86   86 A L        +     0   0    2 1216   15   LLL LLLLLLLLLLLL LLLLLLLLVLLLLL  LLLLLLLLLLLLLLLLLLLLLLLLL LLLVLLLLLL
    87   87 A T    >   -     0   0   61 1215   68   KRR KRKKRKRKKRKK RRRRRRRRTRRRRK  KKKRKRRRKRTRRRRRRRRRRKKRK RRRRRTKRGR
    88   88 A S  G >  S+     0   0   72 1216   59   PAT SSSSSSASSSSS AAAAAASSAAAAAA  NTPAAASATAASSSSSSSSSASSAS AAASASSSAA
    89   89 A E  G 3  S+     0   0  107 1216   21   EEE EEEEEEEEEEEE EEEEEEEEAEEEEE  EEQESEEEEEEEEEEEEEEEEEEEE EEEEEEGEEE
    90   90 A D  G <  S+     0   0    7 1216    3   DDD DDDDDDDDDDDD DDDDDDDDDDDDDD  DDDDDDDDDDDDDDDDDDDDDDDDD DDDDNDDDDD
    91   91 A S    <   +     0   0   31 1216   34   TST TTTTTTSTTTTT TTTTTTTTTTTTTT  TTTTTTTTSTSTTTTTTTTTSTTST TTTTTTTTTS
    92   92 A A  E    S- H   0 116B  10 1214    5   AAA AAAAAAAAAAAA AATAAAAAAAAAAA  SAAAAAAAAGAAAAAAAAAAAAAAA AAAAAAAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48   TVV MMMMMMTMMMVM VVVVVVTTVLVVVV  TVVVTVTVVITMMMMMIMMMTMMTM VVVLVVVMVT
    94   94 A Y  E     -EH  38 114B   0 1216    1   YYY YYYYYYYYYYYY YYYYYYYYYYYYYY  YYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3   YYY YYYYYYYYYYYY YYYYYYYYYYYYYF  FYYYYYYYYYYYYYYYYYYYYYYYY YYYYYFYYYY
    96   96 A a  E     +E   36   0B   0 1216    1   CCC CCCCCCCCCCCC CCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24   AAA AVAAAAAAAVAA AAAAAATAAAAAAT  ANAAAAGAATAAAAAAAAAAAANAA AASAAATAAA
    98   98 A R  E     -E   34   0B  13 1196   38   RRR RRRRRRRRRRSR KRKRRRTTRKRRTT  IYVRKKRKRRRRRRRRRRRRRRYRR RTPRRSRRRR
    99   99 A M  E     -EI  33 107B   5 1101   82   HHD DIDGRRDDGIGD DGIVDIDNGEGRGL  HYKPVDHDDPVSRSRPWSSPYDRYD QDLFDEDLDA
   100  100 A W  E >   -E   32   0B  89 1101   89   kTP RYGegaGKYYRT VSVRSPRRRiGRSS  YFPvtTSsagDYGTGyGYYlYryNN TqGLLRrYQY
   101  101 A Y  T 3  S+     0   0  112  572   91   sVD ....y.NPG... QVAAVP...f....  YDDly.Sl...........g.y.A. L.T...l..S
   102  102 A Y  T 3  S-     0   0  133  629   92   FRI ....G.YAN... GWSAWMY..Y..QG  ASDWY.YY...........Y.D.P. F.T...W.GN
   103  103 A G  S <  S+     0   0   38  705   79   yGl ....n.FYY... YSNYgiYwFYF.wY  YSGfe.Ff..YY.....YYW.Y.YY g.v...FYyY
   104  104 A T        -     0   0   32  784   66   gI. .D.g...ygDsh GGpnyvg...g.gs  GG.edH.wd.gGevgggGG.Pdg.g hgdAGGgsg.
   105  105 A Y        +     0   0   81  679   93   ..a .F.Nag.s.Fde D..pgrnhT....d  .Y.ns..gD.nNytygwNN.Yd..y ....WGagY.
   106  106 A Y        -     0   0   32  842   66   ..f fylFyy.W.yFC y..WPHWYYy.y.w  dlWWaf.YY.YyyHfAYyyYyW.Yy ....fLFAgY
   107  107 A F  E     +I   99   0B   0  885   48   GYf lmmFmm.Ffm.. fLf..FFFFmfl.e  lrWFff.FFp.fmFmMFvfFmFFCm Ff..lF.MfF
   108  108 A D  E     +     0   0B  25  997   46   DHD ADDADDDAADY. DDDDDDTDDDDDDD  DDDDDKDDDDDADDDDDAADDAADD DDD.DDDDDD
   109  109 A Y  E     -J  168   0C 108 1059   61   LCY YYYYYYYYYYY. YYYYYYYYYVQYYY  YLYPNFYYYYYYYYYYLYYVYYYYY YYYYYVIYHN
   110  110 A W  E     -I   97   0B  23 1092    2   WWW WWWWWWWWWWWW WWWWWWWWWWWWWW  WWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWW
   111  111 A G        -     0   0    3 1067   15    LG GGGGGGGGGGGT GGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGG
   112  112 A Q        -     0   0  141 1047   41    LQ QQQQQQQQQQQV QQQQQQQQQQQQQQ  QQQQQQQQKQQQQQQQAQQAQQQQQ QQQQQPQQQQ
   113  113 A G        -     0   0   20 1013   12    SG GGGGGGGGGGGT GGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGG
   114  114 A T  E     - H   0  94B   2  996   31    GV TTTTTTTTTTTT TTTTTTTVTTTTTT  TTTTVAVTTTTTTTTTTTTTTTTTT TTTTTTTTTT
   115  115 A T  E     - H   0  93B  60  979   76    FL LSSLSSTLLSLT LLLLLLLMLTLLLL  S QLLLMLQTTLSTSSTLLTSLLTS LLLSLTKSLT
   116  116 A L  E     -dH  10  92B   1  972   19    IV VVVVVVLVVVV  VVVVVVVVVVVVVV  V VVVVVVVLLVILVVVVVVVVVLV VVVVVVVVVL
   117  117 A T  E     -d   11   0B  57  953   21    TT TTTTTTTTTTT  TTTTTTSTTTT TT  T TTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTT
   118  118 A V  E     +d   12   0B   4  935    8    LV VVVVVVVVVVV  VVVVV VVVVV VV  V VVVVVVVVVVVVVVVVVVVVVVV V VVVVVVVV
   119  119 A S              0   0   64  917   10    TS SSSSSSSSSSS  SSSSS SSSSS SS  S SSSSSSTSSSSSSSSSSSSSSSS S SSSSSSSS
   120  120 A S              0   0  122  885   21     S ASSASSSAASS  SSSSS SSSSS SS  S SSSSSSSSSASSSSSAASSAASS S SSSSSSSS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32  Q   Q            Q              QQ                                    
   123    2 B A        -     0   0   19  713   70  A   P            T              TT                                    
   124    3 B V        -     0   0   84  765   49  V   V            V              VV                                    
   125    4 B V  E     -Q  145   0D  10  820   26  V   V            V              VV                         L          
   126    5 B T  E     +Q  144   0D  69  829   11  T   T            I              TT                         T          
   127    6 B Q  E     -Q  143   0D  18  832    2  Q   Q            Q              QQ                         Q          
   128    7 B E        -     0   0   59  833   63  E   E            E              EE                         D          
   129    8 B S  S    S+     0   0  101  841   38  P   P            P              PP                         P          
   130    9 B A  E     -k  226   0C  59  842   50  S   S            S              SS                         A          
   131   10 B L  E     -k  227   0C  57  847   76  L   M            V              VV                         V          
   132   11 B T  E     +k  228   0C  84  848   77  S   S            S              SS                         S          
   133   12 B T  E     -k  229   0C  18  848   68  V   V            V              VV                         V          
   134   13 B S    >   -     0   0   55  849   70  S   T            S              SS                         A          
   135   14 B P  T 3  S+     0   0   61  848   65  L   P            P              AA                         L          
   136   15 B G  T 3  S+     0   0   46  850    7  R   G            G              GG                         G          
   137   16 B E    <   -     0   0  108  850   56  G   G            G              GG                         Q          
   138   17 B T  E     - R   0 199D  88  850   66  T   A            A              TT                         T          
   139   18 B V  E     - R   0 198D  14  850   33  V   V            V              VV                         V          
   140   19 B T  E     - R   0 197D  53  849   41  T   T            T              TT                         R          
   141   20 B L  E     - R   0 196D   0  849   25  M   L            L              LL                         I          
   142   21 B T  E     - R   0 195D  22  849   52  T   S            T              TT                         T          
   143   22 B b  E     -QR 127 194D   0  850    2  C   C            C              CC                         C          
   144   23 B R  E     -Q  126   0D 133  850   77  G   S            G              GG                         Q          
   145   24 B S  E >   -QS 125 148D  11  850   68  S   L            L              LL                         G          
   146   25 B S  T 3  S+     0   0   81  850   27  S   S            S              SS                         D          
   147   26 B T  T 3  S-     0   0   87  850   71  T   T            S              SS                         S          
   148   27 B G  B <  S+S  145   0D  39  850   55  G   G            G              GG                         L          
   149   28 B A        -     0   0   40  390   77  A   A            S              AA                         .          
   150   29 B V        -     0   0    3  620   45  V   I            V              VV                         .          
   151   30 B T    >   -     0   0   56  541   72  T   T            S              SS                         .          
   152   31 B T  G >  S+     0   0   94  694   78  T   S            T              SS                         R          
   153   32 B S  G 3  S+     0   0   84  802   62  G   S            S              SG                         G          
   154   33 B N  G <  S-     0   0   13  673   73  Q   N            N              NN                         Y          
   155   34 B Y    <   -     0   0   98  781   50  Y   Y            Y              YN                         D          
   156   35 B A        -     0   0    0  817   59  P   P            P              PP                         A          
   157   36 B N  E     -L  212   0C   0  827   79  Q   H            Q              SS                         A          
   158   37 B W  E     -LM 211 171C   0  849    0  W   W            W              WW                         W          
   159   38 B V  E     -LM 210 169C   0  849   25  F   F            F              YL                         Y          
   160   39 B Q  E     -LM 209 168C  10  849   10  Q   Q            Q              QQ                         Q          
   161   40 B E  E     -LM 208 167C  20  849    8  Q   Q            Q              QQ                         Q          
   162   41 B K  E  >  - M   0 166C  68  849   50  A   K            T              TI                         K          
   163   42 B P  T  4 S+     0   0   98  843   23  P   P            P              PP                         P          
   164   43 B D  T  4 S-     0   0  148  846   16  G   G            G              GG                         G          
   165   44 B H  T  4 S+     0   0   90  845   66  W   S            K              KK                         Q          
   166   45 B L  E  <  - M   0 162C  92  846   57  A   A            A              PP                         A          
   167   46 B F  E     + M   0 161C   9  847   19  F   P            P              PP                         P          
   168   47 B T  E     -JM 109 160C  56  843   61  R   R            R              RR                         L          
   169   48 B G  E     + M   0 159C   1  848   64  T   T            L              MH                         L          
   170   49 B L  E     +     0   0C   4  848   24  V   L            L              LL                         V          
   171   50 B I  E     +NM 177 158C   0  848   19  L   I            I              II                         I          
   172   51 B G  E  >  +N  176   0C   0  849   33  Y   Y            Y              YY                         Y          
   173   52 B G  T  4 S-     0   0    9  848   87  S   D            S              EE                         G          
   174   53 B T  T  4 S+     0   0    9  849   68  A   T            T              AA                         R          
   175   54 B N  T  4 S+     0   0  102  841   49  N   N            S              NN                         N          
   176   55 B N  E  <  -N  172   0C  77  849   69  S   N            S              KK                         N          
   177   56 B R  E     -N  171   0C 113  850   66  H   R            R              RR                         R          
   178   57 B A    >   -     0   0    1  849   73  P   P            P              PP                         P          
   179   58 B P  T 3  S+     0   0   97  849   39  T   S            S              TS                         S          
   180   59 B G  T 3  S+     0   0   83  850   18  G   G            G              GG                         G          
   181   60 B V  S <  S-     0   0   13  848   23  V   I            V              VV                         I          
   182   61 B P    >   -     0   0   57  850    9  P   P            P              PP                         P          
   183   62 B A  T 3  S+     0   0   77  850   59  D   D            G              DD                         D          
   184   63 B R  T 3  S+     0   0   58  850    5  R   R            R              RR                         R          
   185   64 B F  E <   +T  198   0D   4  850    1  F   F            F              FF                         F          
   186   65 B S  E     -T  197   0D  51  849   17  S   S            S              SS                         S          
   187   66 B G  E     +T  196   0D   9  850    4  G   G            G              GG                         G          
   188   67 B S  E     -T  195   0D  41  850    7  A   A            S              SS                         S          
   189   68 B L  E     -T  194   0D  59  835   79  .   I            I              II                         S          
   190   69 B I  E >   -T  193   0D  86  842   31  L   S            S              SS                         S          
   191   70 B G  T 3  S-     0   0   67  850   18  H   G            G              GG                         G          
   192   71 B N  T 3  S+     0   0  105  828   57  G   N            N              NN                         H          
   193   72 B K  E <  S- T   0 190D  68  833   67  D   K            K              KK                         T          
   194   73 B A  E     -RT 143 189D   0  838   81  K   A            A              AA                         A          
   195   74 B A  E     -RT 142 188D   0  849   57  S   A            A              AA                         S          
   196   75 B L  E     -RT 141 187D   0  850    2  L   L            F              LL                         L          
   197   76 B T  E     -RT 140 186D  19  850   33  T   T            T              TT                         T          
   198   77 B I  E     -RT 139 185D   0  849    5  I   I            I              II                         I          
   199   78 B T  E    S+R  138   0D  78  850   46  S   T            K              SS                         T          
   200   79 B G  S    S-     0   0   15  850   57  G   G            E              GG                         G          
   201   80 B A        -     0   0    0  849   51  A   V            A              AA                         A          
   202   81 B Q    >   -     0   0   80  849   32  Q   Q            Q              QQ                         Q          
   203   82 B T  G >  S+     0   0   84  850   59  P   A            L              PP                         A          
   204   83 B E  G 3  S+     0   0   99  850   17  E   D            E              EE                         E          
   205   84 B D  G <   +     0   0    1  850    2  D   D            D              DD                         D          
   206   85 B E    <   +     0   0   71  849   74  E   E            E              EE                         E          
   207   86 B A  E    S- O   0 227C   3  850   14  A   A            A              DD                         A          
   208   87 B I  E     -LO 161 226C  55  850   71  M   D            N              DD                         D          
   209   88 B Y  E     -LO 160 225C   0  850    0  Y   Y            Y              YY                         Y          
   210   89 B F  E     -L  159   0C   5  848    8  Y   Y            H              YY                         Y          
   211   90 B b  E     -L  158   0C   0  849    1  C   C            C              CC                         C          
   212   91 B A  E     -LP 157 221C   0  848   73  G   M            L              NA                         N          
   213   92 B L  E     - P   0 220C   0  845   83  V   V            L              LL                         S          
   214   93 B W  E     + P   0 219C  21  834   71  W   W            Y              HY                         R          
   215   94 B Y  E >  S- P   0 218C  33  829   88  I   A            M              VL                         D          
   216   95 B S  T 3  S-     0   0  106  829   66  G   G            G              GG                         S          
   217   96 B N  T 3  S+     0   0  105  824   81  S   S            s              SS                         s          
   218   97 B H  E <   -P  215   0C  39  647   66      .            h              ..                         h          
   219   98 B L  E     -P  214   0C   1  382   85      .            .              ..                         V          
   220   99 B V  E     -P  213   0C  12  489   66      .            Q              ..                         L          
   221  100 B F  E     -P  212   0C  17  540   30      .            H              ..                         F          
   222  101 B G        -     0   0    1  481   35      .            G              ..                         G          
   223  102 B G        -     0   0   51  513   58      .            K              ..                         G          
   224  103 B G        -     0   0    8  528   33      .            G              ..                         G          
   225  104 B T  E     - O   0 209C   0  550   33      .            G              NG                         T          
   226  105 B K  E     -kO 130 208C  82  547   67      A            S              VI                         K          
   227  106 B L  E     -kO 131 207C   0  546   44      H            L              YH                         L          
   228  107 B T  E     -k  132   0C  34  614   65      T            A              TT                         T          
   229  108 B V  E     -k  133   0C   3  593   35      V            P              VV                         V          
   230  109 B L              0   0  120  399   31      I            L              MM                         L          
   231  110 B G              0   0   62  207   39                   P                                         G          
## ALIGNMENTS  701 -  770
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 A E              0   0  185  771   30  EEEQ EDQ D   EEEEEE D  QQEQD E             QE        E DDQD EEEE EQEQQ
     2    2 A V        +     0   0   18  834   19  VVVV VVV V  VVVVVVVMV  VVVVV V             VV VVVVVVVV VVIV VVVVVVVVVV
     3    3 A Q  E     -A   25   0A  90  836   34  QQQQ QQQ Q  QQQQQQQQQ  QQQEQ N             QQ QQQQQQQM QQHK QQQQQQQQQQ
     4    4 A L  E     -A   24   0A  13  881    3  LLLL LLL L LLLLLLLLLLLLLLLLLLL             LL LLLLLLLLLLLLL LLLLLLLLLL
     5    5 A Q  E     -A   23   0A 107  882   70  VVLV QDQ Q TVVVVVVVVVTTVVLVQTV             VV VVVVVVVVTQAVV VVVVVLVLQV
     6    6 A Q  E     -A   22   0A  14  887   31  EEEQ EQE E SEEEEEEEEEQQQDEEESE             QE EEEEEEEESEQQE EEEEEEQEGE
     7    7 A S        -     0   0   33  892   13  SSSS SSS S SSSSSSSSSSSSSSSSSSS             SS SSSSSSSSSSSSS SSSSSSSSSS
     8    8 A G        -     0   0   52  907   11  GGGG GEG G GGGGGGGGGGEEGGGGGDG             GG GGGGGGGGDGEGG GGGGGGGGGG
     9    9 A A        -     0   0   80 1179   51  GGGA GSG P SGGGGGGGGGAAAGGGPSGGGGGG G PGPGGAG GGGGGGGGSPPPG GGGGGGAGPG
    10   10 A E  E     -d  116   0B  68 1189   46  GGGE GVG D ETGGGGGGGGVVEGGGGVGGGGDG G GGGGGEG GGGGGGGGVDVEG GGGGGGEGSG
    11   11 A L  E     +d  117   0B 130 1195   22  VLLV LVL L VLLLLLLLLLIIVLLVLVLLLLLL LLLLLLLLL LVVVVVVLVLVLL VLVLVLVLLV
    12   12 A V  E     -d  118   0B  28 1197   47  VVVK VIV V KVVVVVVVVAKKKVVVVKVVVVVV VVVVVVVRV VVVVVVVVKVIKV VVVVVVKVVV
    13   13 A K    >   -     0   0  145 1201   50  QQQK QKQ K KQQQQQQQPQRRKEQZKRQKQQKKKKQQQQQQKQ QQQQQQQQRKKKK QQQKQQKQKQ
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPP PPP P PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPPPP PPPPPPPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28  GGGG KGK S RGGGGGGGGGEEGGGGSGGGGGGGSGSSGSGGGG GGGGGGGKGSGGG GGGGGGAGSG
    16   16 A A    <   -     0   0   36 1213   63  GGGS GGG Q EGGGGGGGGGEESGGRQEGGGGGGQGQQGQGGAN GGRRRRRGEQGEG GGRGRGSGQR
    17   17 A S        -     0   0   66 1210   29  SSSS SSS S SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSTS SSSSSSSSTS
    18   18 A V  E     - B   0  83A  10 1213   32  LLLV LHM L VLLLLLLLLLHHALLLLVLLLRLLLLPLRLLLVL LLLLLLLLVLHVL LLLLLLVLLL
    19   19 A K  E     - B   0  82A 119 1211   53  RRRR KKK S TRRRRRRRRRRRRRRRSTRKRKKKSKSSKSRRER RRRRRRRKTSKKR RRRRRRKRFR
    20   20 A L  E     - B   0  81A   0 1214   21  LLLV LLL L LLLLLLLLLLLLLLLLLLLLLLLLLLIILILLVL LLLLLLLLLLLIL LLLLLLVLLL
    21   21 A S  E     - B   0  80A  31 1215   35  SSSS SSS T SSSSSSSTSSTTSSSSTSSSSSSSTSTTSTSSSS SSSSSSSSSTSSS FSSSSSSSTS
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCC CCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCC CCCCCCCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70  AAAR ATA T VATTTAAAAATTKSAASTAAAAAATATTATAARV AAAAAAVATTTKA AAAAATKATA
    24   24 A A  E     +A    4   0A   2 1216   49  AAAA AAA V VAGGGAAAAATTVAAAVVAATAAAVAVVAVTTAA VAAAAAAAVVAAA AAAAAAAAVA
    25   25 A S  E     +A    3   0A  49 1216   12  SSSS SSS T SSSSSSSSSSSSSSSSTSSSSSSSTSSSSSSSSS SSSSSSFSSTSSS SSSSSSSSSS
    26   26 A G  S    S+     0   0   56 1215    3  GGGG GGG G GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGG GGRGGGGGGG
    27   27 A Y  S    S-     0   0   39 1216   33  FFFG FFF Y LFFFFFFFFFFFDFFFYIFFFFFFYFFFFFFFYF FFFFFYFFIYFYF FFFFFFGFFF
    28   28 A T    >   -     0   0   90 1216   52  TTSA TKN S STTTTTTTTTTTDTTTSSTTTTITSTSSTSTTIT TSTTTTTTSSTTI TTTTTTTTST
    29   29 A F  G >  S+     0   0   13 1216   27  FFFL FFF I LLFFFFFFFFFFFFFFIMFFFFFFIFLLFLFFFF FLFFFFFFMIFFF FVFFFFFFLF
    30   30 A T  G 3  S+     0   0   40 1216   55  SSSA SSN T ASSSSSSSSSRSNSSSTSTSTSNSTSTTSTTTTD TSSSSSSNSTSTS DSSSSSGSTS
    31   31 A S  G <  S+     0   0   23 1216   57  SSnN TSI s WRSSSSSDSNSSTATNsSDSDSRDsSSSSSDDSD TDSSSSSNRsSSn GSNKSNTsSN
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YY.Y YYN y .YYYYYYYYYYYYNYYyYYYYFYYyYYYFYYYYY YYYYYYYYYyYYy YNYAYYY.YY
    33   33 A W  E     -E   99   0B  40 1148   92  GSaA AWA T .DYYYENEWYEYDDVAFWYTYGGYAAGGGGYYAA EGGGGGWAWGAG. AYGWAAAaAG
    34   34 A M  E     -EF  98  51B   0 1206   49  MMMI MMM W LMMMMMMMMMMMIMMMWMMMMMMMWMVVMVMMLM MMMMMMMMMWMLM MMMMMMIMVM
    35   35 A H  E     -EF  97  50B   0 1212   72  HNSS NNN H HNYYYNNDSSNNHNSHNHSSSHSYNSHHHHSSLS NHHHHHSNHHSTS HNHSHTSSNH
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWW WWW W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWW WWWWWWWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17  VVVV VVV I IVVVVVVVVVIIVVVVIIVVVVVVIVVVVVVVVV VVVVVVVVIIVVV VVVVVVVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22  RRRR RRR R RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRIR RRRRRRRRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQ QQQ Q QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQ QQQQQQQQQQ
    40   40 A R    >   -     0   0   35 1216   71  AAAA ADA F KAAAAAAAAAAAAAAPFKPTPATTFSSSASPPSA AAAAAAAAKFAST AAAAAAAAAA
    41   41 A P  T 3  S+     0   0  130 1215   15  PPQP PPP P PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPPPP PPPPPPPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGG GDG G GGGGGGGGGGGGGGGGGGGEGEDEGEGGEGGGAG GGGGGGGGGGGGE GGGGGRGGGG
    43   43 A R  S <  S-     0   0  156 1216   43  KKKQ KKR N KKKKKKKKKKKKRKKKNKKKKKKKNKKKKKKKGK KEKKKKKKKNKKK KKKKKKKKKK
    44   44 A G        -     0   0   16 1215   36  GGGG GRG K GGGGGGGGGGGGGGGGKGARAGKRKRGGGGAAAG GGGGGGGGGKGDR GGGGGGGGAG
    45   45 A L  E     -F   39   0B   8 1215   10  LLLL LLL L LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLL LLLLLLLLLL
    46   46 A E  E     -F   38   0B  34 1216    6  EEEE EQE E EEEEEEEEEEEEEEZEEEEEEEEEEEEEEEEEQE EEEEEEEEEEQKE EEEEEEEEEE
    47   47 A W  E     -F   37   0B   3 1216   10  WWWW WWW W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWYW WWWWWWWWWWWWW WSWWWWWWWW
    48   48 A I  E     -     0   0B   0 1215   31  VVVM VVI M IIVVVVVLLVIIMLVVLILVLVVVMVLLVLLLLV VVVVVVVVIMVMV VVVVVVMVVV
    49   49 A G  E     -FG  36  60B   0 1216   35  ASSG ASA A GSSSSAAGGSAAASGAGGGAGAAAGAGGAGGGGS SAAAAAAAGGSGA SSAGASGSGA
    50   50 A R  E     -FG  35  59B  32 1216   94  FYAA RRR Y RYAAAYYEEYFIVFAVFYFTFYTTYEVVYVFFWY YVVVVVNRYYAWT LVARVAgGNV
    51   51 A I  E     -FG  34  58B   0 1207   17  IIFI VII I IIIIIIIIIIIIVIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII ITIIIIlVII
    52   52 A D     >  -     0   0   26 1212   86  RSSI RTR H DGNNNNSNNSSHHGZSKDRSRSSSSSWWSWRRNN SSSSSWKRDSSNS SYSKSGYSLS
    53   53 A P  T  4 S+     0   0    0 1212   83  YSGP SNS Y SGTTTSTPPGTPPGGYYTNSNSSDYSRSSSNNTK SYYYYYQSTYDTN GSNSYGKNNP
    54   54 A N  T  4 S-     0   0   96 1213   69  DTSM KDY S GSGGGGGADDSSSSLBDGKGKGGGSGGGGGKKDN SDDDDDDKGSGFS DGDKDSQSDD
    55   55 A G  T  4 S-     0   0   69 1216   57  GIGS sGs G TGGGGGGGGSSSDGSGGTaGaSGGGGGGSGaaTG gGGGGGGsTGGSG GGGtGGSGGE
    56   56 A G     <  +     0   0   25  915   61  SIGR yDy . .NGGGG.SSSSSDSVB..ySySSS.S..S.yyGD sSSSSSSy..GGY G.SgSH.G.N
    57   57 A G        -     0   0   43 1195   77  NTST AIE N GVSSSSSSTYPPRTSBSTTYTTYYSYSSTSTTKT TNNNNNEATSSVA SSNTNS.DNS
    58   58 A T  E     -G   51   0B  62 1209   46  KITT TTT T TITTTTTTTIIITIZKNATTTITTTTTTITTTPT KKKKKKKTANTPT TSKTKI.TTQ
    59   59 A K  E     -G   50   0B  89 1212   88  YYYD YYY D ISWWWYYSNYYYTYSYGYEYEYYYSYDDYDEETY YYYYYYYFYNYTH YYFDYYTYYY
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYY YYY F FYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYN YYYYYYYYYYYYY YYYYYYYYYY
    61   61 A N    >>  -     0   0   12 1216   63  AAAA ANV N ASTTTSAAAASSGAAANASPSAQPNPNNANSSAA AAAAAAVAANAAP AAAAAGAANG
    62   62 A E  G >4 S+     0   0  148 1216   64  DDDQ DDD P QDDDDNNNNDPPPDBBPQADADDDPDAADAAAQN DDDDDDDDQPDDD DDDADDQDPD
    63   63 A K  G 34 S+     0   0  109 1216   64  SSSK SSS S SSSSSSASASSSRSSSSSSSSTTSSTAATASSGS SSSPSSSSSSSDS SSSPSSKSAS
    64   64 A F  G X> S+     0   0    5 1216   45  VVVF VFV L LVVVVVVVVVVVSVVVLLVVVVVVLVFFVFVVFV VVVVVVVVLLVFM VVVVVVFVLV
    65   65 A K  T << S+     0   0  156 1216   40  KKKR KKK K QKKKKKKKKKKKQKKKKQKRKKKKKTMIKIKKSK KKKKKKKKQKKKK KKKKKKRKKK
    66   66 A S  T 34 S+     0   0  108 1216   35  GGGG GGD S GGGGGGGGGGGGAGGGNGGGGGGGSGSSGSGGEG GGGGGGGDGSGGG GGGGGGGGSG
    67   67 A K  T <4 S+     0   0   33 1214   21  RRRR RRR R QRRRRRRRRRRRRRRRRQRRRRRRRRGRRRRRRR RRRRRRRRQRRRR RRRRRRRRRR
    68   68 A A  E  <  -C   83   0A   2 1216   69  FFFV FFF I FFFFFFFLFFFFFFFFVFFFFFFFIFLLFLFFFF FFFFFFFFFIFFF FFFLFFVFLF
    69   69 A T  E     -C   82   0A  58 1216   37  TTTT TTT S TTTTTTTTTTTTTTTTSTTTTTITSTSSTSTTVT TTTTTTTTTSTAT TTTTTTTAST
    70   70 A L  E     +C   81   0A   7 1216   27  IIII III I IIIIIIIIIIIIVIIIIIIIIIIIIIIIIIIIFI IIIIITIIIIIFI IIIIIIIIII
    71   71 A T  E     -C   80   0A  57 1213   47  SSSS SSS T TSSSSSSSSSSSTSSSTTSSSSSSTSTSSSSSSS SSSSSSSSTTSSS SSFSSSTSSS
    72   72 A V  E     -C   79   0A  28 1216   71  RRRA RRR R KKKKKRRRRRRRRRRRRKRRRRRRRRKKRKRRMR RRRRRRRRKRRLR RRRRRRARRR
    73   73 A D  E   > -C   78   0A  69 1216    7  DDDD DDD D DDEEEDDDDDDDDNDDDDDDDDDDDDDDDDDDDD GDDDDDDDDDDDD DDDDDDDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62  NNNE DND T TNNNNNNNNNDNSBDBTTNNNNNNTNNNNNNNTN NNNNNNNDTTNTN NNNSNNENTN
    75   75 A P  T 3 5S+     0   0  122 1215   37  SASS SNS S SAAAAAAAAASPSSSSSSSASPAASASSPSSSSA ASSSSSASSSNSA SSSSSSSSSS
    76   76 A S  T 3 5S-     0   0   37 1216   65  KKKR QKQ K KRKKKKKKKKSSTKKKEKQKQKKKKKKKKKQQVK KKKKKKKQKKNTQ KKKKKNTKKK
    77   77 A S  T < 5 +     0   0   24 1216   48  NNNS SNS N NNNNNNNNNNSSTNNBNNSNSNNNNNSSNSSSSN DNNNNNNSNNNSN NNNNNNNNSN
    78   78 A T  E   < -BC  23  73A   8 1216   64  TSTT MNM Q MSTTTKTMTSKKTSTTQMITITTNQTQQTQIITT STTTTTSMMQKTT STMTTTTTQT
    79   79 A A  E     -BC  22  72A   0 1207   67  LLLA LLL F VLLLLLLLLLLLVLMLFLLLLLLLFLVVLVLLGL LLLLLLLLLFLAV LLMLLLALVV
    80   80 A Y  E     -BC  21  71A  61 1209   36  YYYY YYY F YYYYYYYYFYYYYYNYFYYYYFYYFYFFFFYYFY FYYYYYYYYFYYL YYDYYYYYSY
    81   81 A M  E     -BC  20  70A   0 1212    9  LLLM LLL L LLLLLLLLLLLLML.LLLLLLLLLLLFFLFLLLL LLLLLLLLLLLLL LLLLLLMLLL
    82   82 A Q  E     -BC  19  69A  69 1215   43  QQQE QQQ Q EQQQQQQQQQQQEQ.QKEQQQQQQQEKKQKQQQQ QQQQQQQQEQQQQ QQQRQQEQSQ
    83   83 A L  E     -BC  18  68A   0 1215   14  MMML MMM L IMMMMMMMMMMMLM.MLVMMMMMMLMMMMMMTIM MMMMMMMMVLMIM MMMMMMLMLM
    84   84 A S        +     0   0   32 1215   56  NNNN NNN N KNDDDNSNKNNNTS.NNKNSNTSSNSNNTNNNNN HNNNNNNNKNNDT NNNNNNNNSN
    85   85 A S  S    S-     0   0   89 1216   25  SSSS NNN S SSSSSSSTSSSSASSSSSASTSSSSSSSSSTTGN SSSSSSSNSSNNS SSSSSTGSSS
    86   86 A L        +     0   0    2 1216   15  LLLL LLL V LLLLLLLLLLLLLLLLVLLLLLLLVLLLLLLLLL LLLLLLLLLVLLL LLLLLLLLVL
    87   87 A T    >   -     0   0   61 1215   68  RRRR KQK T KRRRRKRRRRKKIRRRTKRKRRKKTRQQRQRRKR RRRRRRRKKTQKN RRRKRRSRTR
    88   88 A S  G >  S+     0   0   72 1216   59  AAAS TTT A AAAAAAAAAATTSAAATSASASSSTSAASAAASV AAAAAAATSTTNS AAATAALATA
    89   89 A E  G 3  S+     0   0  107 1216   21  EEED EEE E EEEEEEEEEEEEAEEEEEEEEEEEEEDNENEEEE EEEEEEEEEEEEE EEEEEEEEEE
    90   90 A D  G <  S+     0   0    7 1216    3  DDDD DDD D DDDDDDDDDDDDDDDBDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDD DDDDDDDDDD
    91   91 A S    <   +     0   0   31 1216   34  TTTT TTT T TTTTTTTMMTSSTTTTTTSTSTTTTTTTTTSSTT TTTTTATTTTTTT TTTTTTTTTT
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAA AAA A AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGA AAAAAAAAAAAAA AAAAAAAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48  VVVV MVI T VVVVVVVVVVVVIVVVTVTMTMMMTMIIMITTVM VVVVVVVMVTVTV LFVVMVVVVL
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYY YYY Y YYYYYYYYYYYYYYYYYYYYYYYYYYYYHYYYYY YYYYYYYYYYYYY YYYYYYFYYY
    95   95 A Y  E     -E   37   0B   1 1216    3  YYYY YYY Y YFYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFY YYYYYYYYYYYFY YYYYYYYYYY
    96   96 A a  E     +E   36   0B   0 1216    1  CCCC CCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCC CCCCCCCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAA VGV A AAAAAAAAATAAAAAAAAATAAAAAAAAAAAAAA AAAAAAAVAAAST AAATAAAAAA
    98   98 A R  E     -E   34   0B  13 1196   38  KRRR RRR R RRKKKRRRRRRRRRKRGRRRRRRRRRKRRRRRRK RRKKKRRRRRRTR KRKTGATNRK
    99   99 A M  E     -EI  33 107B   5 1101   82  DGVH PDG G EGDDDDHDYDDDGGGDDTDDDSPDSGNKDNDYDV QSDDDDERTYHRG GDDGGGLTGM
   100  100 A W  E >   -E   32   0B  89 1101   89  LdTr aTL Y YgTttttTtTtPaWKRNsrRDYrsgYYHDnGGia TYrrqGyGAEGGD kREiGSiLGL
   101  101 A Y  T 3  S+     0   0  112  572   91  N..g y.W . .yQlw.g.a.y.y..P.cy.......Y....Tyn L........G... yFRv....I.
   102  102 A Y  T 3  S-     0   0  133  629   92  Y..D FWF . NGRCT.S.V.H.S..L.DY.......G....YYW F........N... DGGV.Q..Y.
   103  103 A G  S <  S+     0   0   38  705   79  W..S DFA . YDwYF.W.pCshd..Y.Yy..Y...YY.Y..Ycy g.......YY..Y REri.w.wY.
   104  104 A T        -     0   0   32  784   66  ..Gd .g. g .f..cga.gDggd.vgd.ge.Gtg.g.Gdh.Ggs hseeigwa.Dgg. ..vtGgvgss
   105  105 A Y        +     0   0   81  679   93  .eGn Yd. y .vgWy.v.v.t.t.yyy.TtWNwa.aYYwyT.l. .waaayad..wtW ..tt..ggwh
   106  106 A Y        -     0   0   32  842   66  .AWW gn. y YRLYy.G.WYN.S.YrYYSWYyYW.WyYYYY.L. .yAAaYPyYyYAY .fYSl.SFtF
   107  107 A F  E     +I   99   0B   0  885   48  .FSF ff. m FLFFlKFAAFFfLLFfFFFFFvFFfFmVFFFMFF Fw..fF.mFmFLF FfFFl.F.iL
   108  108 A D  E     +     0   0B  25  997   46  .DDG AD. D DDSDDDRSSDDDGLBNDDAADADADADDDDDDEE DD..DEDDDDEDD DDDEGDDDND
   109  109 A Y  E     -J  168   0C 108 1059   61  .IYP YYY Y YSFLSMTYYYYYPNYYYYYYVYVYYYYYVYVYYY YYNNYLYYYYHTV IYYYYYIYYS
   110  110 A W  E     -I   97   0B  23 1092    2  .WWW WWW W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWLWWWWWWW WWWWWWWWWW
   111  111 A G        -     0   0    3 1067   15  GGGG GGG G GGGGGASGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGG GGGGGGGGGG
   112  112 A Q        -     0   0  141 1047   41  QQQR QSQ Q KQQPQ LQQQQKQQZQQKQQAQAQQQQQAQAQQQ QQQQQPQQKQQQA QQQQQQQQPQ
   113  113 A G        -     0   0   20 1013   12  GGGG GGG G GGGGG G  GGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGG GGGGGGGGGG
   114  114 A T  E     - H   0  94B   2  996   31  TTTT TTT T TTATV T  TTTTTTTTTTTTTTTTTTTTTTTTT TTTTT TTTTTTT TTTTTTTTLT
   115  115 A T  E     - H   0  93B  60  979   76  LMLL LMT S KLLPV    LTMLLLLTKLLTLTLTLSTTTTSLL LLLLL LSKSMST MLLLLVMLLL
   116  116 A L  E     -dH  10  92B   1  972   19  VVVV VVV V VVVIV    VVVLVVVLVVVVVVVLVVLVLVVVV VVVVV VLVVVLV VVVVVVVVVV
   117  117 A T  E     -d   11   0B  57  953   21  TTTT TTT T TTTTT    TTTITTTTTTTTTTTTTTTTTTTTT TTTTT TTTTTTT TTTTTTTTTT
   118  118 A V  E     +d   12   0B   4  935    8  VVVV VVV V VVVIV    VVVVVVVVVVVVVVVVVVVVVVVVV VVVVV VVVVVVV VVVVVVVVVV
   119  119 A S              0   0   64  917   10  SSSS STS S SSSSS    SSTSSSSSSSSSSSSSSSSSSSSSS SSSSS SSSSTSS SSSSSSSSSS
   120  120 A S              0   0  122  885   21  S SS ASS S SSSSS    SSSSSSSSSAASASASASSSSSSSS SSSSS SSSSSSS SSSSSSSSSS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32      Q                                                                 
   123    2 B A        -     0   0   19  713   70      F                                                                 
   124    3 B V        -     0   0   84  765   49      V     V                                  M             M          
   125    4 B V  E     -Q  145   0D  10  820   26      L   L V                                  L             L          
   126    5 B T  E     +Q  144   0D  69  829   11      T   T T                                  T             T          
   127    6 B Q  E     -Q  143   0D  18  832    2      Q   Q Q                                  Q             Q          
   128    7 B E        -     0   0   59  833   63      P   P P                                  P             P          
   129    8 B S  S    S+     0   0  101  841   38      N   H P                                  H             H          
   130    9 B A  E     -k  226   0C  59  842   50      S   S S                                  S             S          
   131   10 B L  E     -k  227   0C  57  847   76      V   V A                                  V             V          
   132   11 B T  E     +k  228   0C  84  848   77      S   S S                                  S             S          
   133   12 B T  E     -k  229   0C  18  848   68      T   E G                                  E             E          
   134   13 B S    >   -     0   0   55  849   70      N   S T                                  S             S          
   135   14 B P  T 3  S+     0   0   61  848   65      L   P P                                  P             P          
   136   15 B G  T 3  S+     0   0   46  850    7      G   G G                                  G             G          
   137   16 B E    <   -     0   0  108  850   56      S   K Q                                  K             K          
   138   17 B T  E     - R   0 199D  88  850   66      T   T R                                  T             T          
   139   18 B V  E     - R   0 198D  14  850   33      V   V V                                  V             I          
   140   19 B T  E     - R   0 197D  53  849   41      K   T T                                  T             T          
   141   20 B L  E     - R   0 196D   0  849   25      L   I I                                  F             I          
   142   21 B T  E     - R   0 195D  22  849   52      S   S S                                  S             S          
   143   22 B b  E     -QR 127 194D   0  850    2      C   C C                                  C             C          
   144   23 B R  E     -Q  126   0D 133  850   77      K   T S                                  T             T          
   145   24 B S  E >   -QS 125 148D  11  850   68      R   R G                                  G             R          
   146   25 B S  T 3  S+     0   0   81  850   27      S   S S                                  S             S          
   147   26 B T  T 3  S-     0   0   87  850   71      T   S S                                  G             S          
   148   27 B G  B <  S+S  145   0D  39  850   55      G   D S                                  G             G          
   149   28 B A        -     0   0   40  390   77      .   . .                                  .             .          
   150   29 B V        -     0   0    3  620   45      N   S N                                  S             S          
   151   30 B T    >   -     0   0   56  541   72      I   I I                                  I             I          
   152   31 B T  G >  S+     0   0   94  694   78      G   A G                                  A             A          
   153   32 B S  G 3  S+     0   0   84  802   62      S   S S                                  D             S          
   154   33 B N  G <  S-     0   0   13  673   73      N   N N                                  S             N          
   155   34 B Y    <   -     0   0   98  781   50      Y   Y T                                  F             Y          
   156   35 B A        -     0   0    0  817   59      V   V V                                  V             V          
   157   36 B N  E     -L  212   0C   0  827   79      N   Q N                                  Q             Q          
   158   37 B W  E     -LM 211 171C   0  849    0      W   W W                                  W             W          
   159   38 B V  E     -LM 210 169C   0  849   25      Y   Y Y                                  Y             Y          
   160   39 B Q  E     -LM 209 168C  10  849   10      Q   Q Q                                  Q             Q          
   161   40 B E  E     -LM 208 167C  20  849    8      Q   R Q                                  Q             Q          
   162   41 B K  E  >  - M   0 166C  68  849   50      H   R L                                  R             R          
   163   42 B P  T  4 S+     0   0   98  843   23      E   P P                                  P             P          
   164   43 B D  T  4 S-     0   0  148  846   16      G   G G                                  G             G          
   165   44 B H  T  4 S+     0   0   90  845   66      R   S T                                  S             S          
   166   45 B L  E  <  - M   0 162C  92  846   57      S   A A                                  A             A          
   167   46 B F  E     + M   0 161C   9  847   19      P   P P                                  P             P          
   168   47 B T  E     -JM 109 160C  56  843   61      T   T K                                  T             T          
   169   48 B G  E     + M   0 159C   1  848   64      T   T L                                  T             T          
   170   49 B L  E     +     0   0C   4  848   24      M   V L                                  V             V          
   171   50 B I  E     +NM 177 158C   0  848   19      I   I I                                  I             I          
   172   51 B G  E  >  +N  176   0C   0  849   33      Y   F Y                                  Y             Y          
   173   52 B G  T  4 S-     0   0    9  848   87      R   A S                                  D             E          
   174   53 B T  T  4 S+     0   0    9  849   68      D   D N                                  D             D          
   175   54 B N  T  4 S+     0   0  102  841   49      D   D N                                  N             N          
   176   55 B N  E  <  -N  172   0C  77  849   69      K   R Q                                  Q             Q          
   177   56 B R  E     -N  171   0C 113  850   66      R   R R                                  R             R          
   178   57 B A    >   -     0   0    1  849   73      P   P P                                  P             P          
   179   58 B P  T 3  S+     0   0   97  849   39      D   S S                                  S             S          
   180   59 B G  T 3  S+     0   0   83  850   18      G   G G                                  G             G          
   181   60 B V  S <  S-     0   0   13  848   23      V   V V                                  V             V          
   182   61 B P    >   -     0   0   57  850    9      P   P P                                  P             P          
   183   62 B A  T 3  S+     0   0   77  850   59      D   D D                                  D             D          
   184   63 B R  T 3  S+     0   0   58  850    5      R   R R                                  R             R          
   185   64 B F  E <   +T  198   0D   4  850    1      F   F F                                  F             F          
   186   65 B S  E     -T  197   0D  51  849   17      S   S S                                  S             S          
   187   66 B G  E     +T  196   0D   9  850    4      G   A G                                  G             G          
   188   67 B S  E     -T  195   0D  41  850    7      s   s S                                  s             s          
   189   68 B L  E     -T  194   0D  59  835   79      r   y K                                  d             s          
   190   69 B I  E >   -T  193   0D  86  842   31      S   S S                                  S             S          
   191   70 B G  T 3  S-     0   0   67  850   18      S   S G                                  A             S          
   192   71 B N  T 3  S+     0   0  105  828   57      N   N T                                  N             N          
   193   72 B K  E <  S- T   0 190D  68  833   67      S   S S                                  S             S          
   194   73 B A  E     -RT 143 189D   0  838   81      A   A A                                  A             A          
   195   74 B A  E     -RT 142 188D   0  849   57      L   S S                                  S             S          
   196   75 B L  E     -RT 141 187D   0  850    2      L   L L                                  L             L          
   197   76 B T  E     -RT 140 186D  19  850   33      T   T A                                  T             T          
   198   77 B I  E     -RT 139 185D   0  849    5      I   I I                                  I             I          
   199   78 B T  E    S+R  138   0D  78  850   46      N   S S                                  S             S          
   200   79 B G  S    S-     0   0   15  850   57      N   G G                                  G             G          
   201   80 B A        -     0   0    0  849   51      V   L L                                  L             L          
   202   81 B Q    >   -     0   0   80  849   32      Q   R Q                                  K             K          
   203   82 B T  G >  S+     0   0   84  850   59      T   T S                                  T             T          
   204   83 B E  G 3  S+     0   0   99  850   17      E   E E                                  E             E          
   205   84 B D  G <   +     0   0    1  850    2      D   D D                                  D             D          
   206   85 B E    <   +     0   0   71  849   74      E   E E                                  E             E          
   207   86 B A  E    S- O   0 227C   3  850   14      A   A A                                  A             A          
   208   87 B I  E     -LO 161 226C  55  850   71      D   D D                                  D             D          
   209   88 B Y  E     -LO 160 225C   0  850    0      Y   Y Y                                  Y             Y          
   210   89 B F  E     -L  159   0C   5  848    8      F   Y Y                                  Y             Y          
   211   90 B b  E     -L  158   0C   0  849    1      C   C C                                  C             C          
   212   91 B A  E     -LP 157 221C   0  848   73      Q   Q A                                  Q             Q          
   213   92 B L  E     - P   0 220C   0  845   83      S   S A                                  S             S          
   214   93 B W  E     + P   0 219C  21  834   71      Y   Y W                                  Y             Y          
   215   94 B Y  E >  S- P   0 218C  33  829   88      S   D D                                  N             D          
   216   95 B S  T 3  S-     0   0  106  829   66      S   S D                                  S             S          
   217   96 B N  T 3  S+     0   0  105  824   81      g   n s                                  n             n          
   218   97 B H  E <   -P  215   0C  39  647   66      n   l g                                  h             y          
   219   98 B L  E     -P  214   0C   1  382   85      .   W W                                  V             A          
   220   99 B V  E     -P  213   0C  12  489   66      I   V V                                  V             L          
   221  100 B F  E     -P  212   0C  17  540   30      F   F F                                  F             F          
   222  101 B G        -     0   0    1  481   35      G   G G                                  G             G          
   223  102 B G        -     0   0   51  513   58      G   G G                                  G             G          
   224  103 B G        -     0   0    8  528   33      G   G G                                  G             G          
   225  104 B T  E     - O   0 209C   0  550   33      T   T T                                  T             T          
   226  105 B K  E     -kO 130 208C  82  547   67      K   K N                                  K             Q          
   227  106 B L  E     -kO 131 207C   0  546   44      L   L L                                  V             L          
   228  107 B T  E     -k  132   0C  34  614   65          T T                                  T             T          
   229  108 B V  E     -k  133   0C   3  593   35          V V                                  V             V          
   230  109 B L              0   0  120  399   31          L L                                  L             L          
   231  110 B G              0   0   62  207   39          G G                                  G             G          
## ALIGNMENTS  771 -  840
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 A E              0   0  185  771   30  QEEEQQQEEEE EEQEEE             Q     EDEEEQDDEE  E Q  E Q E QQQQQEEEEE
     2    2 A V        +     0   0   18  834   19  VVVVVVVEVEE VVVVVV             V  VVVVVVVVVVVIV  V V  V V V VVVVVVVVVV
     3    3 A Q  E     -A   25   0A  90  836   34  QQQQQQQQQQQ QQQQQK             Q  QQQMKQQQQQQQQ  Q Q  M Q N QQKQRQQQQQ
     4    4 A L  E     -A   24   0A  13  881    3  LLLLLLLLLLL LLLLLLLL           L  LLLLLILLLLLLL  L L  LML L LLLLLLLLLL
     5    5 A Q  E     -A   23   0A 107  882   70  VVVVVVVVVVV VVQVVVTT           Q  VVVVVLVEVDAVV  V K  VLV E VVLQQVVVVV
     6    6 A Q  E     -A   22   0A  14  887   31  EEEEQEEEEEE EEQEEESS           E  EEEEEEEQEQQEE  E Q  EEQ E QEEEEEEEEE
     7    7 A S        -     0   0   33  892   13  SSSSSSSSSSS SSWSSSSS           S  SSSSSTTSSSSSS  S S  SSS S SSSSSSSSSS
     8    8 A G        -     0   0   52  907   11  GGGGGGGGGGG GGGGGGDG           G  GGGGGGGGGEEGG  G GGGGGG G GGAGGGGGGE
     9    9 A A        -     0   0   80 1179   51  GGGGGGGGGGG GGAGGGSSGG G GGG PGP  GGGEGGGPGSSGG  G PGPGGG G GGPPPGGGGG
    10   10 A E  E     -d  116   0B  68 1189   46  GGGGGGGGGGG GDGDDGVEGGDG GGG GGG  GGGGGGGQGVVGG  G GGGGGG G GGGSSGGGGG
    11   11 A L  E     +d  117   0B 130 1195   22  LLLLVVVLLLL LLLLLLVVLLLL LLL LLQ  LLLLLLLLVVVLL  L LLLLLV L VLLLLLLLLL
    12   12 A V  E     -d  118   0B  28 1197   47  VVVVVVVVVVV VVVVVVKKVVVV VVV VVV  VVVVVVVKVIIVV  V VVVVVV V VVVVVVVVVV
    13   13 A K    >   -     0   0  145 1201   50  NQQQQQQQQQL QKKQQQRKQQKQ QQQ AQK  QQQQQKQTQKKQQ  K QQKKKQ Q QQKKKQQQPQ
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPPPPPPPP PPPPPPPPPPPP PPR PPP  PPPPPPPPPPPPL  P PPPPPP P PPPPPPPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28  GGGGGGGGGGG GGSGGGGRKGGG GGG SGS  GGGKGGKGGGGGG  G SGSGGG G GGSSSGGGGG
    16   16 A A    <   -     0   0   36 1213   63  GGGGRRRGGGG GGERRGEEGGGG GGG QGQ  GGRGRGGEKGGGG  G QREGGR G RREQQRGGGG
    17   17 A S        -     0   0   66 1210   29  SSSSSSSSSSS SSTSSSSSSSSS SSS SST  SSSSSSSTSSSSS  S SSTSSS S SSTTTSSSSS
    18   18 A V  E     - B   0  83A  10 1213   32  RLLLLLLLLLL LLLLLLVVLRLR LRRMLLL  LLLLLLLVVHHLL  L LLLLLL M LLLLLLLLLL
    19   19 A K  E     - B   0  82A 119 1211   53  RRRRRRRRRRR RRSRRRTTKKKKKRKKKSRS  RRRKKRKERKKRR  R SRSKRR K RRSSSKRRRR
    20   20 A L  E     - B   0  81A   0 1214   21  LLLLLLLLLLL LLLLLLLLLLLLLLLLLILL  LLLLLLLILLLLL  L ILLLLL L LLLLLLLLLL
    21   21 A S  E     - B   0  80A  31 1215   35  SSSSSSSSSSS SSTSSSSSSSSSSSSSSTST  SSSSSSSSSSSSS  S TSTSSS S SSTTTSSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCCCCCCCC CCCCCCCCCCGCCCCCCCCC  CCCCCCCCCCCCC  C CCCCCC C CCCCCCCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70  VTTTAAAAAAA AVAAAATVAAAAAAAAVTAT  AATAAAAKATTAA  A TATTAA A ATTTTATTSA
    24   24 A A  E     +A    4   0A   2 1216   49  AGGGAAAAAAA AAVAATGVAAAAATAAAITV  AAAAATAAAAAAT  A VAVAGA A ATVVVAGGGA
    25   25 A S  E     +A    3   0A  49 1216   12  SSSSSSSSSSS SSFSSSSSSSSSSSSSSSSS  SSPSSSSSSSSSS  S SSSSSS S SSSSSSSSSS
    26   26 A G  S    S+     0   0   56 1215    3  GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGG  GGGGGGGVGGGGG  G GGGGGG G GGGGGGGGGG
    27   27 A Y  S    S-     0   0   39 1216   33  FFFFFFFFFFF FIGFFFFLFFFFFFFFFFFF  FFFFFFFYFFFFL  L FFGFFF F FFGFFFFFFF
    28   28 A T    >   -     0   0   90 1216   52  TTTTTTTTTTT TTSBNTSSTTSTATTTTSTS  TTTTTNSTDTTTT  S STSITT T STSSSTTTTT
    29   29 A F  G >  S+     0   0   13 1216   27  LFFFFFFFFFF FFFFFFVLFFFFFFFFFLFL  FFFFFFFLFFFFF  F VFIFFF F FFVLLFFFFF
    30   30 A T  G 3  S+     0   0   40 1216   55  NSSSSSSSSSS SSSBHSGANSSSSTSSSTTT  SSGNSNNTSSSST  S TDSNSS S GGRTTSSSSS
    31   31 A S  G <  S+     0   0   23 1216   57  DSSSTTTSSSS SGGBEADWTSDGSDsTNSDn  NNDTDDtDTsSSK  T SDsRSN D NDSssDSSSS
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YYYYYYYYYYY YYYLYFY.YFYFYY.FYYY.  YYYYYY.YY.YFY  Y YYyCYY A FYg..YYYYY
    33   33 A W  E     -E   99   0B  40 1148   92  YYYYGAAYDSD DDYGNYW.AGAGDYgGWGYg  WWAAGFaSAwYEW  A GAYAGG W GAyaaYYYSY
    34   34 A M  E     -EF  98  51B   0 1206   49  VMMMMMMMMMM MMWMMMMLMMMMMMIMMVMV  MMMMMMMLMMMMM  M VMWMFM M MMWVVMMMMM
    35   35 A H  E     -EF  97  50B   0 1212   72  IYYYHHHSNDN HQSTHEHHNHSHSSHHNHSH  NNSNANNHHSNNT  N HHGSSH D HISGGAYYDN
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWWWWWWWW WWWWWWWWWWWWWWWWWWWW  WWWWWWWWWWWWW  W WWWWWW W WWWWWWWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17  VVVVVVVVVVV VVIVLVIIVVVVVVVVVVVT  AAVVVVVVVVVVV  V IVIVVV V VAIVVVVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22  RRRRRRRRRRR RRRRRRRRRRRRRRRRRRRR  RRRRRRRKRRRRR  R RRPRRR R RRRRPRRRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQ  QQQQQQQQQQQQQ  Q QQQQQQ Q QQQQQQQQQQ
    40   40 A R    >   -     0   0   35 1216   71  AAAAAAAAAAA AAPAGPKKAATATPAGSPPA  VVAAAAAGSAAAA  A SAPTAA S AAPAAAAAAA
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPPPPPPPPP PPPPPPPPPPPPPPPPPPPP  PPPPPPPPPPPPP  P PPPPPP P PPPPPPPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGGGGGGGGG GGGGGGGGGEEEEGEEEGGG  GGGGGGGGGGGGG  G GGGEGG E GGGGGTGGGG
    43   43 A R  S <  S-     0   0  156 1216   43  KKKKKKKKKKK KKRKKKKKKKKKKKKKKKKK  KKKKKKKKRKKKK  K KKKKKK K KKKKKKKKKK
    44   44 A G        -     0   0   16 1215   36  GGGGGGGGGGG GGGGGRGGGGRGRAGGGGAG  GGGGGGGGRGGGG  G GGGRGG G GGGAVGGGGG
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLLLLLLLL LLLLPLLLLLLLLLLLLLLL  LLLLPLLLLLLLL  L LLLLLL L LLLLALLLLL
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEEEEEEEE EQEEEEEEEEEEEEEEEEEE  EEEEEEEREQQEE  E EEEEEE E EEEEEEEEEE
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWWWWWWWW WKWWWWWWWWWWWWWWWWWW  WWWWCWWWWWWWW  W WWWWWW W WWYWWWWWWW
    48   48 A I  E     -     0   0B   0 1215   31  VVVVVVVVVVV AVIVVIIIVVVVVLVVVLLV  VVVVVVVMVVLLV  V LVIVVV V VVIVLVVWVV
    49   49 A G  E     -FG  36  60B   0 1216   35  ASSSAAASSAA SAGASAGGAAAAAGAAAVGG  AAGAAVAGASCSA  S GSGASA A ASGGGASVAA
    50   50 A R  E     -FG  35  59B  32 1216   94  YAAAVVVRLYS YYENTAYRRYTYTFYYEVFV  NNFRFQRWVVQYN  S VGSTAI E TSYFGSAsYR
    51   51 A I  E     -FG  34  58B   0 1207   17  IIIIIIIIIII IFIIISIIIIIIIIIIIIII  IIIIIIIIIIIII  I IIIIII I IIIIMIIiII
    52   52 A D     >  -     0   0   26 1212   86  SNNNSSSNSSS SNNKTRDDRSSSSRSSRWRW  KKRRSRRNSSNTN  S WSYSSW R SSSYNSNSST
    53   53 A P  T  4 S+     0   0    0 1212   83  PTTTYYYTPSS YDHZWNSSSSSSSNSSLSNS  QQSSNNSTYSPRE  S SWYSSY T HSYTNYTNSN
    54   54 A N  T  4 S-     0   0   96 1213   69  SGGGDDDGSAG NASBNKGGKGGGGKGGKDKG  DDKKLKKEEDDSD  R GNSGSD K DSRRGDGGAS
    55   55 A G  T  4 S-     0   0   69 1216   57  GGGGGAGGGSS GLGGGaTTsSGSGaSSsGaG  GGasAnsTGGGGG  S GSGGSG v GSGGGGGGSG
    56   56 A G     <  +     0   0   25  915   61  SGGGNNN.GSS GS.SGy..ySSNSySSy.y.  TTgyYyyGGGGNS  D .G.TSN h SS...GGING
    57   57 A G        -     0   0   43 1195   77  SSSSYYYYSTY SASZSTGGATYIYTMTASTS  EETANGAEKSSTD  Y SSNYYD A QYSS.SSNTS
    58   58 A T  E     -G   51   0B  62 1209   46  TTTTKKKTTII TQTZVTTTTITITTIITTTK  KKTTITTPQTTVE  I TINTTE T KITITTTTIS
    59   59 A K  E     -G   50   0B  89 1212   88  YWWWYYYYYYY NGNBLEIIYYYYYELYHTED  YYEYYYYAHYYYY  Y DGYYFY Y YYNYYYWYYY
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYYYYYYYYY YYYYYYFFYYCYYYYYYYYY  YYYYYYYYYYYYY  Y YYYYYY Y HYYYYYYYYY
    61   61 A N    >>  -     0   0   12 1216   63  ATTTAAAAAAG AAKVASAAAAPAPSAAANSN  VVAAAAAAAAAAV  R NANPTA A TANNNRTPAA
    62   62 A E  G >4 S+     0   0  148 1216   64  EDDDDDDDDND DDTDDAQQDDDDDADEESAP  DDADDEDDDDDDG  D ADPDDD E DDPPPDDDNE
    63   63 A K  G 34 S+     0   0  109 1216   64  SSSSSSSASSA SASSSSSSSTTASSTTSASA  SSSSTSSDSSSSS  S ASSSSS S SSSAASSSSY
    64   64 A F  G X> S+     0   0    5 1216   45  VVVVVVVVVVV VVLVVVLLVVVVVVVVVLVL  VVVVVLVFVVVLV  V FVLVVV V VVLMLVVMVV
    65   65 A K  T << S+     0   0  156 1216   40  KKKKKKKKKKK KKKKKKQQKKKKKKKKKKKK  KKKKTEKKKKKQE  K IKKKKK K KKKKKKKKKK
    66   66 A S  T 34 S+     0   0  108 1216   35  GGGGGGGGGGG GGSGGGGGDGGGGGGGGSGS  GGGDGGDGGGGGG  G SGSGGG G GGSSSGGGGG
    67   67 A K  T <4 S+     0   0   33 1214   21  RRRRRRRRRRR RRRRRRQQRRRRRRRRRRRR  RRRRRRRRRRRRR  R RRRRRR R RRRRRRRQRR
    68   68 A A  E  <  -C   83   0A   2 1216   69  FFFFFFFFFFF FFVFFFFFFFFFFFFFFLFL  FFFFFVFFAFFFF  F LFVFFF F FFVLLFFFFF
    69   69 A T  E     -C   82   0A  58 1216   37  TTTTTTTTTTT TTTTAFTTTTTTTTTTTSTS  TTTTTTTATITTT  T TTTTTT T TTTSSTTTTT
    70   70 A L  E     +C   81   0A   7 1216   27  IIIIIIIIIII IIIIIVIIIIIMIIVIIIII  IIIIIIIFIIIII  I IIIIVI I IIMIIIIIII
    71   71 A T  E     -C   80   0A  57 1213   47  SSSSSSSSSSS SSSSSSTTSSSSSSSSSSST  SSSSSSSSSSSSS  S SSSSSS S SSSTTSSSSS
    72   72 A V  E     -C   79   0A  28 1216   71  RKKKRRRRRRR RKLRRRKKRRRRRRRRRKRR  RRRRRRRLRRRRR  R KRVRKR R RRVRRRKRIR
    73   73 A D  E   > -C   78   0A  69 1216    7  DEEEDDDDDDD DDDDDDDDDDDDDDDDDDDD  DDDDDDDEDDDDD  D DDDDDD D DDDDDDEDDD
    74   74 A K  T > 5S+     0   0  105 1216   62  RNNNNNNNNNN NNTNNTTTDNNNNNNNDNNT  NNDDNDDTNNNNN  N NNTNNN D NNKTPNNTNN
    75   75 A P  T 3 5S+     0   0  122 1215   37  AAAASSSAAAT AASAASSSSPAPASPPSSSS  AASSASSSSNNAA  A SASAAS S SASSSAATAA
    76   76 A S  T 3 5S-     0   0   37 1216   65  KKKKKKKKKKK KKKKQQKKQKKKRQKKKKQK  KRKQKKQANNNRK  K KKKKKK K KKKKKKKKKK
    77   77 A S  T < 5 +     0   0   24 1216   48  NNNNNNNNNNN NDNNKSNNSNNNNSNNSSSS  NNSSNSSTKNNNS  N SNNNSN S NNNSSSNNDN
    78   78 A T  E   < -BC  23  73A   8 1216   64  STTTTTTSMMT SSLSTIMMMTTTTITTSQIQ  SSIMTSMTTKKSS  S QSQTSI N TSQQQSTSTT
    79   79 A A  E     -BC  22  72A   0 1207   67  VLLLLLLLVLL LLFLLLVVLLLLLLLLVVLV  LLALLVLAVLLLL  L VLFLLL V LLFVVLLLLL
    80   80 A Y  E     -BC  21  71A  61 1209   36  SYYYYYYYYYY YYSYYYYYYFYFYYFFYFYY  YYYYYYYYSYYYY  Y FYSYYF Y YYSSSYYYYY
    81   81 A M  E     -BC  20  70A   0 1212    9  LLLLLLLLLLL LLLLLLLLLLLLLLPLLLLL  LLLLLLLLLLLLL  L FLLLLL L LLLLLLLLLL
    82   82 A Q  E     -BC  19  69A  69 1215   43  EQQQEQQQQQQ QQKQQQEEQQQQQQQQQKQI  QQQQQQQQQQQQQ  Q KQKQQQ Q QQNSSQQQQQ
    83   83 A L  E     -BC  18  68A   0 1215   14  MMMMMMMMMMM MMLMLMIIMMMMMMMMMMML  MMMMMVMILMMMM  M VMLMMM M MMLLLMMMMM
    84   84 A S        +     0   0   32 1215   56  SDDDNNNNSSS NNSNNNKKNTSTSNTTNNNS  NNNNSTNNSNNNN  N NNSSNN N NNTSSDDNSN
    85   85 A S  S    S-     0   0   89 1216   25  SSSSSSSSSSS SSSSIASSNSSSSTSSNSTS  SSSNSSNNGNNSS  S SSSSSS S SSSSSSSSSS
    86   86 A L        +     0   0    2 1216   15  LLLLLLLLLLL LLVLLLLLLLLLLLLILLLL  LLLLLFLLLLLLL  L LLVLLL L LLVVVLLLLL
    87   87 A T    >   -     0   0   61 1215   68  RRRRRRRRRRR RRTRRRKKKRRRRRRRRQRT  RRKKRRKKSQQRR  R QRTRRR R RRTTTRRRRK
    88   88 A S  G >  S+     0   0   72 1216   59  RAAATAAAAAT AAAVPAAATSSSSASSATAV  AATTSPTNTTTAA  V PAPSAI V AAATSSAVAV
    89   89 A E  G 3  S+     0   0  107 1216   21  EEEEEEEEEEE EEAEEEEEEEDEEEEEEDEE  EEEEEEEEEEEEE  D AEAAEA E EEAEEEEEEE
    90   90 A D  G <  S+     0   0    7 1216    3  DDDDDDDDDDD DDDDDDDDDDDDDDDDDDDD  DDDDDDDDDDDDD  D DDDDDD D DDDDDDDDDD
    91   91 A S    <   +     0   0   31 1216   34  TTTTTTTSTTT TTTTTTTTTTTTTSTTTTST  TTTTTTTTTTTTT  T TTTTTT T TTTTTTTTTT
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAAAAAAAA AAAAAAAAAAAAAAAAGAAA  AAAAAAAAGAAAA  A AAAAAA G AAAAAAAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48  MVVVLVVVVVV VVVLFIVVMMMILTIMIMTT  IIVMLIMTVVVVV  V ILVMVV I VVVVVTVVVM
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYYYYYYYYY YYYYYYYYYYYYYYYYYYYY  YYYYYYYYYYYYY  Y YYYYYY Y YYYYYYYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3  YYYYYYYYYYY YYYYYYYYYYYYYYYFYYYY  YYYYYYYFYYYYY  Y YYYYYY Y FYYYYYYYYY
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCC  C CCCCCC C CCCCCCCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAAAAAAAAA AAAAAAAAVAAAAAAATAAA  AATVATVAATAAA  A AAAVAA T AAAAATAMAA
    98   98 A R  E     -E   34   0B  13 1196   38  RKKKKKKRRRR GPRRKRKKRRRRRRRRRRRR  TTRRRRKGRRSRR  R RKRRKR M KRRRRTKRRT
    99   99 A M  E     -EI  33 107B   5 1101   82  EDDDDDDDNDD HWGGGDTEHQQSQVSREQYV  DDDRHSEYDDQQY  D ADRRKE A DENDADDDDD
   100  100 A W  E >   -E   32   0B  89 1101   89  FTtTsssttTt tQlWyVDYYeKtiLGGgAGg  TTqGkRgRfGQnh  S grvegI Y pRPsyTtttt
   101  101 A Y  T 3  S+     0   0  112  572   91  ...Hlll.y.. h.g..Y...........YTt  ..v..P.....pg  . yl..y. . yY.yy.qqf.
   102  102 A Y  T 3  S-     0   0  133  629   92  ...PYYY.P.. I.G..Y.N.........YYS  ..C..Y...T.WI  . NW..K. . RDYAL.PSH.
   103  103 A G  S <  S+     0   0   38  705   79  ...Wfff.e.. l.w..GYY.........gYY  ..y..Y...yyYy  c yF..GY . YFyYY.wSP.
   104  104 A T        -     0   0   32  784   66  lqggwwwdg.. s.dgwy..Gge...de.yGP  ppfg.gg.pagPd  g gggggg . ...GCSppGg
   105  105 A Y        +     0   0   81  679   93  dqLngggal.g a.y.ny..YadtdIhyyW..  ssndlny.n.wSE  c ..heds . AWy.H.aw.g
   106  106 A Y        -     0   0   32  842   66  ATsNYYYSl.S R.y.WWYYwWAyAryyyY.y  SSWyyYYyy.nFF  y ..TGWT Y YsgcHfSY.N
   107  107 A F  E     +I   99   0B   0  885   48  F.lFFFF.eAL LFmgFFFFmFMmMmlmmFMm  ..FmmFFglFfFV  f FlFFL. E GmfiIy.F.F
   108  108 A D  E     +     0   0B  25  997   46  D.PSDDD.DSR SEDDDDDDDADDDDDDDDGD  DDDDDDDADDDDD  S ALDAG. A DDDDDMPDNR
   109  109 A Y  E     -J  168   0C 108 1059   61  IFFFHYPYMYT PYVYSVYYYYYYYYYYYVYY  YYPYYYYYVYYYL  P YNYYNN Y YVYYYLFLLF
   110  110 A W  E     -I   97   0B  23 1092    2  WWWWWWWWWWW WWWWWWWWWWWWWWWWWWWW  WWWWWWWWWWWWW  W WWWWWW W WWWWWWWWWW
   111  111 A G        -     0   0    3 1067   15  GGGGGGGGAGC VGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGG  G GGGGGG G GGGGGSGG G
   112  112 A Q        -     0   0  141 1047   41  QQQQQQQP QQ QQQQQAKKQQQQQQQQQAQL  QQQQQQQQQAAQQ  Q QQQQQQ Q RKQPP QP  
   113  113 A G        -     0   0   20 1013   12  GGGGGGGG  G  GGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGG  G GGGGGG G GGGGG GG  
   114  114 A T  E     - H   0  94B   2  996   31  TAAATTTG  T  TTTTTTTTTTTTTTTTTTT  TTTTTVTTTTTIV  T TTTTTT T TTTLL AT  
   115  115 A T  E     - H   0  93B  60  979   76  MLLLLLLP     LTLLTKKSLSSSSSSSTSL  LLLSSMTLAMMLL  L LLLVLL L LTLLL LP  
   116  116 A L  E     -dH  10  92B   1  972   19  VVVVVVVS     VVVVVVVVVVVVVVVVVVV  VVVVVVIVVVVVV  V VVVVVV V VVVVV VI  
   117  117 A T  E     -d   11   0B  57  953   21  TTTTTTTC     TTTTTTTTTTITTATTTTT  TTTTTTTTITTTT  T TTTTTT T TTTTT TT  
   118  118 A V  E     +d   12   0B   4  935    8  VVVVVVVV     VVVVVVVVVVVVVVVVVVV  VVVVVVVVVVVVV  V VVVVVV V VVVVV VI  
   119  119 A S              0   0   64  917   10  SSSSSSSS     SSSSSSSSSSSSSSSSSSS  SSSSSSSSSTTSS  S SSSSSS S SSSSS SS  
   120  120 A S              0   0  122  885   21  SSSSSSST     SSTSSSSSASSSSSSSSSS  SSSSSSSASSSSS  S ASSASS A SSSSS SS  
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32             Q                                                          
   123    2 B A        -     0   0   19  713   70             A                                                          
   124    3 B V        -     0   0   84  765   49             V                    MM              M                     
   125    4 B V  E     -Q  145   0D  10  820   26             L                    LL              L                     
   126    5 B T  E     +Q  144   0D  69  829   11             T                    TT              T                     
   127    6 B Q  E     -Q  143   0D  18  832    2             Q                    QQ              Q        Q            
   128    7 B E        -     0   0   59  833   63             P                    PP              P        D            
   129    8 B S  S    S+     0   0  101  841   38             S                    HH              H        P S          
   130    9 B A  E     -k  226   0C  59  842   50             S                    SS              S        V S          
   131   10 B L  E     -k  227   0C  57  847   76             V                    VV              V L      V L          
   132   11 B T  E     +k  228   0C  84  848   77             S                    SS             SS S      S S          
   133   12 B T  E     -k  229   0C  18  848   68             G                    EE             AE A      V A          
   134   13 B S    >   -     0   0   55  849   70             S                    SS             AS S      A S          
   135   14 B P  T 3  S+     0   0   61  848   65             L                    PP             PP P      L L          
   136   15 B G  T 3  S+     0   0   46  850    7             G                    GG             GG G      G G          
   137   16 B E    <   -     0   0  108  850   56             Q                    KK             QK E      Q D          
   138   17 B T  E     - R   0 199D  88  850   66             R                    TT             KT K      T R          
   139   18 B V  E     - R   0 198D  14  850   33             V                    VV             VV V      V V          
   140   19 B T  E     - R   0 197D  53  849   41             S                    IT             TT T      N T          
   141   20 B L  E     - R   0 196D   0  849   25             I                    II             II M      I I          
   142   21 B T  E     - R   0 195D  22  849   52             T                    SS             SS T      T S          
   143   22 B b  E     -QR 127 194D   0  850    2             C                    CC             CC C      C C          
   144   23 B R  E     -Q  126   0D 133  850   77             S                    TT             ST R      L R          
   145   24 B S  E >   -QS 125 148D  11  850   68             G                    RG             GG A      G A          
   146   25 B S  T 3  S+     0   0   81  850   27             S                    SN             SS S      D S          
   147   26 B T  T 3  S-     0   0   87  850   71             S                    DS             SS S      S Q          
   148   27 B G  B <  S+S  145   0D  39  850   55             S                    GG             SG S      L D          
   149   28 B A        -     0   0   40  390   77             N                    ..             .. .      . .          
   150   29 B V        -     0   0    3  620   45             V                    TS             NS .      . .          
   151   30 B T    >   -     0   0   56  541   72             G                    II             II .      . .          
   152   31 B T  G >  S+     0   0   94  694   78             R                    AA             GA .      H I          
   153   32 B S  G 3  S+     0   0   84  802   62             G                    GS             KT V      K S          
   154   33 B N  G <  S-     0   0   13  673   73             N                    YN             NN S      Y N          
   155   34 B Y    <   -     0   0   98  781   50             Y                    YY             YY Y      Y Y          
   156   35 B A        -     0   0    0  817   59             V                    VV             VV M      A L          
   157   36 B N  E     -L  212   0C   0  827   79             N                    QQ             SQ H      S N          
   158   37 B W  E     -LM 211 171C   0  849    0             W                    WW             WW W      W W          
   159   38 B V  E     -LM 210 169C   0  849   25             F                    YY             YY Y      Y Y          
   160   39 B Q  E     -LM 209 168C  10  849   10             Q                    QQ             QQ Q      Q Q          
   161   40 B E  E     -LM 208 167C  20  849    8             Q                    QQ             QL Q      Q Q          
   162   41 B K  E  >  - M   0 166C  68  849   50             I                    RR             VR K      K K          
   163   42 B P  T  4 S+     0   0   98  843   23             P                    PR             PP P      P P          
   164   43 B D  T  4 S-     0   0  148  846   16             G                    GV             GG G      G D          
   165   44 B H  T  4 S+     0   0   90  845   66             S                    RS             TS S      Q G          
   166   45 B L  E  <  - M   0 162C  92  846   57             A                    AA             AA S      A T          
   167   46 B F  E     + M   0 161C   9  847   19             P                    PP             PP P      P V          
   168   47 B T  E     -JM 109 160C  56  843   61             R                    TT             QT K      L K          
   169   48 B G  E     + M   0 159C   1  848   64             T                    TI             LT P      L L          
   170   49 B L  E     +     0   0C   4  848   24             L                    VV             LV W      V L          
   171   50 B I  E     +NM 177 158C   0  848   19             I                    II             II I      I I          
   172   51 B G  E  >  +N  176   0C   0  849   33             Y                    FY             HY Y      H Y          
   173   52 B G  T  4 S-     0   0    9  848   87             G                    EE             DE A      G Y          
   174   53 B T  T  4 S+     0   0    9  849   68             A                    DD             TD T      T T          
   175   54 B N  T  4 S+     0   0  102  841   49             T                    TN             DN S      S S          
   176   55 B N  E  <  -N  172   0C  77  849   69             S                    QQ             KQ N      N R          
   177   56 B R  E     -N  171   0C 113  850   66             R                    RR             RR L      R L          
   178   57 B A    >   -     0   0    1  849   73             A                    PP             PP A      P H          
   179   58 B P  T 3  S+     0   0   97  849   39             S                    SL             SS S      S S          
   180   59 B G  T 3  S+     0   0   83  850   18             G                    GG             GG G      G G          
   181   60 B V  S <  S-     0   0   13  848   23             V                    VV             IV V      I V          
   182   61 B P    >   -     0   0   57  850    9             P                    PP             PP P      P P          
   183   62 B A  T 3  S+     0   0   77  850   59             D                    DD             DD A      E S          
   184   63 B R  T 3  S+     0   0   58  850    5             R                    RR             RR R      R R          
   185   64 B F  E <   +T  198   0D   4  850    1             F                    FF             FF F      F F          
   186   65 B S  E     -T  197   0D  51  849   17             S                    SS             SS S      S S          
   187   66 B G  E     +T  196   0D   9  850    4             G                    GG             GG G      G G          
   188   67 B S  E     -T  195   0D  41  850    7             S                    ss             Ss S      S S          
   189   68 B L  E     -T  194   0D  59  835   79             R                    rs             Qs G      R G          
   190   69 B I  E >   -T  193   0D  86  842   31             S                    SS             SS S      S S          
   191   70 B G  T 3  S-     0   0   67  850   18             G                    SS             GS G      G G          
   192   71 B N  T 3  S+     0   0  105  828   57             N                    NN             TN T      N T          
   193   72 B K  E <  S- T   0 190D  68  833   67             T                    SS             SS S      T D          
   194   73 B A  E     -RT 143 189D   0  838   81             A                    AA             AA Y      A Y          
   195   74 B A  E     -RT 142 188D   0  849   57             T                    SS             TS S      S S          
   196   75 B L  E     -RT 141 187D   0  850    2             L                    LL             LL L      L L          
   197   76 B T  E     -RT 140 186D  19  850   33             T                    TT             GT T      T T          
   198   77 B I  E     -RT 139 185D   0  849    5             I                    II             II I      I I          
   199   78 B T  E    S+R  138   0D  78  850   46             S                    SS             TS S      T S          
   200   79 B G  S    S-     0   0   15  850   57             S                    GG             GG R      G N          
   201   80 B A        -     0   0    0  849   51             L                    LL             LL V      A L          
   202   81 B Q    >   -     0   0   80  849   32             Q                    QK             QK E      Q E          
   203   82 B T  G >  S+     0   0   84  850   59             A                    TT             TT A      A Q          
   204   83 B E  G 3  S+     0   0   99  850   17             E                    EE             GE E      E E          
   205   84 B D  G <   +     0   0    1  850    2             D                    DD             DD D      D D          
   206   85 B E    <   +     0   0   71  849   74             E                    EE             EE A      E I          
   207   86 B A  E    S- O   0 227C   3  850   14             A                    AA             AA A      A A          
   208   87 B I  E     -LO 161 226C  55  850   71             D                    DD             DD T      D T          
   209   88 B Y  E     -LO 160 225C   0  850    0             Y                    YY             YY Y      Y Y          
   210   89 B F  E     -L  159   0C   5  848    8             F                    YY             YY Y      Y F          
   211   90 B b  E     -L  158   0C   0  849    1             C                    CC             CC C      C C          
   212   91 B A  E     -LP 157 221C   0  848   73             A                    QQ             GQ Q      D Q          
   213   92 B L  E     - P   0 220C   0  845   83             A                    SS             TS Q      S Q          
   214   93 B W  E     + P   0 219C  21  834   71             Y                    YF             WY W      W G          
   215   94 B Y  E >  S- P   0 218C  33  829   88             D                    DD             DD S      D N          
   216   95 B S  T 3  S-     0   0  106  829   66             S                    RN             TS S      N T          
   217   96 B N  T 3  S+     0   0  105  824   81             S                    Dt             ss K      s L          
   218   97 B H  E <   -P  215   0C  39  647   66             .                    Hq             sn y      r P          
   219   98 B L  E     -P  214   0C   1  382   85             .                    WG             vV y      V Y          
   220   99 B V  E     -P  213   0C  12  489   66             .                    VV             VI T      I T          
   221  100 B F  E     -P  212   0C  17  540   30             .                    FF             FF F      F F          
   222  101 B G        -     0   0    1  481   35             .                    GG             GG G      G G          
   223  102 B G        -     0   0   51  513   58             .                    GG             GG G      G G          
   224  103 B G        -     0   0    8  528   33             S                    GG             GG G      G G          
   225  104 B T  E     - O   0 209C   0  550   33             N                    TT             TT T      T T          
   226  105 B K  E     -kO 130 208C  82  547   67             N                    KK             KK K      K K          
   227  106 B L  E     -kO 131 207C   0  546   44             G                    LL             LL L        L          
   228  107 B T  E     -k  132   0C  34  614   65             T                    TT             TT E        E          
   229  108 B V  E     -k  133   0C   3  593   35             V                    VV             VV I        I          
   230  109 B L              0   0  120  399   31             L                    LL             LL                     
   231  110 B G              0   0   62  207   39                                  GG             GG                     
## ALIGNMENTS  841 -  910
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 A E              0   0  185  771   30    EEQEEEEQEQ                 EE     QEEQQDDEEEEEQQQ QQDEQ     Q  DDQQE
     2    2 A V        +     0   0   18  834   19    VVVVVVVVVV                 EV  VVVVVVVVVVVVAQVVEE VVVVV     V  VVVVV
     3    3 A Q  E     -A   25   0A  90  836   34    QQQKKKKQKQ                 NK  QQQKKQQQQQQKQQKQQQ HQQQQ     Q  QQQQQ
     4    4 A L  E     -A   24   0A  13  881    3  L LLLLLLLLLL                 LL  LLLLLLLLLLLLVLLLLL LLLLL     L  LLLLL
     5    5 A Q  E     -A   23   0A 107  882   70  T VVVVVVEKEQ                 VV  VVVLHQVMAALEVVEKVM VVQVQ L   Q  VVVVV
     6    6 A Q  E     -A   22   0A  14  887   31  Q EEQEEEEEEE                 EE  EEEEEEEEQQEEEQEEEE EEEEQ E   E  EEQQE
     7    7 A S        -     0   0   33  892   13  S SSSSSSSSSS                 SS  SSSSSSSSSSSSSSASSS SSSSS S   S  SSSSS
     8    8 A G        -     0   0   52  907   11  E GGGGGGGGGG                 GG  GGGGGGGGEEGGGAGGGG GGGGG G   G  GGGGG
     9    9 A A        -     0   0   80 1179   51  P GGAGGGGPGPPP PPPGG PPPP    GG  GGGGGPGPPSGGGGGPGG GGPGG G   P  RGGGG
    10   10 A E  E     -d  116   0B  68 1189   46  V GGEGGGGGGGGG GSGDG GDSG    GG  GGGGGGGGVVGGGGGGGG GGGGG G   C  DDGGG
    11   11 A L  E     +d  117   0B 130 1195   22  V LLVLLLLLLLLLLLLLLLLLLLL    LL  LVVLFLVLVVLLLLLLLL VVLVL V   L  VLVVL
    12   12 A V  E     -d  118   0B  28 1197   47  K VVKVVVVVVLVVVVVVVVVVVVV    VV  VVVVVVVVIIVVVVVVVV VVVVV V   V  RKVVV
    13   13 A K    >   -     0   0  145 1201   50  R QQKQQQQAQKQQQAKQKQAQKKA    QQ  KQQQQKQQKKQQQQQATT QQKQQ Q   K  QQQPQ
    14   14 A P  T 3  S+     0   0   70 1203    8  P PPPPPPPPPPPPPPPPPPPPPPP    PP  PPPPPPPPPPPPPPPPLL PPPPA P   P  PPPPP
    15   15 A G  T 3  S+     0   0   59 1209   28  G GGGGGGGSGSSSSSSSGKSSSSS    GG  GGGKKSGSGGGGGGGSGG GGSGG G   S  GGGGG
    16   16 A A    <   -     0   0   36 1213   63  E GGSGGGGQMEQQQQQQGGQQQQQ    GG  GRRGGQREGGGGGGGQGG KRQRG K   Q  GGRRG
    17   17 A S        -     0   0   66 1210   29  S SSSSSSSSSTSSSSTSSSSSSTS    SS  PSSSSSSTSSSSSSSSSS SSTSS S   T  SSSSS
    18   18 A V  E     - B   0  83A  10 1213   32  H LLVLLLMLVLLLLLLLLLLLLLL    LL  LLLLLLLLHHLMLLMLLL LLVLL L   L  LLLLL
    19   19 A K  E     - B   0  82A 119 1211   53  T RRRRRRKSKSSSSSSSKKSSSSS    RR  RRRKKSRSKKRKRRKSKK RRSRR R   S  HSRRR
    20   20 A L  E     - B   0  81A   0 1214   21  L LLVLLLLILLIIIILILLIILLI    LL  LLLLLLLLLLLLLLLILL LLLLL L   L  LLLLL
    21   21 A S  E     - B   0  80A  31 1215   35  T SSTSSSSTSTTTTTTTSSTTTTT    SS  SSSSSTSISSSSSSSTSS SSTSS S   T  SSSSS
    22   22 A a  E     -AB   6  79A   0 1216    0  C CCCCCCCCCCCCCCCCCCCCCCC    CC  CCRCCCCCCCCCCCCCCC CCCCC C   C  CCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70  S AAKAAAVTAATTTTSTAATTTST    VV  AAAAASTTTTAVASATKK EVTAV A   T  KKVAA
    24   24 A A  E     +A    4   0A   2 1216   49  A AATTTTAVTVVVVVVVAAVVVVI    GG  AAAAAVAVAAAAAAAVAA AAVAA A   V  AAAAA
    25   25 A S  E     +A    3   0A  49 1216   12  S SSSSSSSSSSSSSSTSSSSSTTS    SS  SSSSSTSSSSSSSSSSSS SSTSS S   S  SSSSS
    26   26 A G  S    S+     0   0   56 1215    3  G GGGGGGGGGGGGGGGGGGGGGGG    GG  GGGGGGGGGGGGGGGGGG GQGGG G   G  GGGGG
    27   27 A Y  S    S-     0   0   39 1216   33  F FFGFFFFFFGFFFFDFFFFFYDF    FF  FFFFFYFFFFFFFFFFII FFIFR F   F  FLFFF
    28   28 A T    >   -     0   0   90 1216   52  T TTTTTTTSTSSSSSSSTTSSSSS    TT  TPTTTSTSTTTTPTTPDD TTSTT T   S  TTTTT
    29   29 A F  G >  S+     0   0   13 1216   27  F FFFFFLFLFILLLLILFFLLIIL    FF  FFFFFIFLFFFFFFFLFF FFIFF F   L  FSFFF
    30   30 A T  G 3  S+     0   0   40 1216   55  S SSSSSSSTSSTTTTTTSNTTTTT    SN  SNSNNTKTSSRSSESTSS SSTSS R   T  SSSSS
    31   31 A S  G <  S+     0   0   23 1216   57  D SDGDDDNGDgSNSSsSrTSSSSS    sT  STINAsNStDNnSNNSHH TsTHg N   s  SYTTS
    32   32 A Y  E <  S-E  100   0B  40 1139   28  Y YYYFFFYYYyYYYYyY.YYYgGY    yY  YYYYYyYY.YY.FHYHYY Y.gYy Y   .  YYYYY
    33   33 A W  E     -E   99   0B  40 1148   92  G SYTYYYWGWGGGGG.GgAGGsYG    .N  SGGAARANwYAwWAWGGG GgrPG G   g  SYAGW
    34   34 A M  E     -EF  98  51B   0 1206   49  M MMIMMMMVMWVVVVWVMMVVWWV    IM  MMMMMWMVMMMMMMMVII MMWMM M   V  MMMMM
    35   35 A H  E     -EF  97  50B   0 1212   72  H NESEEENNEGHHHHNHSNHHHNH    NI  NHHNNNHHNNNNTHNSSS SHSHG H   N  HNHHD
    36   36 A W  E     -EF  96  49B   0 1216    0  W WWWWWWWWWWWWWWWWWWWWWWW    WW  WWWWWWWWWLWWWWWWWW WWWWW W   W  WWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17  V VVVVVVVVVIVVVVIVVVVVIIV    VV  VVVVVIVVVVVVVVVVVV VVIVF V   V  VVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22  R RRRRRRRRRRRRRRRRRRRRRRR    RR  RRRRRRRRRRRRRRRRRR RRRRR R   R  RRRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5  Q QQQQQQQQQQQQQQKQQQQQQKQ    QQ  QQQQQKQQQQQQQQQQQQ QQQQQ Q   Q  QQQQQ
    40   40 A R    >   -     0   0   35 1216   71  V AAAPPTSPAPSSPPFPTAPPFFP    AV  AAAAAFAPAAASAVSPAA AAFAV A   A  TAAAA
    41   41 A P  T 3  S+     0   0  130 1215   15  P PPPPPPPPPPPPPPPPPPPPPPP    PP  PPPPPPPPPPPPPPPPPP PPPPP P   P  PPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22  G GGGGGGEGGGGGGGGGDGGGGGG    GG  GGGGGGAGGGGEGGEGGG GGGGG G   G  GGGGG
    43   43 A R  S <  S-     0   0  156 1216   43  K KKRKKKKKKKKKKKNKKKKKNNK    KK  KKKKKNKKKKKKKKKKKK KKNKK K   K  KKRKK
    44   44 A G        -     0   0   16 1215   36  G GGGRRRGGGGGGGGKGKGGGKKG    GG  GGGGGKGGGGGGGRGGGG GGKGE G   S  GGGGG
    45   45 A L  E     -F   39   0B   8 1215   10  L LLLLLLLLLLLLLLLLLLLLLLL    LL  LLLLLLLLLLLLLLLLLL LLLLR L   L  LLLLL
    46   46 A E  E     -F   38   0B  34 1216    6  E EEEEEEEEEEEEEEEEEEEEEEE    EE  EEEEEEEEQQEEEEEEEE DEEQE E   E  EEEEE
    47   47 A W  E     -F   37   0B   3 1216   10  W WWWWWWWWWWWWWWYWWWWWWYW    WG  WWWWWWWWWWWWWWWWWW WWWWF W   W  WWWWW
    48   48 A I  E     -     0   0B   0 1215   31  I VVVIIIVLVILLLLMLVVLLMML    LL  VVVVVMVMVVVVVVVLII VVIVV V   V  VVVVL
    49   49 A G  E     -FG  36  60B   0 1216   35  A SGGAAAAGAGGGGGGGAAGGGGV    AA  SAAAAGAGSSSAASAGAA AGGAA A   G  AAAAC
    50   50 A R  E     -FG  35  59B  32 1216   94  Y YFSAAAETESVVVVYVTRVVYYV    TY  SGVRRYTVYRGqSGeVYY LVYFA G   G  LRVVR
    51   51 A I  E     -FG  34  58B   0 1207   17  I IIPSSSIIIIIMIIIIIIIIIII    II  ITMIIIIMIIIlIIlIII IVIII I   I  IVIIM
    52   52 A D     >  -     0   0   26 1212   86  Y RRARRRRWRYWWWWSWSRWWHSW    SG  STSRRNSWSSSRNDRWYY SSYSR S   W  YHSSN
    53   53 A P  T  4 S+     0   0    0 1212   83  S YNKNNNLGNPSSSAYSSSASYYS    TY  SYYSSSYSSDSSKWSGPP YFYYW S   S  SSYYP
    54   54 A N  T  4 S-     0   0   96 1213   69  S DKWKKKKNKTGGGGSGGKGGSSD    GT  SDDKKADGDGSDDNNDNN DDSDS D   D  DNDDD
    55   55 A G  T  4 S-     0   0   69 1216   57  G GaTaavsGaGGGGGGGGsGGGGG    GG  SGGtsGGGGGGNGGNGYY GGGGG G   G  GGGGG
    56   56 A G     <  +     0   0   25  915   61  S GgDyyyy.yG......Sy.....    GV  SRGyy.R.GGVYRGY.GG SS.TV R   .  SGNNS
    57   57 A G        -     0   0   43 1195   77  S STPTTTASVNSSSSSSYASSSSS    DI  YINAESNNSSNADDANSS TKTNT K   S  SSYYT
    58   58 A T  E     -G   51   0B  62 1209   46  Q TAFTTTTTATTTTTTTTTTTTTT    TT  IKETTTITTTTTSATTVV QTIIT K   T  TTKKT
    59   59 A K  E     -G   50   0B  89 1212   88  Y YEQEEEHDYYDDDNYDYYNDNYT    SD  YDYYYNQDYVYHYGHKDD YYTEY K   D  YNYYH
    60   60 A Y  E     -G   49   0B  46 1215    9  Y YYGYYYYYYYYYYYYYYYYYYYY    YY  YYYYYYYYYYYYYYYYYY YYYHY Y   Y  YYYYY
    61   61 A N    >>  -     0   0   12 1216   63  S AAVSSSANGNNNNNNNPANNNNN    AA  AAAAANANAAAAVAAHAA AANAV V   K  AAAAA
    62   62 A E  G >4 S+     0   0  148 1216   64  E DAYAAAESKPAAASPADDSAPPS    DD  DDDDDPDSDDDEEDESSS GDPED D   P  EDDDN
    63   63 A K  G 34 S+     0   0  109 1216   64  S SSISSSSTSSAAAASATSAASSA    SS  SSSSSSSASSSSSSSAWW SSSSS S   A  SSSSS
    64   64 A F  G X> S+     0   0    5 1216   45  V VVKVVVVLLLFFFLLFVVLFLLL    VV  VVVVVLVLVVVVVVVLVV VALVV V   L  VVVVV
    65   65 A K  T << S+     0   0  156 1216   40  K KKWKKKKKKKIIIMKIKKMIKKK    KK  KKKKKKKKRKKKKKKINN KKTRK K   K  KKKRK
    66   66 A S  T 34 S+     0   0  108 1216   35  G GGEGGGGSGSSSSSGSGDSSSSS    GG  GGGDDSGSGGGGGGGSGG GGSGG G   S  SGGGG
    67   67 A K  T <4 S+     0   0   33 1214   21  R RRRRRRRRRRRRRRRRRRRRRRR    RR  RRRRRRRRRRRRRRRRRR RRRRR R   R  RRRRR
    68   68 A A  E  <  -C   83   0A   2 1216   69  F FFVFFFFLFALLLLILFFLLIIL    FF  FFFFFICLFFFFFFFLFF FFTFF F   L  FFFFF
    69   69 A T  E     -C   82   0A  58 1216   37  I TTTIIITTTTSSSSSSTTSSSSS    TT  TTITTSTSTTTTTTTSTT TTTTT F   S  TTSTT
    70   70 A L  E     +C   81   0A   7 1216   27  I IIVVVVIILIIIIIIIIIIIIII    II  IIIIIIFIIIIIIIIIII IIIII I   I  IIIII
    71   71 A T  E     -C   80   0A  57 1213   47  S SSSSSSSTSSSSSSTSSSSSTTS    SS  SSSSSTSSSSSSSSSSSS SSTSS S   T  SSSSS
    72   72 A V  E     -C   79   0A  28 1216   71  R RRLRRRRKRTKKKKRKRRKKRRK    RR  RRRRRRRRRRGRRRRKLL RRRRR R   R  RWRRR
    73   73 A D  E   > -C   78   0A  69 1216    7  D DDKDDDDDDDDDDDDDDDDDDDD    DD  DDDDDDDDDDDDDDDDDD DDDDD D   D  DDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62  N NDPTTTDNDTNNNNTNNDNNTTN    NN  NNNDDTNTNNIDNNDNNN NNTNN N   T  NKNNN
    75   75 A P  T 3 5S+     0   0  122 1215   37  N ASSSSSSSSSSSSSSSASSSSSS    SS  ASSSSSSSNNSSASSSAA SSSSA S   S  AASSA
    76   76 A S  T 3 5S-     0   0   37 1216   65  R KKFQQQKKKKKKKKKKKQKKKKK    QE  KKKQQKQKNNTKEKKKQQ KKKKK K   R  NSNKK
    77   77 A S  T < 5 +     0   0   24 1216   48  A NNNSSSSSSNSSSSNSNSSSNNS    NN  NNNSYNDNNNNSTKSSNN NNNNS N   S  SSNNN
    78   78 A T  E   < -BC  23  73A   8 1216   64  Q SSQIIISQIQQQQQQQTMQQQQQ    TT  STTMMQTQKKTRSSSQTT TTQIT T   Q  QLTTM
    79   79 A A  E     -BC  22  72A   0 1207   67  L LLALLLVVVFVVVVYVLLVVFYV    AA  LLLLVFLVLLLLLLVVVV LLFLV L   V  LLLLL
    80   80 A Y  E     -BC  21  71A  61 1209   36  N YYYYYYYFYSFFFFYFYYFFFYF    YY  YYYYYFYFYYYYYYYFFF YYFFY Y   S  HSHNY
    81   81 A M  E     -BC  20  70A   0 1212    9  L LLMLLLLLLLFFFLLFLLLFLLL    LL  LLLLLLLLLLLLLLLLLL LLLLL L   L  LLLLL
    82   82 A Q  E     -BC  19  69A  69 1215   43  Q QQEQQQQKQKKKKKQKQQKKQQK    QQ  QQQQQQQKQQQQQQQKQQ QQEQQ Q   S  QQEDQ
    83   83 A L  E     -BC  18  68A   0 1215   14  M MMLMMMMMMLMMMMLMMMMMLLM    MM  MMMMMVLMMMMMMMMLMM MMMMM L   L  MMMMM
    84   84 A S        +     0   0   32 1215   56  N NSVNNNNNNNNNNNNNNNNNNNN    NN  NNNNNNNNNNHSGSNNII TTNNN N   S  NNNNN
    85   85 A S  S    S-     0   0   89 1216   25  S SGNAAANSNSSSSSSSSNSSSSS    SS  SSSNNSSSNNSSSSNSSS SSSSS S   S  SSTSS
    86   86 A L        +     0   0    2 1216   15  L LLLLLLLLIVLLLLVLLLLLVVL    LL  LLLLLVLLLLLLLLLLLL LLLLL L   V  LLLLL
    87   87 A T    >   -     0   0   61 1215   68  K RKFRRRRQRTQQQQTQKKQQTTQ    RR  RRRKKTRQQQRRRRRQTT RRTRK R   T  KKRRR
    88   88 A S  G >  S+     0   0   72 1216   59  T ATNAAAATSAAAATTATTTATTT    TT  ALPTSTPSTTAAAPATAA VVAIP A   S  TTTTA
    89   89 A E  G 3  S+     0   0  107 1216   21  E EEEEEEEDEANNDDEDEEDDEED    EE  EEEEEEEEEEDEEDEEAA EDEAE E   E  EEEEE
    90   90 A D  G <  S+     0   0    7 1216    3  D DDDDDDDDDDDDDDDDDDDDDDD    DD  DDDDDDDDDDDDDDDDDD DDDDD D   D  DDDDE
    91   91 A S    <   +     0   0   31 1216   34  S TTGTTTTTTTTTTTTTTTTTTTT    TT  TTTTTTTATTTTTSTTTT TTTTT T   T  TTTTT
    92   92 A A  E    S- H   0 116B  10 1214    5  A AAAAAAAAGAAAAAAAAAAAAAA    AA  AAAAAAATAAAGAAGAAA AAAAG A   A  AAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48  V VVVIIIIRIVIIIMTIMMMITTM    RR  VVMMMTVTVVVIVFITTT VVTVV V   M  LLLLM
    94   94 A Y  E     -EH  38 114B   0 1216    1  Y YYYYYYYYYYYYYYYYYYYYYYY    YY  YYYYYYYYYYYYYYYYYY YYYYY Y   Y  YYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3  Y YYYYYYYYYFYYYYYYYYYYYYY    YY  YYYCYYYYYYYYYFYYFF YYYYY Y   Y  YYYYY
    96   96 A a  E     +E   36   0B   0 1216    1  C CCCCCCCCCCCCCCCCCCCCCCC    CC  CCCCCCCCCCCCCCCCCC CCCCC C   C  CCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24  A ATAAAASASAAAAAAATVAAAAA    AA  AAAVVAAAATATAATAAA AAAAA A   A  AAAAA
    98   98 A R  E     -E   34   0B  13 1196   38  R RRRRRRTSRRRRRRRRRRRRRRR    RR  RKFRRRRRSTRNRRRRRR KTRRV K   K  KTKKR
    99   99 A M  E     -EI  33 107B   5 1101   82  W DHEDDDGVGDNRNDCNPGENWYH    GN  GKSRREPETEAAKDRHDD DGDER D   S  DDDDD
   100  100 A W  E >   -E   32   0B  89 1101   89  I TTwYYAFsYHigrrhrrDGlLmG    RY  vwTGGSvGlGDMftGYrr GGYIp e   Y  rtsst
   101  101 A Y  T 3  S+     0   0  112  572   91  . ...YYY.y.Sr.lygl...l..G    ..  ......s.....d..Yyy NG..v k   .  ..ll.
   102  102 A Y  T 3  S-     0   0  133  629   92  R ...GDY.Y.DY.YYYY...Y..N    ..  ......R.....S..KYY YR..D N   .  ..YY.
   103  103 A G  S <  S+     0   0   38  705   79  l ...bYg.Y.yY.YGYY..YY..Y    .f  ......wY..y.W.YySS Ff.Yd f   .  ..fF.
   104  104 A T        -     0   0   32  784   66  g ..gypy.ggs.g.s..tgg...g    ag  .gsasp.PgGd.sgg.gg dg.gs g   .  kpwd.
   105  105 A Y        +     0   0   81  679   93  . ..vWwW.yn..A.p..w.s.Ry.    sl  ggvyyrdY..w.hdwntt yy.sd y   .  f.ggg
   106  106 A Y        -     0   0   32  842   66  t .ynYYY.fWdyYyyYyY.yyyY.    yy  VPYyyRAYtnY.YwYyRR ayyTG y   .  YWYYR
   107  107 A F  E     +I   99   0B   0  885   48  f .ffFFF.lFfmFmmFmFmgmmFf    im  L..mmFFFffF.FfFmLL imm.F m   F  FEFF.
   108  108 A D  E     +     0   0B  25  997   46  D .KDDDDADVDDDDDDDDDDDDDD    SD  VDDDDAHNDADDDDDDDD DDD.V D   E  LDDDN
   109  109 A Y  E     -J  168   0C 108 1059   61  V VTYVVVYYYFYYYYYYVYYYYYY    SL  FYCYYYIYYYVYLLVYLL YVYNY V   Y  YFPHL
   110  110 A W  E     -I   97   0B  23 1092    2  W RWWWWWWWWWWWWWWWWWWWWWW    WW  GWWWWWWWWWWWWWWWWW WWWWW W   W  WWWWW
   111  111 A G        -     0   0    3 1067   15  G GSGGGGGGGGGGGGGGGGGGGGG    GG  GGGGGGGGGGGGGGGGGG GGGGG G   G  SAGGT
   112  112 A Q        -     0   0  141 1047   41  N T QAAAQQQQQQQQQQAQQQQQQ    RP  QLQQQQQQPQRQRRAQQQ QQQQQ Q   P  LAQQP
   113  113 A G        -     0   0   20 1013   12  G G GGGGGGGGGGGGGGGGGGGGG    GG  GGGGGGGGGGGGGGGGGG GGGGG G   G  NAGGD
   114  114 A T  E     - H   0  94B   2  996   31  T G VTTTTTTLTTTTTTTTTTTTT    VV  TTTTTTTVTTTTTTTTTT TTTTT T   L  VGTTS
   115  115 A T  E     - H   0  93B  60  979   76  K H LTTTLSLRSTSSTSTSTSSTT    EE  LLLSSLMMMMLSQLTSLL LTSLQ T   L  S LLA
   116  116 A L  E     -dH  10  92B   1  972   19  V I VVVVVVVVVLVVLVVVLVVLL    VV  VVVVVVVVVVVVVVVVVV VVVVV V   V  V VVL
   117  117 A T  E     -d   11   0B  57  953   21  T L TTTTTTTTTTTTTTTTTTTTT    TV  TTTTTTTTTTSTTSTTTT TSTTT T   T  T TTT
   118  118 A V  E     +d   12   0B   4  935    8  V T VVVVVVVVVVVVVVVVVVVVV    VV  VVVVVVVVVVVVVVVVII VVVVV V   V  V VV 
   119  119 A S              0   0   64  917   10  S S SSSS SSSSSSSSSSSSSSSS    SS  SSSSSSSSTTSSSSSSSS SSSSS S   S  T SS 
   120  120 A S              0   0  122  885   21  S T SSSS SSSSSSSSSSSSSSSS    SS  SSSSSSSSSSASSSSSSS SSSSS S   S    SS 
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32   E                          Q  QQ                        Q Q   QQ     
   123    2 B A        -     0   0   19  713   70   V                          P  AS                        V S   FS     
   124    3 B V        -     0   0   84  765   49   V                          E  VV                        V VVV VA     
   125    4 B V  E     -Q  145   0D  10  820   26   V                          V  LL                        L LVV LL     
   126    5 B T  E     +Q  144   0D  69  829   11   P                          T  TT                  T     T TTT TT     
   127    6 B Q  E     -Q  143   0D  18  832    2   Q                          Q  QQ                  Q     Q QQQ QQ     
   128    7 B E        -     0   0   59  833   63   G                          L  PP                  P     P PPP SP     
   129    8 B S  S    S+     0   0  101  841   38   P                       SSSP  SP                  S     K PPP NS     
   130    9 B A  E     -k  226   0C  59  842   50   S                       SSSS  SS                  S     S SSS SS     
   131   10 B L  E     -k  227   0C  57  847   76   L                       LLLL  VV                  V     V VVA MV     
   132   11 B T  E     +k  228   0C  84  848   77   T                       SSSS  SS                  S     S SSS SS     
   133   12 B T  E     -k  229   0C  18  848   68   V                       AAAA  GA                  V     T AAG TG     
   134   13 B S    >   -     0   0   55  849   70   I                       SSSS  SA                  S     S AAS ST     
   135   14 B P  T 3  S+     0   0   61  848   65   Q                       LLLL  LP                  P     L PPP LL     
   136   15 B G  T 3  S+     0   0   46  850    7   G                       GGGG  GG                  G     E GGG GG     
   137   16 B E    <   -     0   0  108  850   56   R                       DDHA  QQ                  Q     S QQQ SQ     
   138   17 B T  E     - R   0 199D  88  850   66   T                       RRRT  RK                  T     T KRS TT     
   139   18 B V  E     - R   0 198D  14  850   33   I                       VVVA  VV                  A     V VVV VV     
   140   19 B T  E     - R   0 197D  53  849   41   T                       TTTR  ST                  R     K TTT KT     
   141   20 B L  E     - R   0 196D   0  849   25   L                       IIIL  II                  I     L III LI     
   142   21 B T  E     - R   0 195D  22  849   52   T                       SSTT  TS                  T     S SSS SS     
   143   22 B b  E     -QR 127 194D   0  850    2   R                       CCCC  CC                  C     C CCC CC     
   144   23 B R  E     -Q  126   0D 133  850   77   S                       RRST  SS                  S     K SST KD     
   145   24 B S  E >   -QS 125 148D  11  850   68   S                       AAAL  GG                  G     L GGG RG     
   146   25 B S  T 3  S+     0   0   81  850   27   S                       SSSS  SS                  D     N TST SS     
   147   26 B T  T 3  S-     0   0   87  850   71   A                       QQQR  SS                  L     S SSS TS     
   148   27 B G  B <  S+S  145   0D  39  850   55   G                       DDDA  NS                  L     G SSS GS     
   149   28 B A        -     0   0   40  390   77   A                       ....  NN                  .     . N.D NN     
   150   29 B V        -     0   0    3  620   45   L                       ...V  VI                  .     N INV II     
   151   30 B T    >   -     0   0   56  541   72   I                       ...T  GG                  .     I GIG GG     
   152   31 B T  G >  S+     0   0   94  694   78   T                       IIID  TN                  A     G NGG SS     
   153   32 B S  G 3  S+     0   0   84  802   62   G                       SSSG  GD                  K     S NNY SS     
   154   33 B N  G <  S-     0   0   13  673   73   L                       NNNH  N.                  K     Y .NN .N     
   155   34 B Y    <   -     0   0   98  781   50   S                       YYYY  YY                  Y     Y YYY YY     
   156   35 B A        -     0   0    0  817   59   P                       LLLP  VV                  A     I VVV VI     
   157   36 B N  E     -L  212   0C   0  827   79   H                       NNNH  SS                  R     H SSS YE     
   158   37 B W  E     -LM 211 171C   0  849    0   W                       WWWW  WW                  W     W WWW WW     
   159   38 B V  E     -LM 210 169C   0  849   25   F                       YYYI  FY                  F     Y YYY YY     
   160   39 B Q  E     -LM 209 168C  10  849   10   P                       QQQQ  QQ                  Q     Q QQQ QQ     
   161   40 B E  E     -LM 208 167C  20  849    8   Q                       QQQQ  QQ                  Q     Q QLQ QQ     
   162   41 B K  E  >  - M   0 166C  68  849   50   K                       KKKK  IV                  K     H LLH HF     
   163   42 B P  T  4 S+     0   0   98  843   23   S                       PPPP  PP                  P     E PPP EP     
   164   43 B D  T  4 S-     0   0  148  846   16   G                       DDDG  GG                  G     G GGG GG     
   165   44 B H  T  4 S+     0   0   90  845   66   L                       GGGQ  ST                  Q     R TTK RT     
   166   45 B L  E  <  - M   0 162C  92  846   57   V                       TTTA  AA                  A     S AGA SS     
   167   46 B F  E     + M   0 161C   9  847   19   P                       VVVP  PP                  P     P PPP PP     
   168   47 B T  E     -JM 109 160C  56  843   61   S                       KKKT  RK                  I     T KKK TK     
   169   48 B G  E     + M   0 159C   1  848   64   T                       LLLT  TL                  L     T LLL TL     
   170   49 B L  E     +     0   0C   4  848   24   L                       LLLL  LL                  V     M LLM ML     
   171   50 B I  E     +NM 177 158C   0  848   19   I                       IIII  II                  I     I III II     
   172   51 B G  E  >  +N  176   0C   0  849   33   Y                       YYYY  YY                  F     Y YYY YY     
   173   52 B G  T  4 S-     0   0    9  848   87   R                       YYYN  GD                  K     R DDE DY     
   174   53 B T  T  4 S+     0   0    9  849   68   P                       TTTT  AN                  D     D NNV DT     
   175   54 B N  T  4 S+     0   0  102  841   49   N                       SSSN  TN                  T     D NNS DN     
   176   55 B N  E  <  -N  172   0C  77  849   69   N                       RRRN  SK                  E     K KKK KN     
   177   56 B R  E     -N  171   0C 113  850   66   P                       LLLR  RR                  R     R RRR RR     
   178   57 B A    >   -     0   0    1  849   73   S                       HHHH  AP                  P     P PPP PP     
   179   58 B P  T 3  S+     0   0   97  849   39   S                       SSSS  SS                  S     D SSS DS     
   180   59 B G  T 3  S+     0   0   83  850   18   G                       GGGW  GG                  G     G GGG GG     
   181   60 B V  S <  S-     0   0   13  848   23   V                       VVVT  GI                  I     V IIV VI     
   182   61 B P    >   -     0   0   57  850    9   P                       PPPP  PP                  P     P PPP PP     
   183   62 B A  T 3  S+     0   0   77  850   59   A                       SSSA  DD                  E     D DDD DA     
   184   63 B R  T 3  S+     0   0   58  850    5   C                       RRRR  RR                  R     R RRR RR     
   185   64 B F  E <   +T  198   0D   4  850    1   F                       FFFF  FF                  F     F FFF FF     
   186   65 B S  E     -T  197   0D  51  849   17   F                       SSSS  SS                  S     S SSS SS     
   187   66 B G  E     +T  196   0D   9  850    4   G                       GGGG  GG                  G     G GGG GG     
   188   67 B S  E     -T  195   0D  41  850    7   S                       SSSS  SS                  S     s SSS sS     
   189   68 B L  E     -T  194   0D  59  835   79   L                       GGGI  RK                  S     s KKK sK     
   190   69 B I  E >   -T  193   0D  86  842   31   L                       SSSQ  SS                  S     S SSS SS     
   191   70 B G  T 3  S-     0   0   67  850   18   G                       GGAG  GG                  G     S GGG SG     
   192   71 B N  T 3  S+     0   0  105  828   57   N                       TTTG  NT                  T     N TTT NN     
   193   72 B K  E <  S- T   0 190D  68  833   67   K                       DDDK  TS                  T     S SSS ST     
   194   73 B A  E     -RT 143 189D   0  838   81   G                       YYYA  AA                  V     A AAA AA     
   195   74 B A  E     -RT 142 188D   0  849   57   A                       SSSA  TT                  T     F TTS FS     
   196   75 B L  E     -RT 141 187D   0  850    2   L                       LLLL  LL                  L     L LLL LL     
   197   76 B T  E     -RT 140 186D  19  850   33   T                       TTTT  TG                  T     T GGA TT     
   198   77 B I  E     -RT 139 185D   0  849    5   I                       IIIL  II                  I     I III II     
   199   78 B T  E    S+R  138   0D  78  850   46   P                       SSTS  ST                  S     N TTS NS     
   200   79 B G  S    S-     0   0   15  850   57   E                       NNNG  SG                  G     N GGG NG     
   201   80 B A        -     0   0    0  849   51   V                       LLLA  LL                  A     V LLL VL     
   202   81 B Q    >   -     0   0   80  849   32   Q                       EEQQ  QQ                  Q     Q RQQ QQ     
   203   82 B T  G >  S+     0   0   84  850   59   S                       QQQP  AT                  V     T TTS IA     
   204   83 B E  G 3  S+     0   0   99  850   17   E                       EEEE  EG                  E     E GGE EE     
   205   84 B D  G <   +     0   0    1  850    2   D                       DDDD  DD                  D     D DDD DD     
   206   85 B E    <   +     0   0   71  849   74   E                       IIXE  EE                  E     E EEE EE     
   207   86 B A  E    S- O   0 227C   3  850   14   A                       AAAA  AA                  A     A ALA AA     
   208   87 B I  E     -LO 161 226C  55  850   71   G                       TTTM  DD                  D     I DED ID     
   209   88 B Y  E     -LO 160 225C   0  850    0   Y                       YYYY  YY                  Y     Y YYY YY     
   210   89 B F  E     -L  159   0C   5  848    8   D                       FFXY  FY                  Y     F YYY FY     
   211   90 B b  E     -L  158   0C   0  849    1   C                       CCCC  CC                  C     C CCC CC     
   212   91 B A  E     -LP 157 221C   0  848   73   S                       QQQT  AG                  Y     H AGA QS     
   213   92 B L  E     - P   0 220C   0  845   83   I                       QQQC  ST                  S     S TTA SA     
   214   93 B W  E     + P   0 219C  21  834   71   W                       GGGF  YW                  A     Y WWW YY     
   215   94 B Y  E >  S- P   0 218C  33  829   88   H                       NYNT  DN                  S     D DDD ST     
   216   95 B S  T 3  S-     0   0  106  829   66   N                       SMTA  SN                  D     S STD SG     
   217   96 B N  T 3  S+     0   0  105  824   81   s                       llLt  Ss                  n     S sss gS     
   218   97 B H  E <   -P  215   0C  39  647   66   h                       rrPr  .s                  g     . sag hN     
   219   98 B L  E     -P  214   0C   1  382   85   .                       ..Y.  .w                  R     I vVY d.     
   220   99 B V  E     -P  213   0C  12  489   66   .                       TTTT  .V                  V     I VVV VT     
   221  100 B F  E     -P  212   0C  17  540   30   w                       FFFv  .F                  F     F FFF NF     
   222  101 B G        -     0   0    1  481   35   g                       GGGg  .G                  G     G GGG HH     
   223  102 B G        -     0   0   51  513   58   G                       GGGA  .G                  G     G GGT GS     
   224  103 B G        -     0   0    8  528   33   G                       GGGG  SG                  G     G GGG GG     
   225  104 B T  E     - O   0 209C   0  550   33   T                       TTTG  ST                  T     T TTT ST     
   226  105 B K  E     -kO 130 208C  82  547   67                           KKKE  DK                  K     K KNK K      
   227  106 B L  E     -kO 131 207C   0  546   44                           LLLV  NL                  L     L LLV        
   228  107 B T  E     -k  132   0C  34  614   65                           EEX   TT                  T       TAT        
   229  108 B V  E     -k  133   0C   3  593   35                           III   VV                  V       VVV        
   230  109 B L              0   0  120  399   31                                 LL                  L       LLL        
   231  110 B G              0   0   62  207   39                                  G                          SGG        
## ALIGNMENTS  911 -  980
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 A E              0   0  185  771   30  E EE   E    E E EQEEEEEEE  E   E       E QEE       Q      EEE QQQQ EQ 
     2    2 A V        +     0   0   18  834   19  E EE   V IVIV V VVVVVVVVV VV   V       V VVE       VV     VVE VVVL VV 
     3    3 A Q  E     -A   25   0A  90  836   34  Q QQ   Q ALQQ K QQKKKKKKQ QQ   Q       L QKK       HQ     MKE QQQQ QQ 
     4    4 A L  E     -A   24   0A  13  881    3  L LL   LLLLLL LLLLLLLLLLLLLL   L       L LLL       LL     LLL LLLL LLM
     5    5 A Q  E     -A   23   0A 107  882   70  V VV   VTTTEV VQVVVVVEEEQTVV   Q       V VVV       KV     VEV QQQQ VKL
     6    6 A Q  E     -A   22   0A  14  887   31  E EE   EQQEEE EEEQEEEEEEESEE   E       E QEE       EE     EEE QEEE EEE
     7    7 A S        -     0   0   33  892   13  S SS   SSSSSS SSSSSSSSSSSSSS   S       S SSS       TS     SSS SSSA SSS
     8    8 A G        -     0   0   52  907   11  G GG   GEGGGG GGGGGGGGGGGGGG G G       G GGG       GG     GGG GGGG GGG
     9    9 A A        -     0   0   80 1179   51  G GG   GPVGGG GPGGGGGGGGPSGPPGPPPPPPP  G AGG       GG     GPG PGGP GPP
    10   10 A E  E     -d  116   0B  68 1189   46  G GG   GVEDDG DGGGGGGGGGSEGGGGGGGDGGG  A EGG       GG     GPG GGGR GGG
    11   11 A L  E     +d  117   0B 130 1195   22  L LL   LVVITL LTLVLLLLLLLVLALLLLLLLLL  L VLL       LV     LLL LLLL LLL
    12   12 A V  E     -d  118   0B  28 1197   47  V VV   AKKKKV VVVVVVVVVVVKQVVVVVVVVVV  V RVV       VV     VEV VVVV VVV
    13   13 A K    >   -     0   0  145 1201   50  Q QQ   QRNKKQ KKQQQQQQQQKKQKAQQAQAQAA  Q KQQ       QQ     KEK KQQK QAK
    14   14 A P  T 3  S+     0   0   70 1203    8  P PP   PPPPPP PPPPPPPPPPPPPPPPPPPPPPPP P PPP       PP     PSP PAAP PPP
    15   15 A G  T 3  S+     0   0   59 1209   28  G GG   GGGGGG GSGGGGGGGGSRGGSKSSSSSSSS G GGG       GG     GGG SGGS GSS
    16   16 A A    <   -     0   0   36 1213   63  G GG   GEEEEG GEGRGGGGGGQEGEQGQQQQQQQQ G AGG       RR     GGE QGGE GQE
    17   17 A S        -     0   0   66 1210   29  S SS   SSPSSS SSSSSSSSSSTSSTSSSSSSSSSS S SSS       SS     STS TSST SST
    18   18 A V  E     - B   0  83A  10 1213   32  L LL   LHLLVL LLLLLLLMMMLVLLLLLLLLLLLL L VLL       LL     LVL LLLL LLL
    19   19 A K  E     - B   0  82A 119 1211   53  R RR   RTKMRR RRRRRRRKKKSTRTSKSSSSSSSS R KKR       KR     KKR SRRS RSS
    20   20 A L  E     - B   0  81A   0 1214   21  L LL   LLLLLL LLLLLLLLLLLLLLILIIIIIIII L VLL       LL     LIL LLLL LIL
    21   21 A S  E     - B   0  80A  31 1215   35  S SS   STSSSS STSSSSSSSSTSSSTSTTTTTTTT S SSS       SS     SSS TSSS STT
    22   22 A a  E     -AB   6  79A   0 1216    0  C CC   CCCCCC CCCCCCCCCCCCCCCCCCCCCCCC C CCC       CC     CCC CCCC CCC
    23   23 A K  E     -AB   5  78A 113 1216   70  A AA   ASEKEA VTAAAAAVVVSVETTATTTTTTTT G KVV       VA     AKA AAAT ATT
    24   24 A A  E     +A    4   0A   2 1216   49  A AA   AATAGA AVAATTTAAAVVAIIAVVVIVIVV A AGG       AA     AAA IAAV AIV
    25   25 A S  E     +A    3   0A  49 1216   12  T SS   SSSSSS SSSSSSSSSSTSTSSSSSSSSSSS S SSS       SS     SSS SSSS SSS
    26   26 A G  S    S+     0   0   56 1215    3  G GG   GGGDGG GGGGGGGGGGGGGGGGGGGGGGGG G GGG       GG     GGG GGGG GGG
    27   27 A Y  S    S-     0   0   39 1216   33  F FF   FFYVFF FFFFFFFFFFDLFYFFFFFFFFFF F YYF       FF     FYF DLLG FFY
    28   28 A T    >   -     0   0   90 1216   52  T TT   TTSNTT TETTTTTTTTSSTSSTSSSSSSSS T TIT       TT     TTT STTS TSS
    29   29 A F  G >  S+     0   0   13 1216   27  F FF   FFYFFF FLFFFFFFFFILFVLFLLLLLLLL F FFF       FF     FFF VFFM FLV
    30   30 A T  G 3  S+     0   0   40 1216   55  S SS   SSTNSS SSSSTSSSSSTASTTNTTTTTTTT S TSS       SS     STR SDDS STS
    31   31 A S  G <  S+     0   0   23 1216   57  S SS   dDSSSS sSYRDDDNNNsWSnSTSSSSSSSS S SsS       SR     SYS STTg SSS
    32   32 A Y  E <  S-E  100   0B  40 1139   28  Y YY   yYYYYY .YYYYFFYYYy.FyYYYYYYYYYY Y Y.Y       YY     YSF nYYf YYt
    33   33 A W  E     -E   99   0B  40 1148   92  W NW   .GYHWA gHNTYYYWWW..A.GAGGGGGGGG V GgE       WD     ASN aAAY WGy
    34   34 A M  E     -EF  98  51B   0 1206   49  M MM   MMMMMM MMMIMMMMMMWLMWVMVVVVVVVV M MMI       ML     MIM WMMW MVW
    35   35 A H  E     -EF  97  50B   0 1212   72  H NH   DHHESG SHNHSEENNNNHFDHNHNHHHHHH N NTS       YH     SHN NGGG YHS
    36   36 A W  E     -EF  96  49B   0 1216    0  W WW   WWWWWW WWWWWWWWWWWWWWWWWWWWWWWW W WWW       WW     WWW WWWW WWW
    37   37 A V  E     -EF  95  47B   0 1216   17  V VL   VVIVVV VIVVVVVVVVIIVVVVVVVVVVVV V VVV       IV     VVV IFFI VVI
    38   38 A K  E     -EF  94  46B   7 1216   22  C RR   RRRRRR RRRRRRRRRRRRRRRRRRRRRRRR R RRR       RR     RKR RRRR CRR
    39   39 A Q  E     +EF  93  45B  20 1216    5  Q QQ   QQQQQQ QQQQQQQQQQKQQQQQQQQQQQQQ Q QQQ       QQ     QQQ QQQQ QQQ
    40   40 A R    >   -     0   0   35 1216   71  A AA   AVPHAA DPVAPPSSSSFKAAPASPSPSPPP S VAA       AP     TAA SAAA APH
    41   41 A P  T 3  S+     0   0  130 1215   15  P PP   PPPSPP PPTPPPPPPPPPPPPPPPPPPPPP P PPP       PP     PPP PPPP PPP
    42   42 A G  T 3  S+     0   0   83 1216   22  G GG   GGRGGG GGGGGGGEEEGGGGGGGGGGGGGG E GGG       GG     EGG SGGG GGG
    43   43 A R  S <  S-     0   0  156 1216   43  K KK   KKKKKK EKKKKKKKKKNKKKKKKRKKKKKK K QKK       KK     KKK RKKR KKR
    44   44 A G        -     0   0   16 1215   36  G GG   GGGGGG GGGGARRGGGKGGGGGGVGGGGGG G WGG       GG     RGG GKKG GGG
    45   45 A L  E     -F   39   0B   8 1215   10  L LL   LLLLLL LLLLLLLLLLLLLLLLLLLLLLLL L LLL       LL     LLL LRRL LLL
    46   46 A E  E     -F   38   0B  34 1216    6  E EE   EEEEEE QEEEEEEEEEEEEEEEEEEEEEEE E EEE       EE     EKE EEEE EEE
    47   47 A W  E     -F   37   0B   3 1216   10  W WW   WWWWWW WWWWWWWWWWHWYWWWWWWWWWWW W WWW       WW     WWW WYYW WWW
    48   48 A I  E     -     0   0B   0 1215   31  V VV   VIIIVV VIVVLIIVVVMIVVLVLLLLLLLL V MLL       VV     VMI LVVI VLI
    49   49 A G  E     -FG  36  60B   0 1216   35  S AS   GAGAAS AGSAGAAAAAGGAGVAGAGVGVGG S RAA       SA     AGA GAAG SVG
    50   50 A R  E     -FG  35  59B  32 1216   94  L LL   RYREYT DVAVFAAEEEYREQVRVVVVVVVV S WCV       SV     TWF RAAS SVF
    51   51 A I  E     -FG  34  58B   0 1207   17  I II   IIIVII IIIMISSIIIIIIIIIIIIIIIII I III       II     III TIII III
    52   52 A D     >  -     0   0   26 1212   86  S SS   RYDEHG SAGSRRRRRRSDTDWRWWWWWWWW N NSS       NW     SNN YSSD YWS
    53   53 A P  T  4 S+     0   0    0 1212   83  S NS   NSCNPT STTYNNNLLLYSDWSSSGSSRSAA W TGT       TF     STS YWWY SSN
    54   54 A N  T  4 S-     0   0   96 1213   69  D GD   KSGDTA SGABKKKKKKSGGSDKGDGDGDGG N NGS       DD     GAR RTTR YDN
    55   55 A G  T  4 S-     0   0   69 1216   57  g Gg   aGSGSG GGGGagasssGTGgGsGGGGGGGG G TGG       GG     GTG sGGG GGG
    56   56 A G     <  +     0   0   25  915   61  s .s   ySG.A. ...Bgyyyyy..Gw.y........ E GGV       GS     SGN wII. S..
    57   57 A G        -     0   0   43 1195   77  Y SY   TSSDSS QSDBYTTAEASGSRSASTSSSSSS N KTG       SN     YEE YSSN NSD
    58   58 A T  E     -G   51   0B  62 1209   46  I TI   TQSITT TTQKTTTTTTTTTTTTTTTTTTTT L PTT       TK     TPK NTTT TTP
    59   59 A K  E     -G   50   0B  89 1212   88  Y YY   EYVYYY YAYHTEEHHHYIYYTYDNDTDTNN Y TYY       YY     YTY DYYY YTF
    60   60 A Y  E     -G   49   0B  46 1215    9  Y YY   YYVYYY YIYYEYYYYYYFYYYYYYYYYYYY Y YYY       YY     YYY YYYY YYY
    61   61 A N    >>  -     0   0   12 1216   63  A AA   ASIAPA AAAAYSSAAANAASNANHNNNNNN A TVA       PA     PPG RAAN ANN
    62   62 A E  G >4 S+     0   0  148 1216   64  A NA   AEEPDD DDDDSAAEEEPQDPSDASASASSS D QDD       DD     DDE VDDP DSP
    63   63 A K  G 34 S+     0   0  109 1216   64  S SS   SSKSVS ASSSASSSSSSSAAASAAAAAAAA S GSS       SS     SDS SIIS SAS
    64   64 A F  G X> S+     0   0    5 1216   45  V VV   VVFVVV VLVVVVVVVVLLVVLVFLFLFLLL V FVV       VV     VFV VAAL VLL
    65   65 A K  T << S+     0   0  156 1216   40  K KK   KKQQKK KKKNKKKKKKKQQQKKIIIKMKMM K SKK       KR     KKK KKKK KKK
    66   66 A S  T 34 S+     0   0  108 1216   35  G GG   GGGGGG GNGGGGGGGGSGGSSDSSSSSSSS G GGG       GG     GGG SGGS GSS
    67   67 A K  T <4 S+     0   0   33 1214   21  R RR   RRRRRR RRRRRRRRRRRQRRRRRRRRRRRR R RRR       RR     RRR RRRR RRR
    68   68 A A  E  <  -C   83   0A   2 1216   69  F FF   FFFFFF FVFFFFFFFFIFFALFLLLLLLLL F FFF       FF     FFF IFFV FLF
    69   69 A T  E     -C   82   0A  58 1216   37  T TT   TITATT STTTTIITTTSTTTSTSTSSSSSS T VTT       TT     TVT TTTT TST
    70   70 A L  E     +C   81   0A   7 1216   27  I II   IIIIII IIIIIVVIIIIIILIIIIIIIIII I FVS       II     IFI IIII III
    71   71 A T  E     -C   80   0A  57 1213   47  S SS   SSSSSS STSSSSSSSSTTSSSSSSSSTSSS S SSS       SS     SSS NSSS SSS
    72   72 A V  E     -C   79   0A  28 1216   71  R KR   RRRRRR RKRRRRRRRRRKRAKRKKKKKKKK R LRK       RR     RLR PRRV RKI
    73   73 A D  E   > -C   78   0A  69 1216    7  D DD   DDDDDD DDNNBDDDDDDDDDDDDDDDDDDD D DDD       DD     DED DDDD DDD
    74   74 A K  T > 5S+     0   0  105 1216   62  N NN   DNAVNN NNDDBTTDDDTTNKNDNNNNNNNN N TNN       NN     NSN TNNT NNT
    75   75 A P  T 3 5S+     0   0  122 1215   37  A GA   SNSSSA AGSSSSSSSSSSGSSSSFSSSSSS G SSS       AS     ASA SAAS ASS
    76   76 A S  T 3 5S-     0   0   37 1216   65  K KK   KRSSNK KKKKZQQKKKKKQKKQKKKKKKKK D ALQ       EK     KTD KKKR KKK
    77   77 A S  T < 5 +     0   0   24 1216   48  N NN   NASSNN NKNNGSSSSSNNSNSSSRSSSSSS N SNN       NK     NSN NNNN NSN
    78   78 A T  E   < -BC  23  73A   8 1216   64  T ST   TQTMML TQTTIIISSSQMTQQMQQQQQQQQ T MTT       TM     TTS QTTQ MQQ
    79   79 A A  E     -BC  22  72A   0 1207   67  L LL   LLVLLL LVLLLLLVVVYVVFVLVVVVVVVV L AAA       VL     LAL FLLF LVF
    80   80 A Y  E     -BC  21  71A  61 1209   36  Y YY   YNYYYY YYYYYYYYYYYYYSFYFFFFFFFF Y FWY       YY     YYF SYYS YFT
    81   81 A M  E     -BC  20  70A   0 1212    9  L LL   LLLLLL LLLLLLLLLLLLLLLLFLFLFLLL L LLL       LL     LLL LLLL LLL
    82   82 A Q  E     -BC  19  69A  69 1215   43  Q QQ   QQQQQQ QQNNQQQQQQQEQQKQKKKKKKKK Q QQQ       QQ     QEQ QQQN QKR
    83   83 A L  E     -BC  18  68A   0 1215   14  M MM   MMMMMM MMMMMMMMMMLIMLMMMLMMMMMM M IMM       MM     MIM LMML MVL
    84   84 A S        +     0   0   32 1215   56  S SN   SNNNNN ENNNNNNNNNNKNRNNNTNNNNNN N NNN       NY     SNS NDDR NNY
    85   85 A S  S    S-     0   0   89 1216   25  S SS   SSSNSS DGSSTAANINSSSSSNSSSSSSSS N GSR       SS     SNS SSSS SSS
    86   86 A L        +     0   0    2 1216   15  L LL   LLLLLL LMLLLLLLLLVLLLLLLLLLLLLL L LLV       LL     LLL VLLV LLV
    87   87 A T    >   -     0   0   61 1215   68  R RK   KKTKKR RERRRRRRRRTKKTQKQQQQQQQQ R RRR       RR     RKR TKKT KQT
    88   88 A S  G >  S+     0   0   72 1216   59  A AA   TTVVPA VVAPAAAAAASAAATTATATATTT V STT       SA     SNV PPPA SAS
    89   89 A E  G 3  S+     0   0  107 1216   21  E EE   EEEEEE EKEEQEEEEEEEEADEDDDDDDDD E EEE       EE     EED EEEA EDA
    90   90 A D  G <  S+     0   0    7 1216    3  D DD   DDDDDD DDDDDDDDDDDDDDDDDDDDDDDD D DDD       DD     DDD DDDD DDD
    91   91 A S    <   +     0   0   31 1216   34  T TT   TSTTTT TTTTSTTTTTTTTTTTTTTTTTAT T TTT       TT     TTT TTTT TTT
    92   92 A A  E    S- H   0 116B  10 1214    5  A AA   AAAAAA AAAAAAAGGGAAGAAAAAAAAAAA A IAA       AA     ADA AAAA AAA
    93   93 A V  E     -EH  39 115B  21 1216   48  V VV   VVMTTM VMVVTIIIIITVTTMMITIMIMMM M CRR       TV     MTI VVVV VMK
    94   94 A Y  E     -EH  38 114B   0 1216    1  Y YY   YYYYYY YYYYYYYYYYYYYYYYYYYYYYYY Y TYY       YY     YYY YYYY YYY
    95   95 A Y  E     -E   37   0B   1 1216    3  Y YF   YYYYYY YYYYYYYYYYYYYYYYYYYYYYYY F GYY       YY     YFY YYYF YYY
    96   96 A a  E     +E   36   0B   0 1216    1  C CC   CCCCCC CCCCCCCCCCCWCCCCCCCCCCCC C CCC       CC     CCC CCCC CCC
    97   97 A A  E     -EI  35 110B   0 1215   24  A AA   AAAAAA AAAAAAATTTTTAAAVAAAAAAAA A DAA       AA     AAA AAAA AAA
    98   98 A R  E     -E   34   0B  13 1196   38  R RR   RRRRRR TRRRRRRTTTSSKRRNRRRRKRRR K RTR       KR     SPR RAAS ARR
    99   99 A M  E     -EI  33 107B   5 1101   82  D DD   DCRNDD EESIDNYGGGLHSGHGNGNQKHAD S HNG       DA     MYG DQQP DHQ
   100  100 A W  E >   -E   32   0B  89 1101   89  t tt   tfVpTt GypRIYYFFFRCtRDDrRrGyDYY E qLP       Cp     vDk LrkG TGs
   101  101 A Y  T 3  S+     0   0  112  572   91  . e.   hl.y.. ..d...G.....gHR.y.y.sRY. . ...       .a     ..g .... ..f
   102  102 A Y  T 3  S-     0   0  133  629   92  . E.   IGTY.. ..G...S....DWSY.Y.YYYYR. . .GR       .Y     ..P ...G ..W
   103  103 A G  S <  S+     0   0   38  705   79  . G.   FwfY.. ..w..YS....YCdY.Y.YYYYyY . .Cy       .Y     .yt ...l ..S
   104  104 A T        -     0   0   32  784   66  . v.   .np.Dg dgyd.gY.....Ga.ggtgg..gg g ggg       Sn     ggt ells .Dg
   105  105 A Y        +     0   0   81  679   93  v ag   NVsY.y p.ym.wW.....Gk..rfrw..Gy i .y.       .t     a.n gppg ..a
   106  106 A Y        -     0   0   32  842   66  Q EK   FfHnYy RyYFtYY....YCRW.IyIYyWyy l .yy       .V     K.W QWWY .pY
   107  107 A F  E     +I   99   0B   0  885   48  L ..   Ff.fRl .fGFfFF...FFI.MfMlMFmMmm f Lvl       ..     ..F F..F .fF
   108  108 A D  E     +     0   0B  25  997   46  E DD   LDADDF .DSAADDAAAADDDDADDDDDDDD E SHD       .D     GFD DDDD .AD
   109  109 A Y  E     -J  168   0C 108 1059   61  V MM   TVLNFM YYVHYVVYYYYYALYYYYYVYYYY K GLL       LY     LYP YYYY LYS
   110  110 A W  E     -I   97   0B  23 1092    2  W WW   WWWWWW FWWWWWWWWWWWWWWWWWWWWWWW W WWW       WW     WWW WWWW WWW
   111  111 A G        -     0   0    3 1067   15  A AA   NGPGRG GGGGGGGGGGGGGGGGGGGGGGGG G DGG       IG     SGG GGGG EGG
   112  112 A Q        -     0   0  141 1047   41  G  A   ANPQSS QQQQZAAQQQQKR QQQQQAQQQQ Q GPP       HQ      QQ QQQQ RQQ
   113  113 A G        -     0   0   20 1013   12  S  M   NGHGVG GGGGGGGGGGGGG GGGGGGGGGG G FGG       IG      GG GGGG SGG
   114  114 A T  E     - H   0  94B   2  996   31  C  G   ATTTL  TTTTTTTTTTTTT TTTTTTTTTT T TIV       QT      TT TTTT PTA
   115  115 A T  E     - H   0  93B  60  979   76  V  T    KPML  IMLLLTTLLLLKS SLSSSTSSSS L LEE       LL      LL LQQL SLL
   116  116 A L  E     -dH  10  92B   1  972   19  V  L    VSVL  VV VVVVVVVVVV VVVVVVVVVV V MVV       LV      VV VVVV PVV
   117  117 A T  E     -d   11   0B  57  953   21  S       TRTG  TT TTTTTTTTTT TTTTTTTTTT T MDV       DT      TT TTTT GTT
   118  118 A V  E     +d   12   0B   4  935    8  S       VIVI  VV VVVVVVVVVV VVVVVVVVVV V VVV       VV      VI VVVV IVV
   119  119 A S              0   0   64  917   10  S       SASC  ST SSSS  SSSS SSSSSSSSSS S ASS        S      SS SSSS PSS
   120  120 A S              0   0  122  885   21          SAAS  SS SSSS  AASS SASSSSSSSS S  SS        S      AS SSSS SAS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32   Q    Q      Q                        Q     QQQ      QQDD    Q    Q   
   123    2 B A        -     0   0   19  713   70   S   IA      T                        A     SSSS     IIII    I    S   
   124    3 B V        -     0   0   84  765   49   V  AVV      V                        P     VVAAVMM  AVVV    V    V   
   125    4 B V  E     -Q  145   0D  10  820   26   L  VLL      V                        L     LLLLLLL  LLLLL   L    L   
   126    5 B T  E     +Q  144   0D  69  829   11   T  TTT      T                        T     TTTTTIT  STSST   T    T   
   127    6 B Q  E     -Q  143   0D  18  832    2   Q  QQQ      L                        Q     QQQQQQQ  QQQQQ   Q    Q   
   128    7 B E        -     0   0   59  833   63   P  PSP      E                        P     PPPPPPP  SSSSD   S    P   
   129    8 B S  S    S+     0   0  101  841   38   S  APS      P                        P S   PPRRPPL  PPPPP   P    S   
   130    9 B A  E     -k  226   0C  59  842   50   S  SAS      S                        S S   SSSSSSS  AAAAA   A    S   
   131   10 B L  E     -k  227   0C  57  847   76   V  VSV      F                        V L   ALVLVVV  IIIIV   I    V   
   132   11 B T  E     +k  228   0C  84  848   77   S  SRS      S                        S S   SSSSSSS  LLLLS   M    S   
   133   12 B T  E     -k  229   0C  18  848   68   G  AAG      V                        G A   GAGGVEG  SSSSV   S    G   
   134   13 B S    >   -     0   0   55  849   70   S  NaS      S                        T S   TASSASS  aaaaA   a    S   
   135   14 B P  T 3  S+     0   0   61  848   65   P  PpL      P                        P L   PPPPPPP  ppppL   p    P   
   136   15 B G  T 3  S+     0   0   46  850    7   G  GGG      R                        G G   GGGGGGE  GGGGG   G    G   
   137   16 B E    <   -     0   0  108  850   56   Q  EEQ      R                        Q D   QQQQEKK  EEEEQ   E    E   
   138   17 B T  E     - R   0 199D  88  850   66   R  TRR      I                        S R   RRSATTT  KKKKT   K    R   
   139   18 B V  E     - R   0 198D  14  850   33   V  VVV      V                        V V   VVVVAVV  VVVVV   V    V   
   140   19 B T  E     - R   0 197D  53  849   41   T  KTS      T                        T T   TSTTRTT  TTTTR   T    T   
   141   20 B L  E     - R   0 196D   0  849   25   I  IMI      L                        I I   IIIILMI  MMMMI   M    I   
   142   21 B T  E     - R   0 195D  22  849   52   S  TST      T                        S S   SSSSTSS  TTTTT   T    S   
   143   22 B b  E     -QR 127 194D   0  850    2   C  CCC      C                        C C   CCCCCCC  CCCCC   C    C   
   144   23 B R  E     -Q  126   0D 133  850   77   T  SKT      G                        A R   SSATGTT  RRRRQ   R    T   
   145   24 B S  E >   -QS 125 148D  11  850   68   G  GAG      L                        G A   GGGGGRG  AAAAG   A    G   
   146   25 B S  T 3  S+     0   0   81  850   27   S  GSS      S                        S S   GSTLNTS  SSSSD   S    S   
   147   26 B T  T 3  S-     0   0   87  850   71   S  SQS      S                        S Q   NSSPDSS  SSSSS   S    S   
   148   27 B G  B <  S+S  145   0D  39  850   55   S  SGS      G                        S D   FSSSIDG  SSSSL   S    T   
   149   28 B A        -     0   0   40  390   77   N  ..N      S                        D .   ..DV...  .....   .    N   
   150   29 B V        -     0   0    3  620   45   V  ..V      V                        V .   DNVV.SS  .....   V    V   
   151   30 B T    >   -     0   0   56  541   72   G  ..G      S                        . .   IIGD.II  .....   R    G   
   152   31 B T  G >  S+     0   0   94  694   78   L  .IN      T                        . I   GGGDGAG  ....R   S    S   
   153   32 B S  G 3  S+     0   0   84  802   62   G  .SG      S                        g S   RKNDSSS  VVVVS   S    G   
   154   33 B N  G <  S-     0   0   13  673   73   .  ND.      H                        s N   NNHNENN  SSSNY   .    N   
   155   34 B Y    <   -     0   0   98  781   50   Y  WYY      Y                        Y Y   SYFFSYY  YYYYY   Y    G   
   156   35 B A        -     0   0    0  817   59   V  YLV      P                        V L   VVVVVVV  MMMMA   L    V   
   157   36 B N  E     -L  212   0C   0  827   79   H  GNS      S                        S N   NDSSHQQ  HHHHS   H    Q   
   158   37 B W  E     -LM 211 171C   0  849    0   W  WWW      W                        W W   WWWWWWW  WWWWW   W    W   
   159   38 B V  E     -LM 210 169C   0  849   25   Y  FYF      Y                        F Y   YYYYYYY  YYYYY   Y    Y   
   160   39 B Q  E     -LM 209 168C  10  849   10   Q  QQQ      Q                        H Q   QQQQQRQ  QQQQQ   Q    Q   
   161   40 B E  E     -LM 208 167C  20  849    8   Q  QQQ      Q                        Q Q   VQQQQQQ  QQQQQ   Q    Q   
   162   41 B K  E  >  - M   0 166C  68  849   50   L  kKI      T                        Q K   HLHTKRR  KKKKK   K    L   
   163   42 B P  T  4 S+     0   0   98  843   23   P  pPP      S                        P P   PPPPPPP  PPPPP   P    P   
   164   43 B D  T  4 S-     0   0  148  846   16   G  GGG      G                        G D   GGGGGGG  GGGGG   G    G   
   165   44 B H  T  4 S+     0   0   90  845   66   K  SQS      Q                        S G   TTKRQGS  SSSSQ   S    N   
   166   45 B L  E  <  - M   0 162C  92  846   57   A  AAA      A                        A T   AAAAAAA  SSSSA   S    A   
   167   46 B F  E     + M   0 161C   9  847   19   P  PPP      P                        P V   PPPPPPP  PPPPP   P    P   
   168   47 B T  E     -JM 109 160C  56  843   61   K  VRR      Q                        K K   RKKRVTT  KKKKV   K    K   
   169   48 B G  E     + M   0 159C   1  848   64   L  TLT      M                        L L   LLLLLTN  PPPPL   L    L   
   170   49 B L  E     +     0   0C   4  848   24   L  VLL      L                        L L   LLILVLV  WWWWV   W    I   
   171   50 B I  E     +NM 177 158C   0  848   19   I  III      I                        I I   IIIIIII  IIIII   I    I   
   172   51 B G  E  >  +N  176   0C   0  849   33   Y  YWY      Y                        Y Y   YFYYYYY  YYYSY   Y    Y   
   173   52 B G  T  4 S-     0   0    9  848   87   D  DDG      S                        C Y   SNGDFDE  AAAAG   S    G   
   174   53 B T  T  4 S+     0   0    9  849   68   S  NAD      T                        V T   SNVDDTN  TTTTK   T    T   
   175   54 B N  T  4 S+     0   0  102  841   49   S  TTT      N                        S S   DNNSRNN  SSSSN   S    S   
   176   55 B N  E  <  -N  172   0C  77  849   69   K  NNS      I                        N R   QKKLDQQ  NNNNN   N    T   
   177   56 B R  E     -N  171   0C 113  850   66   R  RLR      R                        R L   RRRRRRR  LLLLR   L    R   
   178   57 B A    >   -     0   0    1  849   73   P  PYA      P                        P H   SPPPPPP  AAAAP   A    P   
   179   58 B P  T 3  S+     0   0   97  849   39   S  SPS      S                        S S   SSSSSYS  SSSSS   S    S   
   180   59 B G  T 3  S+     0   0   83  850   18   G  NGG      E                        G G   GGGGGGE  GGGGG   G    G   
   181   60 B V  S <  S-     0   0   13  848   23   V  IVV      V                        I V   VIVVIVV  VVVVI   V    V   
   182   61 B P    >   -     0   0   57  850    9   P  PPP      P                        P P   PPPPPPP  PPPPP   P    P   
   183   62 B A  T 3  S+     0   0   77  850   59   D  SAD      D                        D S   DDYNEND  ATAAD   V    D   
   184   63 B R  T 3  S+     0   0   58  850    5   R  RRR      C                        R R   RRRRRRR  RRRRR   R    R   
   185   64 B F  E <   +T  198   0D   4  850    1   F  FFF      F                        F F   FFFFFFF  FFFFF   F    F   
   186   65 B S  E     -T  197   0D  51  849   17   S  SSS      S                        S S   SSSSSSS  SSSSS   S    S   
   187   66 B G  E     +T  196   0D   9  850    4   G  GGG      G                        G G   GGGGGGG  GGGGG   G    G   
   188   67 B S  E     -T  195   0D  41  850    7   S  SSS      F                        S S   SSSSSss  SSSSS   S    S   
   189   68 B L  E     -T  194   0D  59  835   79   R  LGR      I                        K G   KKKKNss  GGGGS   G    R   
   190   69 B I  E >   -T  193   0D  86  842   31   S  SSS      L                        S S   SSSSSSS  SSSSS   S    S   
   191   70 B G  T 3  S-     0   0   67  850   18   G  GGG      G                        G G   GGGDGSS  GGGGG   G    G   
   192   71 B N  T 3  S+     0   0  105  828   57   N  STN      N                        N T   TTNTNNN  TTTTN   T    N   
   193   72 B K  E <  S- T   0 190D  68  833   67   S  TDT      K                        M D   SSTKTSS  SSSST   S    S   
   194   73 B A  E     -RT 143 189D   0  838   81   A  AFA      A                        A Y   AAAAAAA  YYYYA   Y    A   
   195   74 B A  E     -RT 142 188D   0  849   57   S  TST      A                        S S   STSATSS  SSSSS   S    T   
   196   75 B L  E     -RT 141 187D   0  850    2   L  LLL      L                        L L   LLLLLLL  LLLLL   L    L   
   197   76 B T  E     -RT 140 186D  19  850   33   T  TTT      T                        R T   AGTTTTT  TTTTT   T    T   
   198   77 B I  E     -RT 139 185D   0  849    5   I  III      I                        I I   IIIIIII  IIIII   I    I   
   199   78 B T  E    S+R  138   0D  78  850   46   T  TSS      T                        S S   STSSSSS  SSSST   S    T   
   200   79 B G  S    S-     0   0   15  850   57   G  GNS      G                        G N   GGGGRGG  RRRRG   S    G   
   201   80 B A        -     0   0    0  849   51   L  VML      A                        L L   LLLLVLL  MVVVA   V    L   
   202   81 B Q    >   -     0   0   80  849   32   Q  QEQ      Q                        R E   QQQQETK  EEEEQ   E    Q   
   203   82 B T  G >  S+     0   0   84  850   59   A  AAA      A                        A Q   STAPANT  AAAAA   A    A   
   204   83 B E  G 3  S+     0   0   99  850   17   E  EEE      D                        E E   EGEDGDE  EEEEE   E    E   
   205   84 B D  G <   +     0   0    1  850    2   D  DDD      D                        D D   NDDDDDD  DDDDD   D    D   
   206   85 B E    <   +     0   0   71  849   74   E  EAE      E                        E I   EEEEETE  AVAAE   A    E   
   207   86 B A  E    S- O   0 227C   3  850   14   A  AAA      S                        A A   AAAAAAA  AAAAA   A    A   
   208   87 B I  E     -LO 161 226C  55  850   71   D  VVD      D                        D T   DIHTDMD  TTTTD   T    D   
   209   88 B Y  E     -LO 160 225C   0  850    0   Y  YYY      Y                        Y Y   YYYYYYY  YYYYY   Y    Y   
   210   89 B F  E     -L  159   0C   5  848    8   Y  YYF      Y                        Y F   FYYFYFY  YYYYY   Y    Y   
   211   90 B b  E     -L  158   0C   0  849    1   C  CCC      Y                        C C   CCCCCCC  CCCCC   C    C   
   212   91 B A  E     -LP 157 221C   0  848   73   S  GQA      M                        A Q   AGCCQQQ  QLQQN   Q    S   
   213   92 B L  E     - P   0 220C   0  845   83   A  SQA      L                        S Q   TTSSLSS  QQQQS   Q    A   
   214   93 B W  E     + P   0 219C  21  834   71   W  QYG      Y                        Y G   WWYYWYY  WWWWR   Y    W   
   215   94 B Y  E >  S- P   0 218C  33  829   88   D  DDD      M                        R N   DDAVDDD  STSSD   D    D   
   216   95 B S  T 3  S-     0   0  106  829   66   S  SSS      G                        S M   DNGGSSN  SSSSS   S    S   
   217   96 B N  T 3  S+     0   0  105  824   81   S  SsS      s                        R l   sRrNssN  NNNNS   S    s   
   218   97 B H  E <   -P  215   0C  39  647   66   .  vhS      s                        s r   dRtyhlN  PPPP.   p    k   
   219   98 B L  E     -P  214   0C   1  382   85   .  g..      v                        l .   pSWfVWH  PPPP.   i    .   
   220   99 B V  E     -P  213   0C  12  489   66   .  IT.      I                        V T   VVVVVVV  TTTT.   T    .   
   221  100 B F  E     -P  212   0C  17  540   30   L  FY.      F                        F F   FFFFFFV  FFFF.   F    .   
   222  101 B G        -     0   0    1  481   35   S  GGS      H                        G G   GGGGGGF  GGGG.   G    .   
   223  102 B G        -     0   0   51  513   58   G  SQN      D                        G G   GGGQGGG  GAGG.   A    .   
   224  103 B G        -     0   0    8  528   33   A  GGA      P                        G G   GGGGGGG  GGGGG   G    .   
   225  104 B T  E     - O   0 209C   0  550   33   T  TTT      T                        T T   TTTTTTT  TTTTN   T    .   
   226  105 B K  E     -kO 130 208C  82  547   67   V  TKV      L                        Q K   KNNDKKR  KKKMH   K    A   
   227  106 B L  E     -kO 131 207C   0  546   44   L  LLL      L                        L L   VVLLLLL  LLLLL   L    P   
   228  107 B T  E     -k  132   0C  34  614   65   Q  TTQ      N                        T E   TTTTTTT  EEEE    E    T   
   229  108 B V  E     -k  133   0C   3  593   35      V A                               V I   VVVVVVV  ILII    L    V   
   230  109 B L              0   0  120  399   31      L R                               L     LVLLLLL               L   
   231  110 B G              0   0   62  207   39      G G                                     GGGGSSG                   
## ALIGNMENTS  981 - 1050
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    1 A E              0   0  185  771   30    QQQQQQQ QQ  DDQEEEE    EEQHQ  E QQEQEEEEE                    EEEE   
     2    2 A V        +     0   0   18  834   19    VVLVVVV VL  VVVVEVV    EVVVV  V IVVVVVVVV                    EEEE   
     3    3 A Q  E     -A   25   0A  90  836   34    QHRRRRQ KQ  QQQQQQQ    QQQWQ  Q KQQQKKKKK                    KKKK   
     4    4 A L  E     -A   24   0A  13  881    3  MMLLLLLLL LL  LLLLLLLLL  LLLLL  L MLLLLLLLLL                   LLLL   
     5    5 A Q  E     -A   23   0A 107  882   70  LLLQQQQQR LQ  VVVVVVVVV  VVKQK  V DEVVVVEEEV                   VVVV   
     6    6 A Q  E     -A   22   0A  14  887   31  EEEQEEEEE EE  EEQEEEEEE  EEEEE  E QQEEEEEEEE                   EEEE   
     7    7 A S        -     0   0   33  892   13  SSSWSSSSS SS  SSSSSSSSS  SSSSS  S SSTSSSSSSS                   SSSS   
     8    8 A G        -     0   0   52  907   11  GGGGGGGGG GG  GGGGGGGGG  GGGGG  G PGGGGGGGGG                   GGGG   
     9    9 A A        -     0   0   80 1179   51  PPGTPPPPP PP  GGGGGGGGG  GGPPP  G NPGGGGGGGGPGPPPPP P PPPPP    GGGG   
    10   10 A E  E     -d  116   0B  68 1189   46  GGGGGSSSS GG  DDGGGGGGG  GGGGG  G VGGGGGGGGDGGGGGSGGGGGGGGG    GGGG   
    11   11 A L  E     +d  117   0B 130 1195   22  LLLLLLLLL LL  LVVLLLLLL  LLVLV  L VLLVLLLLLVLLLLLLLLLLLLLLL    LLLL   
    12   12 A V  E     -d  118   0B  28 1197   47  VVVLVVVVV VV  RRVLVVVVV  VVVVV  A KVIVVVVVVKVVVVVVVVVVVVVVV    VVVV   
    13   13 A K    >   -     0   0  145 1201   50  KKKKKKKKK KK  QQQPQQQPQ  QQKKK  Q RRQQQQQQQKAQKAAKKQAAAKQAA    QQQQ   
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPPPPPP PP  PPPPPPPPP  PPPPP  P PPPPPPPPPPPPPPPPPPPPPPPPP    PPPP   
    15   15 A G  T 3  S+     0   0   59 1209   28  SSGSSSSSS SS  GGGGGGGGG  GGSSS  G GSGGGGGGGGSGSSSSSGSSSSSSS    GGGG   
    16   16 A A    <   -     0   0   36 1213   63  QQGEEQQQQ QE  GGRGGGGGG  GGQQQ  G EQGRGGGGGDQEQQQQQEQQQQQQQ    GGGG   
    17   17 A S        -     0   0   66 1210   29  TTSTTTTTT ST  SSSSSSSSS  SSTTT  S TTSSSSSSSSSSTSSTSSSSSSSSS    SSSS   
    18   18 A V  E     - B   0  83A  10 1213   32  VVLLLLLLL LL  LLLLLLLLL  LLLLL  L VLLLLLMMMLLLVLLLLLLLLLLLL    LLLL   
    19   19 A K  E     - B   0  82A 119 1211   53  SSRSSSSTS SP  SSRRRRRRR  RRPSS  R KSRRRRKKKRSKSSSSSKSSSSSSS    RRRR   
    20   20 A L  E     - B   0  81A   0 1214   21  LLLLLLLLL LL  LLLLLLLLL  LLLIL  L MLLLLLLLLLILLIILLLIIILIII    LLLL   
    21   21 A S  E     - B   0  80A  31 1215   35  SSSTTTTTT TT  SSSSSSSSS  SSIIT  S STSSSSSSSSTSTTTTTSTTTTTTT    SSSS   
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCCCCCC CC  CCCCCCCCC  CCCCC  C CCCCCCCCCCCCCCCCCCCCCCCCC    CCCC   
    23   23 A K  E     -AB   5  78A 113 1216   70  TTAASTTTT TA  KKVAAAAAA  AAASA  A VTASAAVVVKTETTTSSETTTTTNT    VVVV   
    24   24 A A  E     +A    4   0A   2 1216   49  VVAVVVVVA VV  AAAAAVAAA  AAVVV  A CVASTTAAAAISVVVVVSVVVVVVV    GGGG   
    25   25 A S  E     +A    3   0A  49 1216   12  SSSYSSSSS TS  SSSSSSSSS  SSSSS  S SSSSSSSSSSSNTSSTTNSSSTSSS    SSSS   
    26   26 A G  S    S+     0   0   56 1215    3  GGGGGGGGG GG  GGGGGGGGG  GGGGG  G GGGGGGGGGGGEGGGGGEGGGGGGG    GGGG   
    27   27 A Y  S    S-     0   0   39 1216   33  AAFGGFFFF YA  LFFFFFFFF  FFFFF  F FSFFFFFFFFFYIFFDYYFFFYFFF    FFFF   
    28   28 A T    >   -     0   0   90 1216   52  SSTSSSSSS SS  TTTTTTTTT  TTSSS  T STTITTTTTTSESSSSSESSSSSSS    TTTT   
    29   29 A F  G >  S+     0   0   13 1216   27  IIFFVLLLL II  SFFFFFFFF  FFLLL  F MFVFFFFFFFLFILLIIFLLLILLL    FFFF   
    30   30 A T  G 3  S+     0   0   40 1216   55  NNSSSTTTS TS  SSSSSSSSS  SRTTT  S TSSSSSSSSSTPTTTTTPTTTTTTT    SSSS   
    31   31 A S  G <  S+     0   0   23 1216   57  TTNDsTssS Ss  YSTSSNsSS  SSSSS  d SnBSDDNNNSSStSSsmSGSSsSRS    SsSS   
    32   32 A Y  E <  S-E  100   0B  40 1139   28  aaAYyY..Y dy  YYYYYY.YY  YYYYY  y FyHYFFYYYYYHyYYyyHYYYyYYY    YyYY   
    33   33 A W  E     -E   99   0B  40 1148   92  yyWY.SaaG a.  NCAWGYwYE  WGDDD  . Y.SAYYWWWWGDRGG.YDGGGAGGG    P.EE   
    34   34 A M  E     -EF  98  51B   0 1206   49  WWMWWVVVI WW  MMMMMMMMM  MMVMV  M IYMMMMMMMMVMWVVWWMVVVWVVV    IIII   
    35   35 A H  E     -EF  97  50B   0 1212   72  SSSSGGDGN NS  HYHGSNHSN  HSGTG  D HTSYEENNNSHSSHHNNSNHHNHHH    DNSS   
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWWWWWW WW  WWWWWWWWW  WWWWW  W WWWWWWWWWWWWWWWWWWWWWWWWW    WWWW   
    37   37 A V  E     -EF  95  47B   0 1216   17  IIVIVVVVV II  VIVVVVVVV  VIVFV  V IVVVVVVVVVVVIVVIIVVVVIVVV    VVVV   
    38   38 A K  E     -EF  94  46B   7 1216   22  RRRRRRRCR RR  RCRRRGRRR  RRCRR  R RRRRRRRRRRRRRRRRRRRRRRRRR    RRRR   
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQQQQQ QQ  QQQQQQQQQ  QQQQQ  Q QQQQQQQQQQQKQQQKQKQQQQQQQ    QQQQ   
    40   40 A R    >   -     0   0   35 1216   71  HHAPPAAAA FA  AAAAAAAAA  AASPA  A KPAAPPSSSAPTFPPFFTPPPFSPP    AAAA   
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPPPPPPP PP  PPPPPPPPP  PPPPP  P PPPPPPPPPPPPPPPPPPPPPPPPP    PPPP   
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGGGGGGG GG  GGGGGGGGG  GGGGG  G GGGGGGEEEGGEGGGGGEGGGGGGG    GGGG   
    43   43 A R  S <  S-     0   0  156 1216   43  RRKKKKKRK NK  KKRKKKKKK  KKKKK  K RRKKKKKKKKKKNKKNNKKKKNKKK    KKKK   
    44   44 A G        -     0   0   16 1215   36  GGGGGAVVA KG  GGGGGGGGG  GGGGG  G AGAGRRGGGGGRKGGKKRGGGKGGG    GGGG   
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLLLPPL LL  LLLLLLLLL  LLLLL  L LLLLLLLLLLLLLLLLLLLLLLLLL    LLLL   
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEEEEEE EE  EEEEEEEEE  EEEEE  E EEZEEEEEEEEEEEEEEEEEEEEEE    EEEE   
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWWWWCC WW  WWWWWWWWW  WWWWW  W WWWWWWWWWWWLWWWYWLWWWWWWW    WWWW   
    48   48 A I  E     -     0   0B   0 1215   31  IIVIILLLL MI  VIVVVVLVV  VVVVV  V IIVVIIVIVVLVILLMMVLLLMLLL    LLLL   
    49   49 A G  E     -FG  36  60B   0 1216   35  GGGGGGGGA GG  AAASASCSA  AAGGG  S GGSAAAAAAAVAGGGGGAGGGGGGG    AAAA   
    50   50 A R  E     -FG  35  59B  32 1216   94  FFRESGGGC YR  RYVFLLRVY  YVAAA  R FYAIAAEEETVAYVVYSAMVVYVVV    GATT   
    51   51 A I  E     -FG  34  58B   0 1207   17  IIIIIIVII II  VIIIIIIII  IIIII  I IVIISSIIIIIIIIIVIIIIIIIII    IIII   
    52   52 A D     >  -     0   0   26 1212   86  SSKNFESDT TY  YSSTSSNSS  SWCWD  R SFYWRRRRRDWNYWWSSNWWWSWWW    SSTT   
    53   53 A P  T  4 S+     0   0    0 1212   83  NNTDYNSTG YG  SSYDSGPGS  GNSTN  N GYRDNNLLLDSSYAAYYSGAAYSTA    FSTT   
    54   54 A N  T  4 S-     0   0   96 1213   69  NNKSSDDYG SS  NSDYGSDDD  GDGGG  K SHGDKKKKKGDDSGGSDDDGGSGGG    SSSS   
    55   55 A G  T  4 S-     0   0   69 1216   57  GGtGGGGGG GG  GGGGssGSg  SGGGG  a SGGGaasssSGGGGGGGGGGGGGGG    DGGG   
    56   56 A G     <  +     0   0   25  915   61  ..g...... .G  GSNGgsSRs  .S...  y ...Syyyyy..G.....G.......    GGGG   
    57   57 A G        -     0   0   43 1195   77  DDTISCSNN RS  SSYSSTTYY  .QSGS  T STTDTTAAAQSSTSSSSSSSSSSIS    SSGG   
    58   58 A T  E     -G   51   0B  62 1209   46  PPTTTATTT TT  TTKITITTI  TKTTT  T ISTQTTTTTQTTITTTNTTTTTTTT    TTTT   
    59   59 A K  E     -G   50   0B  89 1212   88  FFDNYGYGA TD  NSYYYNNNS  YYYGC  E SDYHEEHHHFTYTNNYNYDNNSDNN    YYYY   
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYYYYYYY YY  YYYYYYYYY  YYYYY  Y YDYYYYYYYYYYYYYYYYYYYYYYY    YYYY   
    61   61 A N    >>  -     0   0   12 1216   63  NNANNHNNN NN  AAAAAAAAA  AANNN  A STAASSAAAANPNNNNNPNNNNNNN    AAAA   
    62   62 A E  G >4 S+     0   0  148 1216   64  PPAPPPPPP PP  DDDNDANAA  DDPSP  A ETDDAAEEEDSDPSSPPDSSSPASS    DDDD   
    63   63 A K  G 34 S+     0   0  109 1216   64  SSPSSAAAA SS  SSSASSSSS  SSATA  S SPSSSSSSSSATSAASSTAAASAAA    SSSS   
    64   64 A F  G X> S+     0   0    5 1216   45  LLVLLLLLL LL  VVVVVVVVV  VVLVL  V VLVVVVVVVVLMLLLLLMLLLLFLL    VVVV   
    65   65 A K  T << S+     0   0  156 1216   40  KKKKKKKKK KK  KKKKKKKKK  KKKAK  K KRKKKKKKKKKETMMKKEKMMKIMM    KKKK   
    66   66 A S  T 34 S+     0   0  108 1216   35  SSGSSSSSS SS  GGGGGGGGG  GGSSS  G NSGGGGGGGGSRSSSSNRSSSSSSS    GGGG   
    67   67 A K  T <4 S+     0   0   33 1214   21  RRRRRRRRR RR  RRRRRRRRR  RRRRR  R RRRRRRRRRRRRRRRRRRRRRRRRR    RRRR   
    68   68 A A  E  <  -C   83   0A   2 1216   69  FFLVVLRLL IV  FFFFFFFFF  FFLVL  F FVFFFFFFFFLFTLLIIFLLLILLL    FFFF   
    69   69 A T  E     -C   82   0A  58 1216   37  TTTTTSSSN ST  TTSSTTTTT  TTSSS  T TTTTIITTTTSITSSSSISSSSSTS    TTTT   
    70   70 A L  E     +C   81   0A   7 1216   27  IIIIIIIII II  IIIIICIII  IIIII  I IMIIVVIIIIIIIIIIIIIIIIIII    IIII   
    71   71 A T  E     -C   80   0A  57 1213   47  SSSSSTTAT TS  SSSSSSSSS  SSTTT  S SLSSSSSSSSSSTSSTTSSSSTSSS    SSSS   
    72   72 A V  E     -C   79   0A  28 1216   71  IIRVVRRRK RI  WRRRRRRRR  RRRRR  R RVRRRRRRRRKRRKKRRRKKKRKRK    RRRR   
    73   73 A D  E   > -C   78   0A  69 1216    7  DDDDDDDDD DD  DDDDDDDDD  DDDED  D DDDDDDDDDDDDDDDDDDDDDDDDD    DDDD   
    74   74 A K  T > 5S+     0   0  105 1216   62  TTDTTTATK TT  KNNNNNNNN  NNTTT  D NTDNTTDDDNNNTNNTTNNNNTNNN    DNNN   
    75   75 A P  T 3 5S+     0   0  122 1215   37  SSSSLSSSS SS  ASSVTAATA  ADSSS  S SSSSSSSSSPSTSSSSSTSSSSSSS    SSSS   
    76   76 A S  T 3 5S-     0   0   37 1216   65  KKKKKKKKK KK  SNNKKKKKK  KKKKK  K RKRKQQKKKNKKKKKKKKKKKKKKK    QQQQ   
    77   77 A S  T < 5 +     0   0   24 1216   48  NNNNNSSSS NN  SSNNNNNNN  NNSSS  N KNBNSSSSSNSKNSSNNKSSSNSSS    NNNN   
    78   78 A T  E   < -BC  23  73A   8 1216   64  QQTQNQQQQ QQ  LLTTSTMTT  MTQQQ  T QQTTIISSSLQTQQQQQTQQQQQQQ    TTTT   
    79   79 A A  E     -BC  22  72A   0 1207   67  FFLFFVVVV FF  LVLLLLLLL  LLVVV  L VFVLLLVVVLVLFVVYFLVVVFVVV    AAAA   
    80   80 A Y  E     -BC  21  71A  61 1209   36  TTYSSSSSS FS  SNHYYYYYY  DYYYY  Y YSYFYYYFYHFYFFFYFYFFFFFFF    YYYY   
    81   81 A M  E     -BC  20  70A   0 1212    9  LLLLLLLLL LL  LLLLLLLLL  LLLFL  L LLLLLLLLLLLLLLLLLLLLLLFLL    LLLL   
    82   82 A Q  E     -BC  19  69A  69 1215   43  RRQKKSSSS QK  QQEQQQQQQ  EQQQQ  Q QRQQQQQQRQKQEKKQKQKKKQKKK    QQQQ   
    83   83 A L  E     -BC  18  68A   0 1215   14  LLMLLLLLL LL  MMMMMMMMM  MMLLL  M MLMMMMMMMLMMMMMLLMMMMLMMM    MMMM   
    84   84 A S        +     0   0   32 1215   56  YYNSSSSSS NS  NNNNSSNNS  SNTST  S NSBDNNNNNTNSNNNNNSNNNNNNN    NNNN   
    85   85 A S  S    S-     0   0   89 1216   25  SSSSSSSSS SS  SSTSSSSSS  SSSSS  S SSSSAANNNGSSSSSSSSSSSSSSS    SSSS   
    86   86 A L        +     0   0    2 1216   15  VVLVVVVVV VV  LLLLLLLLL  LLVVV  L LVLLLLLLLLLLLLLVVLLLLVLLL    LLLL   
    87   87 A T    >   -     0   0   61 1215   68  TTKTTTTTT TT  KKRKRGRRR  RGNTN  K RTRRRRRRRKQRTQQTTRQQQTQQQ    RRRR   
    88   88 A S  G >  S+     0   0   72 1216   59  SSTAASTPT TA  TTTAAAAAA  TSPPP  T AAAPAAAAPPTSATTTTSTTTTATT    TTTT   
    89   89 A E  G 3  S+     0   0  107 1216   21  AAEAAEEEE EA  EEEEEKEED  QQEEE  E EAEEEEEEEEDEEDDEEEDDDENDD    EEEE   
    90   90 A D  G <  S+     0   0    7 1216    3  DDDDDDDDD DD  DDDDDDEDD  DDDDD  D DDDDDDDDDDDDDDDGDDDDDDDDD    DDDD   
    91   91 A S    <   +     0   0   31 1216   34  TTTTTTATT TT  TTTTTTTTT  TMTTT  T STTTTTTTTTTTTTTTTTTTTTTTT    TTTT   
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAAAAAA AA  AAAAAAAAA  AAAAA  A AAAGAAGGGAAAAAAAAAAAAAAAA    AAAA   
    93   93 A V  E     -EH  39 115B  21 1216   48  KKVLVMVVT TV  LLLVVLMVV  VIVLV  V VVVVIIIIIRMLTMMTTLRMMTIVM    RRQQ   
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYYYYYYY YY  YYYYYYYYY  YYYDY  Y YYYYYYYHYYYYYYYYYYYYYYYYY    YYCC   
    95   95 A Y  E     -E   37   0B   1 1216    3  YYYYYYYYY YY  YYYYYYYYY  YYYYY  Y YYYFYYYYYYYYYYYYYYYYYYYYY    YYYY   
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCCCCCC CC  CCCCCCCCC  CCCCC  C CCCCCCCCCCCCCCCCCCCCCCCCC    CCCC   
    97   97 A A  E     -EI  35 110B   0 1215   24  AATATVAAA AA  AAAAAAAAA  AVAAA  A AAAAAATTTAAAAAAAAAAAAAAVA    AATT   
    98   98 A R  E     -E   34   0B  13 1196   38  RRTRRRRRK RR  TRKRRRRRR  RRKRK  R RRRRRRTTTRRRRRRRRRRRRRRRR    RRRR   
    99   99 A M  E     -EI  33 107B   5 1101   82  QQDEPSTFY GE  DDDHDHHDD  DDGDG  D DNDDDDGGGHQHLDDSDHAHDGNDD    GWGG   
   100  100 A W  E >   -E   32   0B  89 1101   89  sstWGFWss Ie  tTsRTtttt  ttTTT  t llLgYYFFFTGvRGHtqENydDsDR    Gsgg   
   101  101 A Y  T 3  S+     0   0  112  572   91  ffv....yc .d  v.l...cal  .....  h v..h.......gP......yy.rY.    .itt   
   102  102 A Y  T 3  S-     0   0  133  629   92  WWV....AA .D  GYY...PCW  .....  I S..G......YYY.....GGV.YY.    .AVV   
   103  103 A G  S <  S+     0   0   38  705   79  SSp.yFyWC .y  gYFF..swG  .....  F i..FYY....YYY.....YyW.YYY    .vWW   
   104  104 A T        -     0   0   32  784   66  ggmgdgggs .y  gse...p.p  ggG.v  S dgacggAA.Qg..gEg.gdg.g.g.    Ggss   
   105  105 A Y        +     0   0   81  679   93  aasyvkgtn Sy  ThgRVa.mg  ggI.l  . N.acww....w..y.phfyw.t.y.    ..rr   
   106  106 A Y        -     0   0   32  842   66  YYsYwYSsY yh  HFYFRS.YT  WWF.R  F wCRfYY...YYyyy.YYWyYyWyvy    .dyy   
   107  107 A F  E     +I   99   0B   0  885   48  FFwPmWIiI ll  GQFCA..L.  FFR..  F fI.pFF....Fmmm.FFFmFmFmfm    .mmm   
   108  108 A D  E     +     0   0B  25  997   46  DDYYDGDDD AD  QDDAP..R.  PPN.K  L DD.DDD..AGDDDDDDDADDDADAD    .DDD   
   109  109 A Y  E     -J  168   0C 108 1059   61  SSGYLYYYA YS  DQPHYY.T.  IVY.L  T YVLYVVYYYCVYYYYYYYYVYYYYY    .LLL   
   110  110 A W  E     -I   97   0B  23 1092    2  WWWWWWWWW WW  WWWWWW.WW  WWSWW  W WWFWWWWWWWWWWWWWWWWWWWWWW    IWWW   
   111  111 A G        -     0   0    3 1067   15  GGGGGGGGG GG  GPGAEG.SG    G G  N GGGGGGGGGGGGGGGGGGGGGGGGG    GGGG   
   112  112 A Q        -     0   0  141 1047   41  QQQQQPPPQ QQ  PQQSNQQEW    A Q  A KQKQAAQQQQAQQQQQQQQAQQQQQ    PPPP   
   113  113 A G        -     0   0   20 1013   12  GGGGGGGGG GG  IPGID GGG    G    N GGGGGGGGGGGGGGGGGGGGGGGGG    GGGG   
   114  114 A T  E     - H   0  94B   2  996   31  ATTNTLLLL TV  AATHG TTS         A TSTTTTTTTPTTTTTTTTTTTTTTT    VVVV   
   115  115 A T  E     - H   0  93B  60  979   76  LLLLTLLLL LV  GTLLD S F         S TLTPTTLLLLASSSSTPLSTSLSLS    EEEE   
   116  116 A L  E     -dH  10  92B   1  972   19  VVV VVVVV VV  VYVVD V L         L VVVVVVVVVPVVVVVLLVVVVVVVV    VVVV   
   117  117 A T  E     -d   11   0B  57  953   21  TTT TTTTT TT  RATSD F G           TTTTTTPTTSTTTTTTTTTTTTATT    VVVV   
   118  118 A V  E     +d   12   0B   4  935    8  VVV VVVVV VV  VLVLI L T           VVVVVVVVVAVVVVVVVVVVVVVVV    VVVV   
   119  119 A S              0   0   64  917   10  SSS SSSSS SS  G T D T A           SSSSSS  SASSSSSSSSSSSSSSS    SSSS   
   120  120 A S              0   0  122  885   21  SSS SSSSS AS  T S N   S           SSSSSS  AASSSSSSSASSSASAS    SSSS   
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32           Q  E          Q      Q  E                          EQQ    QQQ
   123    2 B A        -     0   0   19  713   70           S  V          S      F  V                          VSI    SSS
   124    3 B V        -     0   0   84  765   49           V  V          VV     VA V                          VVV    VVV
   125    4 B V  E     -Q  145   0D  10  820   26           L  FV         LL     LV F                         VMLL    LLL
   126    5 B T  E     +Q  144   0D  69  829   11           T  TT         TT     TT T                         TTTT    TTT
   127    6 B Q  E     -Q  143   0D  18  832    2           Q  QQ         QQ     QQ Q                         QQQQ    QQQ
   128    7 B E        -     0   0   59  833   63           P  PP         PP     PP P                         PPPS    PPP
   129    8 B S  S    S+     0   0  101  841   38           P  HA         SS     NA H                         QEPP    PPP
   130    9 B A  E     -k  226   0C  59  842   50           S  SS         SS     SS S                         ASSA    SSS
   131   10 B L  E     -k  227   0C  57  847   76           V  VV         VV     VV V                         VVEI    VVV
   132   11 B T  E     +k  228   0C  84  848   77           S  SS         SS     SS S                         SSSM    SSS
   133   12 B T  E     -k  229   0C  18  848   68           A  GG         GG     TA G                         VGRS    GAA
   134   13 B S    >   -     0   0   55  849   70           A  ST         SS     NN S                         SSNa    TAA
   135   14 B P  T 3  S+     0   0   61  848   65           P  PL         PP     LP P                         PPPp    PPP
   136   15 B G  T 3  S+     0   0   46  850    7           G  GG         GG     GG G                         GGRG    GGG
   137   16 B E    <   -     0   0  108  850   56           Q  QQ         EE     SE Q                         QQQQ    QQQ
   138   17 B T  E     - R   0 199D  88  850   66           K  TT         RR     TT T                         MKSK    RKE
   139   18 B V  E     - R   0 198D  14  850   33           V  VV         VV     VV V                         AAVV    VVV
   140   19 B T  E     - R   0 197D  53  849   41           T  TT         TT     KK T                         RTTT    TTT
   141   20 B L  E     - R   0 196D   0  849   25           I  II         II     LI I                         IIIM    III
   142   21 B T  E     - R   0 195D  22  849   52           S  SS         SS     ST S                         TSTT    SSS
   143   22 B b  E     -QR 127 194D   0  850    2           C  CC         CC     CC C                         CCCC    CCC
   144   23 B R  E     -Q  126   0D 133  850   77           S  TS         TT     KS T                         QTTS    SSS
   145   24 B S  E >   -QS 125 148D  11  850   68           G  RG         GG     RG R                         GRGA    GGG
   146   25 B S  T 3  S+     0   0   81  850   27           S  SS         SS     SG S                         QSSS    GGS
   147   26 B T  T 3  S-     0   0   87  850   71           S  SS         SS     TS S                         ISSS    SSS
   148   27 B G  B <  S+S  145   0D  39  850   55           S  GS         TS     GS G                         VGSS    STS
   149   28 B A        -     0   0   40  390   77           .  SN         .N     N. .                         .NN.    N..
   150   29 B V        -     0   0    3  620   45           N  II         NI     I. S                         .II.    GNN
   151   30 B T    >   -     0   0   56  541   72           I  DG         IG     G. I                         .GG.    TII
   152   31 B T  G >  S+     0   0   94  694   78           G  SY         GG     S. D                         .DD.    GGG
   153   32 B S  G 3  S+     0   0   84  802   62           K  Es         DG     N. S                         rNNV    NND
   154   33 B N  G <  S-     0   0   13  673   73           N  .s         NN     .N K                         y.YS    NNN
   155   34 B Y    <   -     0   0   98  781   50           Y  YY         YY     YW Y                         FYSY    YYF
   156   35 B A        -     0   0    0  817   59           V  VV         VV     VY V                         PVGM    VVV
   157   36 B N  E     -L  212   0C   0  827   79           S  QG         SH     NG Q                         TYQH    YSS
   158   37 B W  E     -LM 211 171C   0  849    0           W  WW         WW     WW W                         WWWW    WWW
   159   38 B V  E     -LM 210 169C   0  849   25           Y  YF         YY     YY Y                         IYYY    YHY
   160   39 B Q  E     -LM 209 168C  10  849   10           Q  QQ         QQ     QQ Q                         QQQQ    QQQ
   161   40 B E  E     -LM 208 167C  20  849    8           Q  QQ         QQ     QQ Q                         QQQQ    QHQ
   162   41 B K  E  >  - M   0 166C  68  849   50           L  RI         LL     Hk R                         KRIK    LLL
   163   42 B P  T  4 S+     0   0   98  843   23           P  PP         PP     Ep P                         PPPS    PPP
   164   43 B D  T  4 S-     0   0  148  846   16           G  GG         GG     GG G                         GGEG    GGG
   165   44 B H  T  4 S+     0   0   90  845   66           A  ST         KK     RS S                         QSKT    TTT
   166   45 B L  E  <  - M   0 162C  92  846   57           A  AA         AS     SA A                         AVPS    AAA
   167   46 B F  E     + M   0 161C   9  847   19           P  PP         PP     PP P                         PPPP    PPP
   168   47 B T  E     -JM 109 160C  56  843   61           K  TK         KK     TV T                         VTKK    KKK
   169   48 B G  E     + M   0 159C   1  848   64           L  TT         LL     TT T                         TLTR    LLL
   170   49 B L  E     +     0   0C   4  848   24           L  VL         LL     MV V                         VMVW    LLL
   171   50 B I  E     +NM 177 158C   0  848   19           I  II         II     II I                         IIII    III
   172   51 B G  E  >  +N  176   0C   0  849   33           Y  YY         YY     YY Y                         YYYY    YYY
   173   52 B G  T  4 S-     0   0    9  848   87           E  KG         YD     RS K                         GNGD    RED
   174   53 B T  T  4 S+     0   0    9  849   68           S  DN         ND     DN D                         NYTT    DDN
   175   54 B N  T  4 S+     0   0  102  841   49           D  NN         SS     DT N                         NDNS    DNN
   176   55 B N  E  <  -N  172   0C  77  849   69           K  QK         DN     KN Q                         NKSK    KKK
   177   56 B R  E     -N  171   0C 113  850   66           R  RR         RR     RR R                         RRRL    RRR
   178   57 B A    >   -     0   0    1  849   73           P  PA         EP     PP P                         PPPA    PPP
   179   58 B P  T 3  S+     0   0   97  849   39           S  SS         SS     DS S                         SSSS    SSS
   180   59 B G  T 3  S+     0   0   83  850   18           G  GG         GG     GN G                         GGGG    GGG
   181   60 B V  S <  S-     0   0   13  848   23           I  VV         VV     VI V                         IVIV    VII
   182   61 B P    >   -     0   0   57  850    9           P  PP         PP     PP P                         PPPP    PPP
   183   62 B A  T 3  S+     0   0   77  850   59           D  DD         DD     DS D                         DDDA    DDD
   184   63 B R  T 3  S+     0   0   58  850    5           R  RR         RR     RR R                         RRRR    RRR
   185   64 B F  E <   +T  198   0D   4  850    1           F  FF         FF     FF F                         FFFF    FIF
   186   65 B S  E     -T  197   0D  51  849   17           S  SS         SS     SS S                         SSSS    SSS
   187   66 B G  E     +T  196   0D   9  850    4           G  GG         GG     GG G                         SGGG    GAG
   188   67 B S  E     -T  195   0D  41  850    7           S  sS         SS     sS s                         SsSS    SSS
   189   68 B L  E     -T  194   0D  59  835   79           K  sK         RT     rT s                         RrKG    KKK
   190   69 B I  E >   -T  193   0D  86  842   31           S  SS         SS     SS S                         SSSS    SSS
   191   70 B G  T 3  S-     0   0   67  850   18           G  SG         GG     SG S                         GSGA    GGG
   192   71 B N  T 3  S+     0   0  105  828   57           T  NN         SS     NS N                         ENST    TTT
   193   72 B K  E <  S- T   0 190D  68  833   67           S  ST         SS     ST S                         TTAS    SSS
   194   73 B A  E     -RT 143 189D   0  838   81           A  AA         AA     AS A                         SAAY    AAA
   195   74 B A  E     -RT 142 188D   0  849   57           T  ST         SS     LT S                         TYTS    STT
   196   75 B L  E     -RT 141 187D   0  850    2           L  LL         LL     LL L                         LLLL    LLL
   197   76 B T  E     -RT 140 186D  19  850   33           G  AT         TT     TT T                         NTTT    AGG
   198   77 B I  E     -RT 139 185D   0  849    5           I  II         II     II I                         IIII    III
   199   78 B T  E    S+R  138   0D  78  850   46           T  SS         TT     NT S                         SSTT    STT
   200   79 B G  S    S-     0   0   15  850   57           G  GG         GG     NG G                         GGGS    GGG
   201   80 B A        -     0   0    0  849   51           L  LV         LL     VV L                         ALLM    LLL
   202   81 B Q    >   -     0   0   80  849   32           Q  KQ         QQ     QQ K                         RQKQ    RRQ
   203   82 B T  G >  S+     0   0   84  850   59           T  SA         AA     TA S                         APAA    STT
   204   83 B E  G 3  S+     0   0   99  850   17           G  EE         EE     EE E                         EEEE    EGG
   205   84 B D  G <   +     0   0    1  850    2           D  DD         DD     DD D                         DDDD    DDD
   206   85 B E    <   +     0   0   71  849   74           E  EE         EE     EE E                         EEEA    EEE
   207   86 B A  E    S- O   0 227C   3  850   14           A  AA         AA     AA A                         AAAA    AAA
   208   87 B I  E     -LO 161 226C  55  850   71           A  DD         DD     DV D                         DDDT    HDD
   209   88 B Y  E     -LO 160 225C   0  850    0           Y  YY         YY     YY Y                         YYYY    YYY
   210   89 B F  E     -L  159   0C   5  848    8           Y  YY         YY     FF Y                         YHYY    HYY
   211   90 B b  E     -L  158   0C   0  849    1           C  CC         CC     CC C                         CCCC    CCC
   212   91 B A  E     -LP 157 221C   0  848   73           G  QG         EQ     QG Q                         SLQQ    AAG
   213   92 B L  E     - P   0 220C   0  845   83           T  SS         SS     SS                           TSSQ    ATT
   214   93 B W  E     + P   0 219C  21  834   71           W  YY         YF     YR                           WGYW    WWW
   215   94 B Y  E >  S- P   0 218C  33  829   88           D  DD         ED     SD                           DYDS    DDD
   216   95 B S  T 3  S-     0   0  106  829   66           H  NS         SD     SS                           NGKS    YSS
   217   96 B N  T 3  S+     0   0  105  824   81           s  Ys         SD     gs                           nnsN    rss
   218   97 B H  E <   -P  215   0C  39  647   66           a  Ns         ..     h.                           k.sP    sns
   219   98 B L  E     -P  214   0C   1  382   85           G  V          ..     dg                           gfwL    vvg
   220   99 B V  E     -P  213   0C  12  489   66           V  L          ..     VI                           VVVT    VVM
   221  100 B F  E     -P  212   0C  17  540   30           F  F          IL     NF                           FFFF    FFF
   222  101 B G        -     0   0    1  481   35           G  G          DG     HG                           GGGG    GGG
   223  102 B G        -     0   0   51  513   58           G  G          GT     GS                           GGGA    GGG
   224  103 B G        -     0   0    8  528   33           G  G          RP     GG                           GGGG    GGG
   225  104 B T  E     - O   0 209C   0  550   33           T  T          TT     ST                           TTTT    TTT
   226  105 B K  E     -kO 130 208C  82  547   67           T  R          VV     KT                           HQQK    QKR
   227  106 B L  E     -kO 131 207C   0  546   44           L  L          LL      L                           LVLL    LVV
   228  107 B T  E     -k  132   0C  34  614   65           T  T                  T                           TTTE    TTT
   229  108 B V  E     -k  133   0C   3  593   35           V  V                  V                           VVVL    VVV
   230  109 B L              0   0  120  399   31           L  L                  L                           LLL     LLL
   231  110 B G              0   0   62  207   39              G                  G                           GGG      GG
## ALIGNMENTS 1051 - 1120
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    1 A E              0   0  185  771   30       QDEEQQQ   Q   Q  QQQ QQQQQQQQQQ    DEQQQEQEEQ EEQQ KD E EEEE     
     2    2 A V        +     0   0   18  834   19       LVVVLVV   V   V  VVV VVVVVVVVVV    VVVVVVVVVV VEVV VV V VLVV VVVV
     3    3 A Q  E     -A   25   0A  90  836   34       QQQQQQQ   Q   Q  QQQ KQRQQRRRKK   QQQQQQQQQQQ QQQQ QQ Q QQKK QQQQ
     4    4 A L  E     -A   24   0A  13  881    3       LLLLLLL   L   L  LLL LLLLLLLLLL   LLLLLLLLLLL LLLL LLLL LLVL LLLL
     5    5 A Q  E     -A   23   0A 107  882   70       QQQVQQQ   K   Q  QQQ LQQQQQQQLL   VVVQQQVQVVQ VVQQ QVDV VVVE VVVV
     6    6 A Q  E     -A   22   0A  14  887   31       EEEEEEQ   E   E  EEE EEEEEGEEEE   EEEEEEEEEEE EEEE EEQE EEEE EEEE
     7    7 A S        -     0   0   33  892   13       SSSSSSW   S   S  SSS SSSSSSSSSS   SSSSSSSSSSS SSSS SSSS SSSS SSSS
     8    8 A G        -     0   0   52  907   11       GGGGGGG   G   G  GGG GGGGGGGGGG   GGGGGGGGGGG GGGG GGQG GGGG GGGG
     9    9 A A        -     0   0   80 1179   51       PPPGPPA   P   P  GGG PPPPPPPPPP   GGGPPPGPGGP GGPP PGPG GGGG GGGG
    10   10 A E  E     -d  116   0B  68 1189   46       GGSGGGG   D   G  GGG GSSSSSSNGS   DDGGGGGGGGG GGGG SGEG GGGG GGGG
    11   11 A L  E     +d  117   0B 130 1195   22       LLLLLLL   L   L  LLL LLLLLLLLLL   LLLLLLLLLLL LLLL LLVL LLLL LLLL
    12   12 A V  E     -d  118   0B  28 1197   47       VVVVVVL   V   V  VVV VVVVVVVVVV   RRVVVVVVVVV VVVV VVKA AVVV QQQQ
    13   13 A K    >   -     0   0  145 1201   50       KKKQKKK   A   K  QQQ KKKKKKKKQQ   QQQKKKQKQLK QQKK KQRQ KQQQ QQQQ
    14   14 A P  T 3  S+     0   0   70 1203    8       PPPPPPP   P   P  AAA PPPPPPPPPP   PPPPPPPPPPP PPPP PPPP PPPP PPPP
    15   15 A G  T 3  S+     0   0   59 1209   28       SSSGSSS   S   S  GGG SSSSSSSSSS   GGGSSSGLGGT GGSS SGGG GGGG GGGG
    16   16 A A    <   -     0   0   36 1213   63       EQQGEQE   Q   E  GEG EQQQQQQQQQ   GGGQQQGQGGQ GGQQ QGEG AGGR GGGG
    17   17 A S        -     0   0   66 1210   29       TSTSTTT   S   T  SSS TTTTTTTTSS   SSSTTT.TSST SSTT TSTS FCSS SSSS
    18   18 A V  E     - B   0  83A  10 1213   32       LLLLLLL   L   L  LLL LLLLLLLLLL   LLLLLLLLLLL LLLL LLVL LLLM LLLL
    19   19 A K  E     - B   0  82A 119 1211   53       SSSRSSS   S   S  TKR SSSSSSSSSS   RSRSSTRSMRS RRSS SRKR RKRK RRRR
    20   20 A L  E     - B   0  81A   0 1214   21       LLLLLLL   I   L  LLL LLLLLLLLII   LLLLLVLLLLL LLLL LLML LLLL LLLL
    21   21 A S  E     - B   0  80A  31 1215   35       STTSTTS   T   T  SSS TTITTTTTTT   SSSTTTSTSST SSTT TSSS TSSS SSSS
    22   22 A a  E     -AB   6  79A   0 1216    0       CCCCCCC   C   C  CCC CCCCCCCCCC   CCCCCCCCCCC CCCC CCCC CCCC CCCC
    23   23 A K  E     -AB   5  78A 113 1216   70       TSSATTA   T   A  AAA TTTTTSTTTT   KKASSTATAAS AATT TATA AAAV KKKK
    24   24 A A  E     +A    4   0A   2 1216   49       VVVAVVV   V   V  AAA VVVVVVVVVV   AAAVVVAVAAV AAVV TAIA AATA GAGG
    25   25 A S  E     +A    3   0A  49 1216   12       STTSSSY   S   S  SSS SSSSSSSSSS   SSSSSSSSSSS SSSS SSSS SSSS TTTT
    26   26 A G  S    S+     0   0   56 1215    3       GGGGGGG   G   G  GGG GGGGGGGGGG   GGGGGGGGGGG GGGG GGEG GGGG GGGG
    27   27 A Y  S    S-     0   0   39 1216   33       GYDFGGG   F   G  PNR AFLFFLFFFF   LLFFFFFYFFY FFFF FFFF FFFF FFFF
    28   28 A T    >   -     0   0   90 1216   52       SSSTSSS   A   S  MTA SSSSSSSSSS   TTTPSSTSTTS TTSS STDT TTTT DTTT
    29   29 A F  G >  S+     0   0   13 1216   27       IIIVVIF   L   I  SFS IFLLLLLLLL   YNFIILFIFFI FFLL LFMF FFFF FFLF
    30   30 A T  G 3  S+     0   0   40 1216   55       STTSSGS   T   S  SSS RSSTATTTTT   SSSTTTSTSST SSTT TSTS SSSS SSTS
    31   31 A S  G <  S+     0   0   23 1216   57       sSsNnsG   S   S  sgg SnSssNSsTT   SYSttSssSSt SSSs SSSd DNDN sSSS
    32   32 A Y  E <  S-E  100   0B  40 1139   28       ygyYyyY   Y   Y  vfy Y.Y..HY.YY   YYYyyY.yYYy YYY. YYYy YYFY .F.F
    33   33 A W  E     -E   99   0B  40 1148   92       Yy.GYFY   A   Y  ..G YaGadGGaGG   YYA.AHgCHDY YWPg GGY. WRYW rRAN
    34   34 A M  E     -EF  98  51B   0 1206   49       WWWIWWW   I   W  MMM WVVVIVVVII   MMMWWMMWMMW MMVV VMIM MMMM VMMM
    35   35 A H  E     -EF  97  50B   0 1212   72       GNNHGSN   S   S  SGG TGTGTGADHH   HHGNSHNNNNS HHHH SSHD SSEN METF
    36   36 A W  E     -EF  96  49B   0 1216    0       WWWWWWW   W   W  WWW WWWWWWWWWW   WWWWWWWWWWW WWWW WWWW WWWW WWWW
    37   37 A V  E     -EF  95  47B   0 1216   17       IIIVIII   V   I  FYF LVVVVVVVVV   VVVIIIVIVVI VVMI VVIV VVVV VVVI
    38   38 A K  E     -EF  94  46B   7 1216   22       RRRRRRR   R   R  RRR RRRRRRRRRR   RRRRRRRRRRR RRRR RRRR HRRR RRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5       QQKQQQQ   Q   Q  QQQ QQQQQQQQQQ   QQQQQQQQQQQ QQQQ QQQQ QQQQ QQQQ
    40   40 A R    >   -     0   0   35 1216   71       PFFAPAP   P   T  AAV TAAAAAAAPP   AAAPSPAPAAP AAAA AARA AATS AAAA
    41   41 A P  T 3  S+     0   0  130 1215   15       PPPPPPP   P   P  PPP PPPPPPPPPP   PPPPPLPPPPP PPPP PPPP PPPP PPPP
    42   42 A G  T 3  S+     0   0   83 1216   22       EGGGGGG   G   G  GGG GGGRGGGGGG   GGGGGWGGGGG GGGG GGGG GGGE GGGG
    43   43 A R  S <  S-     0   0  156 1216   43       KNNKKRK   K   K  KKK KKEKRKKKKK   KKKKKKKKKKK KKKK KKKK KKKK KKKK
    44   44 A G        -     0   0   16 1215   36       GKKGGGG   G   R  EQE GTAAAAAVGG   GGGGGGGGGGG GGGG AGAG GGRG GGGG
    45   45 A L  E     -F   39   0B   8 1215   10       LLLLLLL   L   L  QRR LLPLLLLPLL   LLLLLLLLLLL LLLL LLLL LLLL LLLL
    46   46 A E  E     -F   38   0B  34 1216    6       EEDEEEE   E   E  EEE EEEEEEEEEE   EEEEEEEEEEE EEEE EEEE EEEE EAEE
    47   47 A W  E     -F   37   0B   3 1216   10       WWYWWWW   W   W  FLF WWWWWWWWWW   WWWWWWWWWWW WWWW WWWW WWWW APWH
    48   48 A I  E     -     0   0B   0 1215   31       IMMIIMI   L   I  VVV IVLVILLLLL   VVVMMMVIVVI VVVV LVIV VVIV VVVV
    49   49 A G  E     -FG  36  60B   0 1216   35       GGGSGGG   G   G  AAA GGGSTGGGGG   AASGGGAGAAG ASGG GSGS GSAA AAAA
    50   50 A R  E     -FG  35  59B  32 1216   94       SYYFSYE   V   N  RTA FNASCCGGVV   RQTCNRVRIYY yLVG GYLR QYaE GVSE
    51   51 A I  E     -FG  34  58B   0 1207   17       LIILIII   I   F  III VITILLIIII   VVIIIIIIIII iIVV IIMI IIsI IIII
    52   52 A D     >  -     0   0   26 1212   86       HSNSYYN   W   H  RNR YWRGAYWSWW   YHYWWNWCWSS SSWW DSNR NNKR YEDS
    53   53 A P  T  4 S+     0   0    0 1212   83       NYYYYYH   T   Y  WSW DSKTRNRGSS   HKNYYNSSNIS SSGY SSAN PSAL NKYS
    54   54 A N  T  4 S-     0   0   96 1213   69       SDSTNSS   G   S  SRS GDNSDDDRNN   DDGDDNDSDPS DDGD GSGK NDHK DDRG
    55   55 A G  T  4 S-     0   0   69 1216   57       GGGTEGG   G   G  GGG GGGGGGGGGG   GGGGGGGGGsG ggGG GSSa GGDs GGNG
    56   56 A G     <  +     0   0   25  915   61       ...D...   .   .  G.K ..........   NG....S.Ss. ns.. .SNy G.Yy SR..
    57   57 A G        -     0   0   43 1195   77       SSDTNSS   V   S  TIE RSDGRDKSRR   YSSNSDQNQSS YYSS SYST STRA GMNS
    58   58 A T  E     -G   51   0B  62 1209   46       DHTITTT   T   T  STT TTTLTTTTII   ITTTTTKTKTT IIIT TIAT TATI TTAT
    59   59 A K  E     -G   50   0B  89 1212   88       YNYHYYN   N   N  YNW KYNYWGNYDD   GKYYYYYYYYY NYYH GYIE YYEH YWWY
    60   60 A Y  E     -G   49   0B  46 1215    9       YYYYYYY   Y   D  YYY YYYYYYYYYY   YYYYYYYYYYY YYYY YYYY FYYY YYYY
    61   61 A N    >>  -     0   0   12 1216   63       NNNASNN   N   N  AAV NNSNNNDNNN   AAASNSASAAS AANN NAGA TASA AAAA
    62   62 A E  G >4 S+     0   0  148 1216   64       PPPDPPP   S   P  NDD PPPPPPPSAA   DDDPPPDPDDP AAPP PDSA DDAE SPSD
    63   63 A K  G 34 S+     0   0  109 1216   64       SSSSSSS   A   S  SFS SATAAAAAAA   SSSSSSSSSAS SSTT GSSS SSSS SASA
    64   64 A F  G X> S+     0   0    5 1216   45       LLLVLLL   L   L  VVV LLLLLLFLFF   VVVLLLVLVVL VVLL LVFV VVVV VVVV
    65   65 A K  T << S+     0   0  156 1216   40       KKKKKEK   K   K  EKK RKKKKKQKII   KKKKKKKKKKK KKKK KKKK KKKK KEQK
    66   66 A S  T 34 S+     0   0  108 1216   35       SNSGSSS   S   S  GGG SSSSSSSSSS   GGGSSSGSGGS GGSS SGSG GGGG GGGG
    67   67 A K  T <4 S+     0   0   33 1214   21       RRRRRRR   R   R  RRR RRRRRRRRRR   RRRRRRCRRRR RRRR RRGR WRRR RRRR
    68   68 A A  E  <  -C   83   0A   2 1216   69       VIIFLLV   L   L  FFF VLLLLLLLLL   FFFTTTFTFFT FFLL LFYF SFFF FFFF
    69   69 A T  E     -C   82   0A  58 1216   37       TSSTTST   S   T  TTT SSSSSSSSSS   TTTSSSTSTTS TTSS STVT TTIT TTTT
    70   70 A L  E     +C   81   0A   7 1216   27       IIIIIII   I   M  III IIIIIIIIII   IIIIIITIIII IIII IIMI IIVI IIII
    71   71 A T  E     -C   80   0A  57 1213   47       STTSFSS   S   S  SSS STTTTTTTTT   SSSSSSSSSSS SSTT TSTS SSSS SSSS
    72   72 A V  E     -C   79   0A  28 1216   71       VRARVIV   K   A  RRR LRRRRRRRKK   WWRRRRRRRRR RRRR RRER RRRR RRRR
    73   73 A D  E   > -C   78   0A  69 1216    7       DDDDDDD   D   D  DDD DDDDDDDDDD   DDDDDDDDDED DDDD DDDD DDDD DDDD
    74   74 A K  T > 5S+     0   0  105 1216   62       TTTNTTT   N   T  NNN TTTTTTTTNN   KKNTTTNTNNT NNTT NNVD NNTD NDNT
    75   75 A P  T 3 5S+     0   0  122 1215   37       SSSASSS   S   S  AAA VSSSSSSSSS   ASASSSASAAS AASS SASS AASS GGGG
    76   76 A S  T 3 5S-     0   0   37 1216   65       KKKKKKK   K   K  KKK KKKKKKKEKK   NSKKKKKKKKK KKKK KKSK KKQK QQQQ
    77   77 A S  T < 5 +     0   0   24 1216   48       NNNNNNN   S   N  NKS KSSSSSSSSS   SSNNNNNNNNN NNSS SNSN NNSS SSSS
    78   78 A T  E   < -BC  23  73A   8 1216   64       QQQSHQQ   Q   Q  TTT QQQQQQQQQQ   LLSQQQTQTSQ TTQQ QSTT TSVS MMTT
    79   79 A A  E     -BC  22  72A   0 1207   67       FFYLFFL   V   L  MVV VVVVVVVLVV   LLLFFVLFLLF LLVV VLQL LLLV GVLL
    80   80 A Y  E     -BC  21  71A  61 1209   36       SFYYSSS   F   S  YYY SSSSSSSSFF   SSYSSSYSHYS YYYY SYYY YYYY YYYY
    81   81 A M  E     -BC  20  70A   0 1212    9       LLLLLLL   L   L  LLL LLLLLLLLFF   LLLLLMLLLLL LLLL LLLL LLLL LLLL
    82   82 A Q  E     -BC  19  69A  69 1215   43       RKQQRRK   K   R  QEQ NSSTSSSSKK   QQQQQQQQQQQ QQTT SQQQ QQQQ QQQQ
    83   83 A L  E     -BC  18  68A   0 1215   14       LLLMLLL   M   L  MMM LLLVLLLLMM   MMMLLLMLMML MMLL VMIM MMMM MMMM
    84   84 A S        +     0   0   32 1215   56       SNNNTNS   N   R  NNN GSSSRSSSNN   NNNSSSSSNSS SSNN SNSS NNNN DNNN
    85   85 A S  S    S-     0   0   89 1216   25       SSSSSSS   S   S  KSS SSSGSSSSSS   SSSSSSNSSSS SSSS SSSS SSAN SSDS
    86   86 A L        +     0   0    2 1216   15       VVVLVLV   L   V  LLL VVVVVVVVLL   LLLLVVLILLV LLLL VLLL LLLL LLLL
    87   87 A T    >   -     0   0   61 1215   68       TTTRTTT   Q   T  KEK TSTTTTTTQQ   KKRTTIRTRRT RKRR TRTK KRRR KKKK
    88   88 A S  G >  S+     0   0   72 1216   59       AITDAAA   T   A  PPP SITTTTTADD   TTASTTATAAT AAAA PAAT TAAA AAAA
    89   89 A E  G 3  S+     0   0  107 1216   21       AEEEAAA   N   A  EEE ADEEEEDDDD   EEEEEEEEQEE EEEE EEEE EEEE EEEE
    90   90 A D  G <  S+     0   0    7 1216    3       DDDDDDD   D   D  DDD DDDDDDDDDD   DDDDDDDDDDD DDDD DDDD DDDD DDDD
    91   91 A S    <   +     0   0   31 1216   34       TTATTTT   T   T  TTT ATTATTTTTT   TTTTTTMTSTT TTTT TTST TTTT TTTT
    92   92 A A  E    S- H   0 116B  10 1214    5       AAAGAAA   A   A  AAA GAAAAAAAAA   AAAAAAAAAAA AAAA AAAA AAAG AAAA
    93   93 A V  E     -EH  39 115B  21 1216   48       VTTFVVV   R   V  VVV VVVVVLVVII   LLVVVVMVMVM VLVV TVVV VVTI TTTT
    94   94 A Y  E     -EH  38 114B   0 1216    1       YYYYYYY   Y   Y  YYY YYYYYYYYYY   YYYYYYYYHFY YYYY YYFY YYYY YYYY
    95   95 A Y  E     -E   37   0B   1 1216    3       YYYYYFY   Y   Y  TYY YYYYYYYYYY   YYYYYYYYYYY YYYY YYFY YYYY YYYY
    96   96 A a  E     +E   36   0B   0 1216    1       CCCCCCC   C   C  CCC CCCCCCCCCC   CCCCCCCCCCC CCCC CCCC CCCC CCRC
    97   97 A A  E     -EI  35 110B   0 1215   24       AAGVVAA   A   A  AYA AAVAGATVAA   AAAAAAAAAVA AAAA AAAA TATS AAAV
    98   98 A R  E     -E   34   0B  13 1196   38       RRGRRRR   R   R  LTV RRGRRTERRR   TARRRRRRRRR RRRR KRRR KRRT IKKK
    99   99 A M  E     -EI  33 107B   5 1101   82       LPGSHGG   D   V  THR NDGIDRIGNN   DDDGRDYDNHH DDNN DDED DHDG DGAC
   100  100 A W  E >   -E   32   0B  89 1101   89       gLlavVe   S   A  qYp aeWsgnAdVV   titttTtttSs tttt ttTt isaF psaA
   101  101 A Y  T 3  S+     0   0  112  572   91       ....g.v   .   K  ... dw...y.g..   .i......f.y q.eh ...h ..s. g.y.
   102  102 A Y  T 3  S-     0   0  133  629   92       .Y..P.V   N   L  ... GTS..YYY..   .T...H..H.I V.GA ..HI ..Y. W.I.
   103  103 A G  S <  S+     0   0   38  705   79       .y..Y.p   y   F  .f. fyW..sYYYY   .F...f..T.h L.GY ..yF ..F. G.Cg
   104  104 A T        -     0   0   32  784   66       gytgGga   g   g  gsr pgagsgggdd   esgg...g.e. pggp gs.S ggGP gg.g
   105  105 A Y        +     0   0   81  679   93       .y.i.ty   .   t  f.p Y.vpsgigtt   .phsssdv..h tcss R.d. fh.. adLa
   106  106 A Y        -     0   0   32  842   66       .y.WWAY   .   y  y.v Y.yyDYYWWW   .WHYYWNC..F HHCf HFCF fYY. ASnA
   107  107 A F  E     +I   99   0B   0  885   48       fmMVFFM   m   m  v.f FiviII.IFF   TE....F..kF L..k .F.F lPF. .IiI
   108  108 A D  E     +     0   0B  25  997   46       DDDDDDD   D   D  D.D HDEDDD.DTT   TDSPP.LQ.LP SR.D .V.L SCD. .DDD
   109  109 A Y  E     -J  168   0C 108 1059   61       FYYPPIV   Y   V  YYY HYYYYYSYYY   FFGFF.TI.IV VC.H .FQT SVVS .AAA
   110  110 A W  E     -I   97   0B  23 1092    2       WWWWWWW   W   W  WWW WWWWWWWWWW   WWWWWWWWWWW WWWW WVWW WWWW WWWW
   111  111 A G        -     0   0    3 1067   15       GGGGGG    G   G  GGG GGGGGGGGGG   AASTTGT TA  ANA  ATSN CGGG GGGG
   112  112 A Q        -     0   0  141 1047   41       HQQQQQ    Q   Q  QQQ QPPPPPPPQQ    AQ  QK KQ  RDQ  VR A ARAP RRRR
   113  113 A G        -     0   0   20 1013   12       GGGGGG    G   G  GGG GGGGGGGGGG    AV   G GG   KG  GG N GGGG GGGG
   114  114 A T  E     - H   0  94B   2  996   31       TTTTTT    T   T  TTT TLLLLLLLTT     E     RF   TF   N A A TT TTTT
   115  115 A T  E     - H   0  93B  60  979   76       M SLLV    S   T  QQQ PLLLLLLLLL     A     IP   FP   I S S TL SSSS
   116  116 A L  E     -dH  10  92B   1  972   19       V VVVV    V   V  VVV VVVVVVVIVV     V     LL   TL   L V A VV VVVV
   117  117 A T  E     -d   11   0B  57  953   21       T TTTT    T   I  TTT STTTTTTTTT     A      K   TK   T   G TT TTTT
   118  118 A V  E     +d   12   0B   4  935    8       V VVVV    V   V  VVV VVVVIAVVVV     S      L   LL   S   A VV VVVV
   119  119 A S              0   0   64  917   10       S SSSS    S   S  SSS SSSSSSSSSS     E      S   TS   T   S S  SSSS
   120  120 A S              0   0  122  885   21       S SSSS    S   S  SSS SSSSSSSSAA     S      A   SA         S  SSSS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32  QQQ         EDQ   E  D   Q            Q           Q    Q         D    
   123    2 B A        -     0   0   19  713   70  SSS S       NIS   I TI   S            S           S    S         I    
   124    3 B V        -     0   0   84  765   49  VVA L       VVA   V VQ   A            V           V    V         T    
   125    4 B V  E     -Q  145   0D  10  820   26  LLLLL       LLL   M VL   L          LLL           L    L    L    M    
   126    5 B T  E     +Q  144   0D  69  829   11  TTTTN       TTT   T TT   T          TTT           T    T    T    T    
   127    6 B Q  E     -Q  143   0D  18  832    2  QQQQQ       QQQ   Q QQ   Q          QQQ           Q    Q    Q    Q    
   128    7 B E        -     0   0   59  833   63  PPPPE       SSP   S ES   P          PPP           P    P    E    S    
   129    8 B S  S    S+     0   0  101  841   38  PPPPP       PPP  TP PP   A          RRP           S    S    P    P    
   130    9 B A  E     -k  226   0C  59  842   50  SSRSS       AAS  TA SA   S          SSS           S    S    A    S    
   131   10 B L  E     -k  227   0C  57  847   76  AAVLV       IIV LMT LI   V          VVA           V    V    L    Y    
   132   11 B T  E     +k  228   0C  84  848   77  SSSSF       MMS LAL SM   S          SSS           S    S    S    L    
   133   12 B T  E     -k  229   0C  18  848   68  GGGVS       SSA VAS VS   G          VVE           G    G    V    S    
   134   13 B S    >   -     0   0   55  849   70  TTSSI       aaA SSv Sa   S          SSA           A    S    A    k    
   135   14 B P  T 3  S+     0   0   61  848   65  PPPPP       ppP APp Pp   P          PPA           P    P    L    p    
   136   15 B G  T 3  S+     0   0   46  850    7  GGGGG       GGG GGG GG   G          GGR           G    G    G    G    
   137   16 B E    <   -     0   0  108  850   56  QGQQW       EEQ DEE WE   Q          QQK           E    Q    H    E    
   138   17 B T  E     - R   0 199D  88  850   66  RRSTA       KKK RKR TK   S          TTS           R    K    T    R    
   139   18 B V  E     - R   0 198D  14  850   33  VVVAV       VVV VIA VV   I          ASV           V    V    V    V    
   140   19 B T  E     - R   0 197D  53  849   41  TTTST       TTT TTT TT   T          RRT           T    T    R    T    
   141   20 B L  E     - R   0 196D   0  849   25  IIIIL       MMI IIL LM   I          III           I    I    M    I    
   142   21 B T  E     - R   0 195D  22  849   52  SSSTS       TTS TTS TT   S          TTS           S    S    T    T    
   143   22 B b  E     -QR 127 194D   0  850    2  CCCCC       CCC CCC CC   C          CCC           C    C    C    C    
   144   23 B R  E     -Q  126   0D 133  850   77  FSTSS       SRS KSW GS   T          GGS           T    T    Q    R    
   145   24 B S  E >   -QS 125 148D  11  850   68  GGGGL       AAG AAA LA   G          GGG           G    G    G    A    
   146   25 B S  T 3  S+     0   0   81  850   27  SSSDS       SST SSS SS   T          DDS           S    S    D    S    
   147   26 B T  T 3  S-     0   0   87  850   71  SSYKT       SSS QSQ SS   S          NNS           S    S    S    Q    
   148   27 B G  B <  S+S  145   0D  39  850   55  SSSLG       SSS SSS GS   S          IIS           S    S    L    G    
   149   28 B A        -     0   0   40  390   77  .NN.A       ... ... S.   D          ..N           N    N    .    .    
   150   29 B V        -     0   0    3  620   45  NVV.I       ..N ... v.   V          ..I           I    I    .    .    
   151   30 B T    >   -     0   0   56  541   72  IGT.T       .VI .I. d.   G          ..G           G    G    .    .    
   152   31 B T  G >  S+     0   0   94  694   78  GSGGT       .SG VSI PV   S          ..S           G    G    .    I    
   153   32 B S  G 3  S+     0   0   84  802   62  RNYES       VSN SSS GS   Y          ggN           G    N    k    S    
   154   33 B N  G <  S-     0   0   13  673   73  YZNQN       SSN NNS ..   N          kk.           N    .    y    S    
   155   34 B Y    <   -     0   0   98  781   50  YPHYY       YYF DYN .Y   L          SSS           Y    N    Y    Y    
   156   35 B A        -     0   0    0  817   59  VAVVP       MLV VLL .M   V          VVV           V    V    A    L    
   157   36 B N  E     -L  212   0C   0  827   79  YYSCS       HHS AHA .N   S          QES           H    N    S    N    
   158   37 B W  E     -LM 211 171C   0  849    0  WWWWW       WWW WWW WW   W          WWW           W    W    W    W    
   159   38 B V  E     -LM 210 169C   0  849   25  YYYYY       YYY YYY IY   Y          YYY           Y    Y    Y    Y    
   160   39 B Q  E     -LM 209 168C  10  849   10  QQQQL       QQQ QQQ QQ   Q          QQQ           Q    Q    Q    Q    
   161   40 B E  E     -LM 208 167C  20  849    8  QQQQQ       QQQ QQQ QQ   Q          QQQ           Q    Q    Q    Q    
   162   41 B K  E  >  - M   0 166C  68  849   50  LLDKK       KKF KKK TK   H          KKL           L    L    K    K    
   163   42 B P  T  4 S+     0   0   98  843   23  PPPP.       SSP PPP PS   P          PPP           P    P    P    P    
   164   43 B D  T  4 S-     0   0  148  846   16  GGGG.       GGG GGG GG   G          PPE           G    G    G    G    
   165   44 B H  T  4 S+     0   0   90  845   66  TTKQ.       TAT QFQ QT   K          QQA           K    K    Q    Q    
   166   45 B L  E  <  - M   0 162C  92  846   57  TAVS.       SSA SSA VS   A          AAA           A    A    V    S    
   167   46 B F  E     + M   0 161C   9  847   19  PPPP.       PPP PPP PP   P          PPP           P    P    P    P    
   168   47 B T  E     -JM 109 160C  56  843   61  KKKV.       KKK KKR RK   K          VVK           K    K    V    K    
   169   48 B G  E     + M   0 159C   1  848   64  LLLL.       RLL LLL TR   L          LLL           L    L    L    R    
   170   49 B L  E     +     0   0C   4  848   24  LLMV.       WWL LLL LW   M          VVL           L    I    V    L    
   171   50 B I  E     +NM 177 158C   0  848   19  IIII.       III III II   I          III           I    I    I    I    
   172   51 B G  E  >  +N  176   0C   0  849   33  YYYYP       YYY YYY YY   Y          YYY           D    Y    Y    Y    
   173   52 B G  T  4 S-     0   0    9  848   87  KNDHG       DSD YRG RD   E          EEY           G    G    G    G    
   174   53 B T  T  4 S+     0   0    9  849   68  DYVDS       TTN ATA TT   G          DDN           D    S    N    A    
   175   54 B N  T  4 S+     0   0  102  841   49  NNDSN       SSN SSS SS   S          SSD           N    S    N    S    
   176   55 B N  E  <  -N  172   0C  77  849   69  QQKKK       KNK NNT SK   K          EER           I    G    Y    N    
   177   56 B R  E     -N  171   0C 113  850   66  RRRRR       LLR RLR HL   R          RRR           R    R    R    L    
   178   57 B A    >   -     0   0    1  849   73  PPPPP       AAP YAA LA   P          PPA           P    P    P    Q    
   179   58 B P  T 3  S+     0   0   97  849   39  SSSSS       SSS TST SS   S          SSS           S    T    S    S    
   180   59 B G  T 3  S+     0   0   83  850   18  GGGGG       GGG GGG GG   G          GGG           G    G    G    G    
   181   60 B V  S <  S-     0   0   13  848   23  VVVII       VVV VVI VV   V          IIV           V    V    I    V    
   182   61 B P    >   -     0   0   57  850    9  PPPPP       PPP PPP PP   S          PPS           P    P    P    P    
   183   62 B A  T 3  S+     0   0   77  850   59  DDDEA       AAD DTA SA   N          EED           D    D    G    S    
   184   63 B R  T 3  S+     0   0   58  850    5  RRRRR       RRR RRR RR   R          RRR           R    R    R    R    
   185   64 B F  E <   +T  198   0D   4  850    1  FFFFF       FFF FFF FF   F          FFF           F    F    F    F    
   186   65 B S  E     -T  197   0D  51  849   17  SSSSS       SSS TSS FT   S          SSS           S    S    S    S    
   187   66 B G  E     +T  196   0D   9  850    4  GAGGG       GGG GGG RG   G          GGG           G    G    V    G    
   188   67 B S  E     -T  195   0D  41  850    7  SSSSS       SSS SSS SS   S          SSS           S    S    S    S    
   189   68 B L  E     -T  194   0D  59  835   79  KRKNI       GGK GGG IG   K          NNE           T    R    W    V    
   190   69 B I  E >   -T  193   0D  86  842   31  SSSSS       SSS YSS SS   S          SSS           S    S    S    S    
   191   70 B G  T 3  S-     0   0   67  850   18  GGAGS       GGG GGG GG   G          GGG           G    G    G    G    
   192   71 B N  T 3  S+     0   0  105  828   57  TTNTN       NTT TTT NT   N          NNT           S    S    N    T    
   193   72 B K  E <  S- T   0 190D  68  833   67  SSTTD       SSS DSE KS   A          TTS           S    S    T    D    
   194   73 B A  E     -RT 143 189D   0  838   81  AAAAA       YYA FYF AY   A          AAA           G    A    G    F    
   195   74 B A  E     -RT 142 188D   0  849   57  SSSTD       SST TST AS   S          TTS           T    S    S    T    
   196   75 B L  E     -RT 141 187D   0  850    2  LLLLL       LLL FLL LL   L          LLL           L    L    L    L    
   197   76 B T  E     -RT 140 186D  19  850   33  AATTT       TTG TTT TT   T          TTA           T    T    T    T    
   198   77 B I  E     -RT 139 185D   0  849    5  IIIII       III III II   I          III           I    I    I    I    
   199   78 B T  E    S+R  138   0D  78  850   46  SSSST       SST SGS MS   S          SSS           T    T    T    S    
   200   79 B G  S    S-     0   0   15  850   57  GGGGG       SSG TTS GN   G          GGG           G    G    A    S    
   201   80 B A        -     0   0    0  849   51  LLLTV       TML VML AM   L          VVL           L    L    A    L    
   202   81 B Q    >   -     0   0   80  849   32  RQQQQ       EEQ QEQ QE   Q          EEQ           Q    Q    Q    E    
   203   82 B T  G >  S+     0   0   84  850   59  SSAAV       GAT AAS PA   A          AAT           A    A    V    P    
   204   83 B E  G 3  S+     0   0   99  850   17  EENME       EEG EEE KE   E          GGE           E    E    E    E    
   205   84 B D  G <   +     0   0    1  850    2  DDNDD       DDD DDD DD   D          DDD           D    D    D    D    
   206   85 B E    <   +     0   0   71  849   74  EEEED       AAE LVF EA   E          EEE           E    E    E    F    
   207   86 B A  E    S- O   0 227C   3  850   14  AAAAA       AAA AAA AA   A          AAA           A    A    A    A    
   208   87 B I  E     -LO 161 226C  55  850   71  DDDDD       TTD VTI DT   D          DDD           D    D    D    T    
   209   88 B Y  E     -LO 160 225C   0  850    0  YYYYY       YYY YYY YY   Y          YYY           Y    Y    Y    Y    
   210   89 B F  E     -L  159   0C   5  848    8  YYYYY       YYY FYH YY   Y          YYY           Y    Y    Y    Y    
   211   90 B b  E     -L  158   0C   0  849    1  CCCCC       CCC CCC CC   C          CCC           C    C    C    C    
   212   91 B A  E     -LP 157 221C   0  848   73  AASQA       QQG QQQ AQ   Q          QQA           Q    S    N    L    
   213   92 B L  E     - P   0 220C   0  845   83  AASAV       QQT QQQ LQ   S          VVA           S    A    S    Q    
   214   93 B W  E     + P   0 219C  21  834   71  WWYWY       WYW DGY DW   Y          WWW           F    W    W    Y    
   215   94 B Y  E >  S- P   0 218C  33  829   88  DDGDM       SHD YSN MS   D          DDD           D    D    D         
   216   95 B S  T 3  S-     0   0  106  829   66  DDGSG       SST SSS GS   S          SSD           D    S    S         
   217   96 B N  T 3  S+     0   0  105  824   81  ssTyS       Nyr siw sn   s          sts           D    S    S         
   218   97 B H  E <   -P  215   0C  39  647   66  .dy..       Pra rrp sp   .          hhs           .    .    .         
   219   98 B L  E     -P  214   0C   1  382   85  wylv.       P.G .YL ..   v          RRw           .    .    .         
   220   99 B V  E     -P  213   0C  12  489   66  VVII.       TTV TTT .T   V          VVV           .    .    .         
   221  100 B F  E     -P  212   0C  17  540   30  FFFF.       FFF FFF YF   F          FFF           L    L    .         
   222  101 B G        -     0   0    1  481   35  GGGG.       GGG GGG .G   G          GGG           G    S    .         
   223  102 B G        -     0   0   51  513   58  GTGGS       GGG GGG .G   G          GGG           T    G    .         
   224  103 B G        -     0   0    8  528   33  GGGGG       GGG GGG .G   G          GGG           P    A    G         
   225  104 B T  E     - O   0 209C   0  550   33  TTTT        TTT TTT .T   T          TTT           T    T    T         
   226  105 B K  E     -kO 130 208C  82  547   67  TKKK        KKK KKK TK   K          RRR           V    V    H         
   227  106 B L  E     -kO 131 207C   0  546   44  LVLL        LLL LLV AL   L          LLL           L    L              
   228  107 B T  E     -k  132   0C  34  614   65  TTTT        EET EEE TE   T          TTT           Q    Q              
   229  108 B V  E     -k  133   0C   3  593   35  VVVV        IIV III VI   V          VVV                               
   230  109 B L              0   0  120  399   31  LLLL          L     M    L          LLL                               
   231  110 B G              0   0   62  207   39  S GG                                GGG                               
## ALIGNMENTS 1121 - 1190
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    1 A E              0   0  185  771   30  DDQ                        EDEEEEEE              DDD QQE   D Q DQ  QQQ
     2    2 A V        +     0   0   18  834   19  IVV                        VVEEEEEE              VVVVVIV   V V VV  VVV
     3    3 A Q  E     -A   25   0A  90  836   34  QQQ                        QQKKKKKK              QQQQHTK   Q Q QK  QQQ
     4    4 A L  E     -A   24   0A  13  881    3  LLL                        LLVLLLLL             LLLLLLLL   L L LLL LLL
     5    5 A Q  E     -A   23   0A 107  882   70  VVQ                        VAVVVVVV             QQQAQVDD   Q V QQE QQQ
     6    6 A Q  E     -A   22   0A  14  887   31  EEE                        EQEEEEEE             EEEQEEQE   E E EEQ EEQ
     7    7 A S        -     0   0   33  892   13  SSS                        SSSSSSSS             SSSSSSPT   S S SSS SSS
     8    8 A G        -     0   0   52  907   11  GGG                        GDGGGGGG             GGGEGGGG   G G GGG GGG
     9    9 A A        -     0   0   80 1179   51  GGPPPPPPP PPPP PPGG        GPGGGGGG             PPPSPGSG   P G PPG GGG
    10   10 A E  E     -d  116   0B  68 1189   46  DDGGGGGGG GGGG GGGG        DVGGGGGG             GGGVGGTG   G G GGG GGG
    11   11 A L  E     +d  117   0B 130 1195   22  VLLLLLLLLLLLLL LLLL        LVLLLLLL             TLLVLVLL   L L LLV LLL
    12   12 A V  E     -d  118   0B  28 1197   47  RRVVVVVVVVVVVV VVVV        VIVVVVVV             VVVIVVVV   V V VVV VVV
    13   13 A K    >   -     0   0  145 1201   50  QQKAAAAAQAKAAQ AAQQ        KKQQQQQQ             KKKKKQKQ   K K KAQ QQQ
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPPPPPPPPPPPPPPPP        PPPPPPPP             PPPPPPPP   P P APP AAT
    15   15 A G  T 3  S+     0   0   59 1209   28  GGSSSSSSSSSSSSSSSKG        GGGGGGGG             SSSGSGSG   S G SSG GGG
    16   16 A A    <   -     0   0   36 1213   63  GGEQQQQQQQQQQQQQQGE        GGGGGGGG             EQQGQRDR   Q G SQR GGG
    17   17 A S        -     0   0   66 1210   29  SSTSSSSSSSTSSSSSSSS        SSSSSSSS             SSSSSSTP   S S ASS SSS
    18   18 A V  E     - B   0  83A  10 1213   32  LLLLLLLLLLVLLLLLLLL        LHLLLLLL             LLLHLLLM   L L LLL LLL
    19   19 A K  E     - B   0  82A 119 1211   53  KRSSSSSSSSSSSSSSSKK        RKRRRRRS             RSSKSRKK   S R SSR RRR
    20   20 A L  E     - B   0  81A   0 1214   21  LLLIIIIIIILIIIIIILL        LLLLLLLL             LLLLLLIL   L L LIL LLL
    21   21 A S  E     - B   0  80A  31 1215   35  SSTTTTTTTTTTTTTTTSS        SSSSSSSS             TTTSTSAS   T S TTS SSS
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCCCCCCCCCCCCCCCC        CCCCCCCC             CCCCCCCC   C C CCC CCC
    23   23 A K  E     -AB   5  78A 113 1216   70  KKATTTTTTTTTTTTTTAE        VTGVVVVV             TSSTSAKV   S A STA AAA
    24   24 A A  E     +A    4   0A   2 1216   49  AAVVVVVVVVVVVVVVVAS        AAGGGGGG             VVVPVALA   V A VVA AAA
    25   25 A S  E     +A    3   0A  49 1216   12  SSSSSSSSSSTSSSSSSSN        SSSSSSSS             STTSTFSS   T S TSS SSS
    26   26 A G  S    S+     0   0   56 1215    3  GGGGGGGGGGGGGGGGGGE        GGGGGGGG             GGGGDGVG   G G GGG GGG
    27   27 A Y  S    S-     0   0   39 1216   33  FLGFFFFFFFIFFFFFFFY        FFFFFFFI             FYNFFFSF   Y F YFI FRR
    28   28 A T    >   -     0   0   90 1216   52  TTSSSSSSSSSSSSSSSTE        TTTRTDTT             ESSTSTVT   S S SSF TAT
    29   29 A F  G >  S+     0   0   13 1216   27  FYILLLLLLLIPLLLLLFF        FFLFFFGF             LIIFIFSF   I F ILT STS
    30   30 A T  G 3  S+     0   0   40 1216   55  SSSTTTTTTTTTTTTSTNP        SSSSSSSS             RITSTGSG   T S TTL DSH
    31   31 A S  G <  S+     0   0   23 1216   57  SSsSSNSSSDtRSSSRSFS        SGrDSrsS             SssDsDYD   s D sST Dgg
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YYyYYYYYYYyYYCYYYYH        YY.YYyyY             YyyHyHYY   y Y yYY Yyy
    33   33 A W  E     -E   99   0B  40 1148   92  YFYGGGGGGGRGGGGSGAD        YGaTA..A             SYYWYS.W   Y Y YGG AGG
    34   34 A M  E     -EF  98  51B   0 1206   49  MMWVVVVVVVWVVVVVVMM        MMVFVIIV             MWWMWMWM   W M WVI VMM
    35   35 A H  E     -EF  97  50B   0 1212   72  SHGHHHHHHSSSSHNHHNS        EHSSSNNT             DNSNHHTN   N I NHH GGG
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWWWWWWWWWWWWWWWW        WWWWWWWW             WWWWWWWW   W W WWW WWW
    37   37 A V  E     -EF  95  47B   0 1216   17  VVIVVVVVVIIVLVVVVVV        VVVVVVVV             IIIVIVVV   I I IVV FFF
    38   38 A K  E     -EF  94  46B   7 1216   22  RRRRRRRRRRRRRRRRRRR        RRRRRRRR             RRRRRRRR   R R RRR RRR
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQQQQQQQQQQQQQQK        QQQQQQQQ             QQQQQQQQ   Q R QQQ QQQ
    40   40 A R    >   -     0   0   35 1216   71  AAPPPPPPSPFPPSPPPAT        AAAAAAAA             PFFAFATS   F A FPA AVV
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPPPPPPPPPPPPPPPPP        PPPPPPPP             PPPPPPPP   P Q PPP PPP
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGGGGGGGGGGGGGGGGE        GGGGGGGG             GGGGGGGE   G G GGG GGG
    43   43 A R  S <  S-     0   0  156 1216   43  KKKKKKKKKKNKKKKKKKK        KKKKKKKK             KDNKNRKK   N K NKK KKK
    44   44 A G        -     0   0   16 1215   36  GGGGGGGGGGKGGGGGGGR        GGGGGGGG             GKKGKGGG   K G KGG EEE
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLLLLLLLLLLLLLLLL        LLLLLLLL             LLLLLLLL   L L LLL RRR
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEEEEEEEEEEEEEEEE        QHEEEEEE             EEEQEEEE   E E EEE EEE
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWWWWWWWWWWWWWWWL        WWWWWWWW             WWWWWWYW   W W WWW GFL
    48   48 A I  E     -     0   0B   0 1215   31  VVILLLLLLLILLLLLLVV        VVLLLLLL             IMMLMMMV   M L MLV VVV
    49   49 A G  E     -FG  36  60B   0 1216   35  SAGGGGGGGGGGGGGGGAA        ASAAAAAA             GGGSGAGS   G S GGA SAA
    50   50 A R  E     -FG  35  59B  32 1216   94  RRSVVVVVVVYVVVVMVRA        QAGAGRTG             LFYNYLRQ   Y Y YVG CAA
    51   51 A I  E     -FG  34  58B   0 1207   17  IVIIIIIIIIIIIIIIIII        IIIMIIII             VIIIITII   I I IIL III
    52   52 A D     >  -     0   0   26 1212   86  DYYWWWWWWWYWWWWWWRN        SSWSYSSD             YRKYSWTR   N S SWW SRR
    53   53 A P  T  4 S+     0   0    0 1212   83  THYAAAAASGYGGSAGASS        SSNASVTS             SYYDYFSN   Y N YAY SWW
    54   54 A N  T  4 S-     0   0   96 1213   69  ADSGGGGGGGSDDGGGGKD        DDTSSDSV             IDDADDSK   D S DGG GSS
    55   55 A G  T  4 S-     0   0   69 1216   57  GGGGGGGGGGGGGGGGGsG        GGGDGGGs             GGGSGGGp   G G GGT DGG
    56   56 A G     <  +     0   0   25  915   61  SN...............yG        SSLGSGGg             .....S.y   . D ... GKI
    57   57 A G        -     0   0   43 1195   77  SYSSSSSSSSTSSSSSSAS        SSGSSSSS             SSNKSNVE   S M SSN SES
    58   58 A T  E     -G   51   0B  62 1209   46  TITTTTTTTTITTTTTTAT        TTTTTTTA             TNNINNTT   N T NIK TTT
    59   59 A K  E     -G   50   0B  89 1212   88  SGYNNNNNDYTNNDNDNYY        YYFYYFYY             SNSNGYEY   N Y NNN YWY
    60   60 A Y  E     -G   49   0B  46 1215    9  YYYYYYYYYYYYYYYYYYY        YYYYYYYY             IYYYYYHY   Y H YYY YYY
    61   61 A N    >>  -     0   0   12 1216   63  AANNNNNNNNNHHNNNNAP        PAAAAAAA             ANNANATS   N A NNA AKA
    62   62 A E  G >4 S+     0   0  148 1216   64  DDPSSSSSASPSSASSSDD        DDEDDDDD             DPPDPDSD   P D PSE DDD
    63   63 A K  G 34 S+     0   0  109 1216   64  SSSAAAAAAASAAAAAAST        ASSSSFSS             SSSSSSSS   S S SAS SSS
    64   64 A F  G X> S+     0   0    5 1216   45  VVLLLLLLFLLLLFLLLVM        VVVVVVVV             LLLLLVFV   L V LLV VVV
    65   65 A K  T << S+     0   0  156 1216   40  KKKMMMMMIKTIIIMKMRE        KKKLTRKK             KKKKKKQK   K K KMK KKK
    66   66 A S  T 34 S+     0   0  108 1216   35  GGSSSSSSSSSSSSSSSDR        GEGGGGGG             NTNGNGNG   N G NSG GGG
    67   67 A K  T <4 S+     0   0   33 1214   21  RRRRRRRRRRRRRRRRRRR        QKRRRRRR             RRRRRRRR   R R RRR RRR
    68   68 A A  E  <  -C   83   0A   2 1216   69  FFVLLLLLLLTLLLLLLFF        FFFLFFFF             VIIFIFVF   I F ILF FFF
    69   69 A T  E     -C   82   0A  58 1216   37  TTTSSTSSSSTSSSSSSTI        TITTTTTT             TSSTSTTT   S T SST TTT
    70   70 A L  E     +C   81   0A   7 1216   27  IIIIIIIIIIIIIIIIIII        IIIVIIII             IIIIIILI   I L III III
    71   71 A T  E     -C   80   0A  57 1213   47  SSSSSSSSSSTSSSSSSSS        SSSSSSSS             TTTSTSTS   T S TSS SSS
    72   72 A V  E     -C   79   0A  28 1216   71  RWVKKKKKKKRKKKKKKRR        RRRSRRRR             KRRRRRRR   R R RKR TRR
    73   73 A D  E   > -C   78   0A  69 1216    7  DDDDDDDDDDDDDDDDDDD        DDDDDDDD             DDDDDDDD   D D DDD DDD
    74   74 A K  T > 5S+     0   0  105 1216   62  NKTNNNNNNNTNNNNNNDN        NNNNNNND             NTTNTNAD   T N TNN NNN
    75   75 A P  T 3 5S+     0   0  122 1215   37  GASSSSSSSSSSSSSSSST        ANSSSSSS             GSSNSIAS   S T SS. AAV
    76   76 A S  T 3 5S-     0   0   37 1216   65  NNKKKKKKKKKKKKKKKQK        KNQQQQQQ             KKKNKRKK   K K KKS SKK
    77   77 A S  T < 5 +     0   0   24 1216   48  SSNSSSSSSSNSSSSSSSK        NNNNNNNN             KNNNNNNS   N K NSK NTN
    78   78 A T  E   < -BC  23  73A   8 1216   64  LLQQQQQQQQQQQQQQQMT        TKTTTTTT             QQQKQIEG   Q S QQD TTM
    79   79 A A  E     -BC  22  72A   0 1207   67  LLFVVLVVVVFVVVVVVLL        LLAAAAAA             VFFLFLIV   F L FVT VVV
    80   80 A Y  E     -BC  21  71A  61 1209   36  HSSFFFFFFFFFFFFFFYY        YYYYYYYY             YFFYFYYY   F S FFL YYY
    81   81 A M  E     -BC  20  70A   0 1212    9  LLLLLLLLFLLLLFLLLLL        LLLLLLLL             LLLLLLLL   L L LLY LLL
    82   82 A Q  E     -BC  19  69A  69 1215   43  QQKKKKKKKKEKKKKKKQQ        QQQQQQQQ             QRKQKQAQ   K Q KKL QQQ
    83   83 A L  E     -BC  18  68A   0 1215   14  MMLMMMMMMMMLLMMMMMM        MMMIMMMM             MLLMLILM   L M LMM MMM
    84   84 A S        +     0   0   32 1215   56  NNSNNSNNNNNNNNNNNNS        NNNYNNNT             TNNNNNSN   N H NNN NND
    85   85 A S  S    S-     0   0   89 1216   25  SSSSSSSSSSSSSSSSSNS        SNSSSSSS             GSSNSRSN   S N SSS SSS
    86   86 A L        +     0   0    2 1216   15  LLVLLLLLLLLLLLLLLLL        LLLLLLLL             MVVLVLML   V L VLL LLL
    87   87 A T    >   -     0   0   61 1215   68  KKTQQQQQQQTQQQQQQKR        GQRRRRRR             ETTQTRRR   T R TQR KKK
    88   88 A S  G >  S+     0   0   72 1216   59  ATATTTTTATATTATTTTS        AATTTTTT             VTTTTDSP   T A PTA PPP
    89   89 A E  G 3  S+     0   0  107 1216   21  EEADDDDDNDEDDNDDDEE        EEEEEEEE             KEEEEEEE   E N EDD EEE
    90   90 A D  G <  S+     0   0    7 1216    3  DDDDDDDDDDDDDDDDDDD        DDDDDDDD             DDDDDDDD   D D DDD DDD
    91   91 A S    <   +     0   0   31 1216   34  TTTTTTTTTTTTTTTTTTT        TTTTTTTT             TTTTTTSM   T T TTT TTT
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAAAAAAAAAAAAAAAA        AAAAAAAA             AAAAAAGG   A A AAA AAA
    93   93 A V  E     -EH  39 115B  21 1216   48  TLVMMMMMIMTTTIMMMML        VVRRRRRR             MTTVTVTI   T V TMV VVV
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYYYYYYYYYYYYYYYYY        YYYYYYYY             YYYYYYYY   Y Y YYY YYY
    95   95 A Y  E     -E   37   0B   1 1216    3  YYYYYYYYYYYYYCYYYYY        YYYYYYYF             YYYYYYYY   Y Y YYY YYY
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCCCCCCCCCCCCCCCC        CCCCCCCC             CCCCCCCC   C C CCC CCC
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAAAAAAAAAAAAAAAVA        AATGAVAA             AAAATAGT   A A AAA AAA
    98   98 A R  E     -E   34   0B  13 1196   38  RTRRRRVRRKRKKRRRRRR        KRSRRTSG             RVRKRRSV   S R RRR AAA
    99   99 A M  E     -EI  33 107B   5 1101   82  DDDKGGIKNRDGEDHNGPG        DDTGGDYC             GFPHGEGE   R G GSA DRR
   100  100 A W  E >   -E   32   0B  89 1101   89  tttRYGgGpArTTGyNYdT        tTSgPLRy             pGLMDRVG   G m pSl dpt
   101  101 A Y  T 3  S+     0   0  112  572   91  s.......v.....yG...        r.Yy...s             ........   . . y.. y..
   102  102 A Y  T 3  S-     0   0  133  629   92  E.......A.....GY...        C.SY...C             ..Y.G...   . . Y.. G..
   103  103 A G  S <  S+     0   0   38  705   79  r...Y...wY....yYy..        r.YW...Y             .Yf.Y...   Y . yF. l..
   104  104 A T        -     0   0   32  784   66  degEGD.g.g.gg.g.dgg        lvEGa.sq             gdhgHgG.   S g ggg yrr
   105  105 A Y        +     0   0   81  679   93  i...S.rgnyrgg.wA.aa        shAYa.ty             dyyd.d..   . e wri ypp
   106  106 A Y        -     0   0   32  842   66  R...rlyyyyYYY.YW.WW        RRygl.Sy             YydAFA..   W S Yyh pvv
   107  107 A F  E     +I   99   0B   0  885   48  .T.FmfmmmmFYYMFFmFF        EElmm.Mm             FmmFFLLM   F F Fmm mff
   108  108 A D  E     +     0   0B  25  997   46  ETGADADDDDDDDDDADAA        SDKDDDDN             DDDDTDDD   P D DDD DDA
   109  109 A Y  E     -J  168   0C 108 1059   61  FFEYYYYYYYVYYYVYYYY        LCLLLVLL             YYYYYMYY   N L VYD YYY
   110  110 A W  E     -I   97   0B  23 1092    2  WWWWWWWWWWWWWWWWWWW        WRWWWWWW             WWWWWWWW   W W WWW WWW
   111  111 A G        -     0   0    3 1067   15   TEGGGGGGGGGGGGGGGG        AGGGGGGG             GGGGGGGG   G G GGG GGG
   112  112 A Q        -     0   0  141 1047   41    PQQQQQQQAQQQAQQQQ        QQPPPPPP             QQQAQQQR   Q Q AQK KQQ
   113  113 A G        -     0   0   20 1013   12     GGGGGGGGGGGGGGGG        GQGGGGGG             GGGGGGGG   G G G G GGG
   114  114 A T  E     - H   0  94B   2  996   31     TTTTTTTTTTTTTTTT        STVVVIVV             TTTTTTTI   T T T T TTT
   115  115 A T  E     - H   0  93B  60  979   76     LSLSSSSTTTSTLSLL        VNEDEKEE             M  MLLMS   L M   A QQQ
   116  116 A L  E     -dH  10  92B   1  972   19     VVVVVVVVLLVVVVVV        LMVVVVVV             V  VVVVV   V V   V VVV
   117  117 A T  E     -d   11   0B  57  953   21     TTTTTTTTTTTTTTTT        TAVVVAVV             T  TTTTT   T T   T TTT
   118  118 A V  E     +d   12   0B   4  935    8     VVVVVVVVVVVVVVVV        Y VVVVVV             V  VVVVV   V V   V VVV
   119  119 A S              0   0   64  917   10     SSSSSSSSSSSSSSSS        S SSSSSS             T  TSSTS   S S   S SSS
   120  120 A S              0   0  122  885   21     ASASSSSSSSSSASAA          SSSSSS             S  SASSS   A S   S SSS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32                     QQ QQQQQ        QE  QQQHQ   Q        DQ            
   123    2 B A        -     0   0   19  713   70                     PP IIIII        AI SSSSSS   A        II            
   124    3 B V        -     0   0   84  765   49                     VVMLVVLL        VVVAAAAAA   V        VVM   V       
   125    4 B V  E     -Q  145   0D  10  820   26                     LLILLLLL        LLLLLLLLLL LL        LLL M L       
   126    5 B T  E     +Q  144   0D  69  829   11                     TTQTTTTT        TTTNTTTTTTTTT        TTT T T   T   
   127    6 B Q  E     -Q  143   0D  18  832    2                     QQSQQQQQ        QQQQQQQQQQQQQ        QQQ Q Q   Q   
   128    7 B E        -     0   0   59  833   63                     PPPSSSSS        QSPQPPPPPPPPP        SSP S P   P   
   129    8 B S  S    S+     0   0  101  841   38                     PPSPPPPP        PPGSARPAAPPPN        PPH P P   P   
   130    9 B A  E     -k  226   0C  59  842   50                     SSSAAAAA        SASSSSSSSSSSS        AAS S S   S   
   131   10 B L  E     -k  227   0C  57  847   76                     LLLIIIII        VSVVVVAVVVVVV        IIV S V   V   
   132   11 B T  E     +k  228   0C  84  848   77                     SSSMMMMM        SMSSSSSSSSSSS        MMS L S   S   
   133   12 B T  E     -k  229   0C  18  848   68                     AAASSSSS        GAGVAGGGGVVVT        SSG S V   V   
   134   13 B S    >   -     0   0   55  849   70                     SSSaaaaa        SvSASSSSSSSSS        aaS a A   S   
   135   14 B P  T 3  S+     0   0   61  848   65                     PPLppppp        LqPLPPPLPPPPL        ppP v P   P   
   136   15 B G  T 3  S+     0   0   46  850    7                     GGGGGGGG        GRGGGGGGGGGGG        GGG G G   G   
   137   16 B E    <   -     0   0  108  850   56                     AADQQQQQ        QEEQQHQQQQQQS        EEK D K   Q   
   138   17 B T  E     - R   0 199D  88  850   66                     TTIKKKKK        RTKTSSSSSTTTT        KKT R T   T   
   139   18 B V  E     - R   0 198D  14  850   33                     AAVVVVVV        VVVVIVVIIAAAV        VVI V A   A   
   140   19 B T  E     - R   0 197D  53  849   41                     RRTTTTTT        STTRTTTTTSRTK        TTT T R   S   
   141   20 B L  E     - R   0 196D   0  849   25                     LLMMMMMM        IIILIIIIIIIIL        IMI I I   I   
   142   21 B T  E     - R   0 195D  22  849   52                     TTTTTTTT        STSPSSSSSTTSS        TTS T T   T   
   143   22 B b  E     -QR 127 194D   0  850    2                     CCCCCCCC        CCCCCCCCCCCCC        CCC C C   C   
   144   23 B R  E     -Q  126   0D 133  850   77                     TTQSSSSS        SRTQTITTTSSST        NST R G   S   
   145   24 B S  E >   -QS 125 148D  11  850   68                     LLAAAAAA        GARGGGGGGGAGL        AAG A G   G   
   146   25 B S  T 3  S+     0   0   81  850   27                     NNSSSSSS        SSDGTTTTTDNDS        SSS S N   D   
   147   26 B T  T 3  S-     0   0   87  850   71                     SSQSSSSS        SESGTSSSTKAKS        SSS Q N   K   
   148   27 B G  B <  S+S  145   0D  39  850   55                     ggGSSSSS        SSGLNSSSSLLLG        SsG S I   L   
   149   28 B A        -     0   0   40  390   77                     vv......        N...DNDDD...N        ... . .   .   
   150   29 B V        -     0   0    3  620   45                     VV......        I...IVVVV...I        ..R . .   .   
   151   30 B T    >   -     0   0   56  541   72                     ........        G.S.GGGGG...E        ..I . .   .   
   152   31 B T  G >  S+     0   0   94  694   78                     EET.....        HVIGSDDGGGPGN        ..A I .   G   
   153   32 B S  G 3  S+     0   0   84  802   62                     GGSVVVVV        GngSYYNYYDNEN        V.S S g   D   
   154   33 B N  G <  S-     0   0   13  673   73                     YYISSSSS        .nyYSKKNDKQS.        SsN N k   K   
   155   34 B Y    <   -     0   0   98  781   50                     HHNYYYYY        YYYYYYYYFDYYY        YYS Y S   Y   
   156   35 B A        -     0   0    0  817   59                     IILMMMMM        GLVSVVVVVVAYV        MMV L V   V   
   157   36 B N  E     -L  212   0C   0  827   79                     NNNHHHHY        THSHSSSSSCYDH        HHQ N H   C   
   158   37 B W  E     -LM 211 171C   0  849    0                     WWWWWWWW        WWWWWWWWWWWWW        WWW W W   W   
   159   38 B V  E     -LM 210 169C   0  849   25                     FFFYYYYY        YYYYYYYFYYYYY        FYY Y Y   Y   
   160   39 B Q  E     -LM 209 168C  10  849   10                     QQQQQQQQ        QQQQQQQQQQQQQ        QQQ Q Q   Q   
   161   40 B E  E     -LM 208 167C  20  849    8                     KKQQQQQQ        QQQQQQQQQQQQQ        QQQ Q Q   Q   
   162   41 B K  E  >  - M   0 166C  68  849   50                     KKKKKKKK        IKRKYHHHHRKSY        KKR K K   K   
   163   42 B P  T  4 S+     0   0   98  843   23                     PPPSSSSP        PPPPPPPPPPPPE        PPP P P   P   
   164   43 B D  T  4 S-     0   0  148  846   16                     GGGGGGGG        GGTGGGGGGGGGG        GGG G G   G   
   165   44 B H  T  4 S+     0   0   90  845   66                     SSKTTTTS        SVSQKKRTKQRQR        TTS K Q   Q   
   166   45 B L  E  <  - M   0 162C  92  846   57                     PPASSSSS        APARAAAAASASS        SSA A A   S   
   167   46 B F  E     + M   0 161C   9  847   19                     ppPPPPPP        PPPPPPPPPPPPP        PPP P P   P   
   168   47 B T  E     -JM 109 160C  56  843   61                     ffKKKKKR        RKTAKKKKKVVLT        KKN N V   L   
   169   48 B G  E     + M   0 159C   1  848   64                     LLLRRRRL        MLTLVLLLLLMLT        LRI L L   L   
   170   49 B L  E     +     0   0C   4  848   24                     LLLWWWWL        LLLFLIVILVVVM        WWV L V   V   
   171   50 B I  E     +NM 177 158C   0  848   19                     RRIIIIII        IIIIIIIIIIIII        IIM I V   I   
   172   51 B G  E  >  +N  176   0C   0  849   33                     FFYYYYYY        YYYYFYFSYYYYY        YYY Y Y   Y   
   173   52 B G  T  4 S-     0   0    9  848   87                     KKGDDDDD        GGQGDEEEDQKEN        SDE A D   Q   
   174   53 B T  T  4 S+     0   0    9  849   68                     ssATTTTT        ATYDVVVVVDDGD        TTN A D   D   
   175   54 B N  T  4 S+     0   0  102  841   49                     nsSSSSSS        TSNSNSSRNNTDD        SSN S S   T   
   176   55 B N  E  <  -N  172   0C  77  849   69                     YDNKKKKN        SNQSSSQNSQQKK        NKQ S D   K   
   177   56 B R  E     -N  171   0C 113  850   66                     QKLLLLLL        RLRRRRRRRRRRR        LLR L R   R   
   178   57 B A    >   -     0   0    1  849   73                     GDEADAAA        AAPAPPPPPSPPP        AAP Q P   P   
   179   58 B P  T 3  S+     0   0   97  849   39                     SQDSSSSS        SSSSSSSSSSSSD        SSS S S   S   
   180   59 B G  T 3  S+     0   0   83  850   18                     GgGGGGGG        GGGGGGGGGGGGG        GGG G G   G   
   181   60 B V  S <  S-     0   0   13  848   23                     VvVVVXVV        VVVVVVVVIIIIV        VVV V I   I   
   182   61 B P    >   -     0   0   57  850    9                     PPPPPPPP        PPPPSPPSSPPPP        PPP P P   P   
   183   62 B A  T 3  S+     0   0   77  850   59                     SNSAAAAV        DADDHDDDNEQZD        AAD S E   E   
   184   63 B R  T 3  S+     0   0   58  850    5                     RRRRRRRR        RRRRRRRRRRRRR        RRR R R   R   
   185   64 B F  E <   +T  198   0D   4  850    1                     FFFFFFFF        FFFFFFFFFFFFF        FFF F F   F   
   186   65 B S  E     -T  197   0D  51  849   17                     SSSSSSXS        SSSSSSSSSSSSS        SSS S S   S   
   187   66 B G  E     +T  196   0D   9  850    4                     ggGGGGGG        GGGGGGGGGGSGG        GGG G G   G   
   188   67 B S  E     -T  195   0D  41  850    7                     ssSSSSSS        SSsSSSSSSSSSs        SSs S S   S   
   189   68 B L  E     -T  194   0D  59  835   79                     nnRGGGGG        RGsRKKKKKNTNs        GGs G N   S   
   190   69 B I  E >   -T  193   0D  86  842   31                     AAYSSSSS        SSSSSSSSSSSSS        SSS S S   S   
   191   70 B G  T 3  S-     0   0   67  850   18                     GGGAAAAA        GGSGGGDAGGGGS        GGS G G   E   
   192   71 B N  T 3  S+     0   0  105  828   57                     ..TTTTTT        NANGNNNNNNTNN        TTN T N   N   
   193   72 B K  E <  S- T   0 190D  68  833   67                     ..DSSSSS        TSATTTTTTTTTS        SSS D T   T   
   194   73 B A  E     -RT 143 189D   0  838   81                     ..FYYYYY        AFAAAAAAAAVAA        YYA F A   A   
   195   74 B A  E     -RT 142 188D   0  849   57                     LLTSSSSS        TSSTSSSSSTTTF        SSS T T   T   
   196   75 B L  E     -RT 141 187D   0  850    2                     LLLLLLLL        LLLLLLLLLLLLL        LLL L L   L   
   197   76 B T  E     -RT 140 186D  19  850   33                     TTTTTTTT        TTTTTTTTTTTTT        TTT T T   T   
   198   77 B I  E     -RT 139 185D   0  849    5                     IIIIIIII        IIIIIIVIIIIII        III I I   I   
   199   78 B T  E    S+R  138   0D  78  850   46                     SSSTTTTT        SSSTSSSSSSSSN        SSS S T   S   
   200   79 B G  S    S-     0   0   15  850   57                     GGSSSSSR        SRGGGGGGGGGGN        RSG G R   G   
   201   80 B A        -     0   0    0  849   51                     LLLMMMMM        LVLALLLLLTVTV        MML L V   T   
   202   81 B Q    >   -     0   0   80  849   32                     QQEQQQQQ        QEQQQQRQQQQEE        EEM Q E   Q   
   203   82 B T  G >  S+     0   0   84  850   59                     PPDAAAAA        ATPAAAAAAAASI        AAT A A   A   
   204   83 B E  G 3  S+     0   0   99  850   17                     EEEEEEEE        EEEEEEEEEMEME        EEE E G   M   
   205   84 B D  G <   +     0   0    1  850    2                     DDDDDDDD        DDDDDDDDDDDDD        DDD D D   D   
   206   85 B E    <   +     0   0   71  849   74                     EEMAAAAA        EFEEEEEEEEEEE        AAE F E   E   
   207   86 B A  E    S- O   0 227C   3  850   14                     AAAAAAAA        AASAAAAAAAAAA        AAA A A   A   
   208   87 B I  E     -LO 161 226C  55  850   71                     DDTTTTTT        DNIDHDDDDDDDI        TTD T D   D   
   209   88 B Y  E     -LO 160 225C   0  850    0                     YYYYYYYY        YYYYYYYYYYYYY        YYY Y Y   Y   
   210   89 B F  E     -L  159   0C   5  848    8                     YYFYYYYY        YYFFFYYYYYYYF        YYY Y Y   Y   
   211   90 B b  E     -L  158   0C   0  849    1                     CCCCCCCC        CCCCCCCCCCCCC        CCC C C   C   
   212   91 B A  E     -LP 157 221C   0  848   73                     GGLQQQQQ        AQLQSCSSSQQQH        QHQ Q Q   Q   
   213   92 B L  E     - P   0 220C   0  845   83                     ATQQQQQQ        AQSSSSSSSAAAS        QQS Q V   A   
   214   93 B W  E     + P   0 219C  21  834   71                     WWHWWWWW        YWYWYYYYFWWWY        RRF S W   W   
   215   94 B Y  E >  S- P   0 218C  33  829   88                     HHSSSSSS        DSDDRIVTTDDNV        SSD Y D   D   
   216   95 B S  T 3  S-     0   0  106  829   66                     GGYSSSSS        SSSSTGDSTSNSS        SSD S S   T   
   217   96 B N  T 3  S+     0   0  105  824   81                     nnLNNNNy        SNnTSSNStmsss        YYs A s   n   
   218   97 B H  E <   -P  215   0C  39  647   66                     nnPPPPPp        SPn.g.nnr...h        PPq . h   .   
   219   98 B L  E     -P  214   0C   1  382   85                     faYLLLLl        ....iYfvAvsvd        LWG L w   a   
   220   99 B V  E     -P  213   0C  12  489   66                     VVTTTTTT        ....IVVVVVILV        TTV T V   I   
   221  100 B F  E     -P  212   0C  17  540   30                     FFFFFFFF        .F..FFFFFFFFN        FFF F F   F   
   222  101 B G        -     0   0    1  481   35                     GGGGGGGG        G...GGGGGGGGH        GGG G G   G   
   223  102 B G        -     0   0   51  513   58                     GGGAAASA        G...GTGGGGGGG        AGG P G   G   
   224  103 B G        -     0   0    8  528   33                     GGGGGGGG        P..GGGGGGGGGG        GGG G G   G   
   225  104 B T  E     - O   0 209C   0  550   33                     TTTTTTTT        T..NTTTTTTTTS        TTT T T   T   
   226  105 B K  E     -kO 130 208C  82  547   67                     QQKKKKKK        G..DYKKKKRKKK        KKR K K   K   
   227  106 B L  E     -kO 131 207C   0  546   44                     VLLLLLLL        L.LLVVLLLLLL         LLL V L   L   
   228  107 B T  E     -k  132   0C  34  614   65                     TTEXEEEE        Q.TTTITTSTTT         EET D T   T   
   229  108 B V  E     -k  133   0C   3  593   35                     VVILLL L        ATVQVVVVVVVV         LIV I V       
   230  109 B L              0   0  120  399   31                     LL              RLLMLLLLLLLL           L   L       
   231  110 B G              0   0   62  207   39                     GG              G  G G GGSGG               G       
## ALIGNMENTS 1191 - 1260
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1    1 A E              0   0  185  771   30     QQQQQQ E  DD     QEE  Q E E E QQ   Q  DQEDEEEE                     
     2    2 A V        +     0   0   18  834   19     VVVVVV V  II     VVV  V V V I VV   V  VVVIVVVI VVV                 
     3    3 A Q  E     -A   25   0A  90  836   34     KKRRQR Q  QQ     QQQ  Q Q Q K QQ   Q  IQQPQQQK QQQ                 
     4    4 A L  E     -A   24   0A  13  881    3     LLLLLL L  LL     LLL  L L L H LL   L LLLLLLLLL LLL                 
     5    5 A Q  E     -A   23   0A 107  882   70     LLQQEQ V  VV     QVV  Q Q V E KK   Q TTQVVVVVE VVV                 
     6    6 A Q  E     -A   22   0A  14  887   31     EEEEEE E  EE     EEE  E E E Q EE   E QEEEEEEEQ EEE                 
     7    7 A S        -     0   0   33  892   13   S SSSSSS S  SS     SSS  S S S S SS   S SSSSSSSSS SSS                 
     8    8 A G        -     0   0   52  907   11   G GGGGGG G  GG     GGG  G G G P GG   G EGGGGGGGP GGG                 
     9    9 A A        -     0   0   80 1179   51   P PGPPPP G  GG     PGG  P P G F PP   P PGPGGGGGS GGG PPPPPPP PTPPP PP
    10   10 A E  E     -d  116   0B  68 1189   46   G GGSSSS G  DD     GSD  G G G E GG   G VDGGVGGGE GGG GSSGGGG GDGGG GG
    11   11 A L  E     +d  117   0B 130 1195   22   L LVLLLL L  VV     LLL  L L L V VV   L VVLLVLLLV LLL LLLLLLLLLLLLL LL
    12   12 A V  E     -d  118   0B  28 1197   47   V VVVVVV V  RR     VVV  V V V K VV   V KKVVRVVVK QQQ VVVVVVVVVVVVV VV
    13   13 A K    >   -     0   0  145 1201   50   A KQKKKK Q  QQ     KQQ  K T K K KK   K RKKQQQQQR QQQ AKKAAAAAAAAAA AA
    14   14 A P  T 3  S+     0   0   70 1203    8   P PPPPPP P  PP     PPP  P P P P PP   P PPPPPPPPP PPP PPPPPPPPPPPPP PP
    15   15 A G  T 3  S+     0   0   59 1209   28   S SGSSSS G  GG     SGG  S S A G SS   S GGSGGGGGG GGG SSSSSSSSSSSSS SS
    16   16 A A    <   -     0   0   36 1213   63   Q ERQQQQ G  GG     QGG  Q Q G E QQ   E EEEGGSGEE GGG QQQQQQQQQQQQQQQQ
    17   17 A S        -     0   0   66 1210   29   S TSTTTT F  SS     TSS  T T S K TT   T SSTSS.CSR SSS STTSSSSSSSSSSSSS
    18   18 A V  E     - B   0  83A  10 1213   32   L LLLLLL L  LL     LLL  L L L V LL   L HLLLLLLLV LPL LLLLLLLLLLLLLLLL
    19   19 A K  E     - B   0  82A 119 1211   53   S SRSSSS R  KK     STR  S S K K SS   S TRSRKRKKK RRR SSSSSSSSSSSSSSSS
    20   20 A L  E     - B   0  81A   0 1214   21   I LLVLLL L  LL     LLL  L L L M LL   L LLLLLLLLM LLL ILLIIIVIIIIIIIII
    21   21 A S  E     - B   0  80A  31 1215   35   T TSTTTT S  SS     TAS  T T S S TT   T TSTSSFSSS SSS TTTTTTTTTTTTTTTT
    22   22 A a  E     -AB   6  79A   0 1216    0   C CCCCCC C  CC     CCC  C C C C CC   C CCCCCCCCC CCC CCCCCCCCCCCCCCCC
    23   23 A K  E     -AB   5  78A 113 1216   70   T TETTTT V  KK     TAA  S T V F AA   A SKAAKAATI KKK TSSTTTTNTTTTTTTT
    24   24 A A  E     +A    4   0A   2 1216   49   V VAVVVV V  AA     VAA  V V A T FF   V AAVTAAAAI AGA VVVVVVVVVVVVVVVV
    25   25 A S  E     +A    3   0A  49 1216   12   S SSSSSS S  SS     SGS  S T S S SS   S SSSSSSSSS TTT STTSSSSSSSSSSSSS
    26   26 A G  S    S+     0   0   56 1215    3   G GGGEGG G  GG     G.G  G G G G GG   G GGGGGGGGG GGG GGGGGGGGGGGGGGGG
    27   27 A Y  S    S-     0   0   39 1216   33   F GFFFFF F  FF     FFF  Y Y F Y FF   G FFYFFFFFY FFF LDDFFFFFFFFFFFFF
    28   28 A T    >   -     0   0   90 1216   52   S STSSSS T  TT     STT  S S T T SS   S TDSTTTTSS MTT SSSSSSSSSSSSSSSS
    29   29 A F  G >  S+     0   0   13 1216   27   L ISLLLL F  FF     LFF  I I F M LL   I FFIFFFFYL LFL LIILLLLLLLLLLLLL
    30   30 A T  G 3  S+     0   0   40 1216   55   T SRTTTT S  SS     TSN  T T S T TT   S SSSSSSSST SSS TTTTSTTTTTTTTTTT
    31   31 A S  G <  S+     0   0   23 1216   57   S SDNTsv d  SS     SDD  t s a d SS   G DSsNSsNNS SsS SssSRSSDSSNSSSSG
    32   32 A Y  E <  S-E  100   0B  40 1139   28   Y FYYY.. y  YY     YYY  y y . y YY   Y YYyYY.YYY F.F YyyYYYYYYYYYYYYY
    33   33 A W  E     -E   99   0B  40 1148   92   G YGAGna .  YS     GWE  Y C w . VV   W GAYWDeLVN DsL G..GSGGGGGDGGGGA
    34   34 A M  E     -EF  98  51B   0 1206   49   V WMAVVV M  MM     VMM  W W M I VV   W MMWMMMMMI MMM VWWVVVVVVVVVVVVV
    35   35 A H  E     -EF  97  50B   0 1212   72   H SNGGGG D  SN     HSN  S S N H SS   S HHGFHNSTH FQQ NNNHHSSNSHTHHNNN
    36   36 A W  E     -EF  96  49B   0 1216    0   W WWWWWW W  WW     WWW  W W W W WW   W WWWWWWWWW WWW WWWWWWWWWWWWWWWW
    37   37 A V  E     -EF  95  47B   0 1216   17   V IVVVVV V  VV     IAV  I I V I VV   I VVIVVVVVI VVI VIIVVVVVVVVVVVVV
    38   38 A K  E     -EF  94  46B   7 1216   22   R RRRRRR R  RR     RRR  R R R R RR   R RRRRRRRRR RRR RRRRRRRRRRRRRRRR
    39   39 A Q  E     +EF  93  45B  20 1216    5   Q HQQQQQ Q  QQ     QQQ  Q Q Q Q QQ   Q QQQQQQQQQ QQQ QKKQQQQQQQQQQQQQ
    40   40 A R    >   -     0   0   35 1216   71   P PAAAAA A  AA     AAA  P P T R AA   P APPAAAAAR AAA PFFPPPPPPPPPPPPP
    41   41 A P  T 3  S+     0   0  130 1215   15   P PPPPPP P  PP     PPP  P P P P PP   P PPPPPPPPP PPP PPPPPPPPPPPPPPPP
    42   42 A G  T 3  S+     0   0   83 1216   22   G GGGGGG G  GG     GGG  G G G G GG   G GGGGGGGGG GGG GGGGGGGGGGGGGGGG
    43   43 A R  S <  S-     0   0  156 1216   43   K KKKKKK K  KK     KKK  K K K N KK   K KKKKKKKKG KKK RNNKKKKKKKKKKKKK
    44   44 A G        -     0   0   16 1215   36   G GGAAAV G  GG     GGA  G G G A GG   G GGGGGGGGA GGG GKKGGGGGGGGGGGGG
    45   45 A L  E     -F   39   0B   8 1215   10   L LLLLLP L  LL     LLF  L L L L LL   L LLLLLLLLL LLL LLLLLLLLLLLLLLLL
    46   46 A E  E     -F   38   0B  34 1216    6   E EEEEEE E  EE     EEE  E E E E EE   E EEEEEEEEE EEE EEEEEEEEEEEEEEEE
    47   47 A W  E     -F   37   0B   3 1216   10   W WWWWWW W  WW     WWW  W W W W WW   W WWYWWWWWW VWP WYYWWWWWWWWWWWWW
    48   48 A I  E     -     0   0B   0 1215   31   L IVLLVL V  IV     VVV  I M V I VV   I IIIVVVVVI VIV LMMLLLLLLLLLLLLL
    49   49 A G  E     -FG  36  60B   0 1216   35   G GEGSGG S  SS     GSS  G G A G GG   G SAGSSSSTG AAA AGGGGGGGGVGGGGGG
    50   50 A R  E     -FG  35  59B  32 1216   94   V FVGYDS S  ER     GDY  Y C R R AA   R AfYSAVYNW LES VYYVMVVMVVVVVVVM
    51   51 A I  E     -FG  34  58B   0 1207   17   I IIIIII I  II     VII  I I I M II   I IsIIIIIIM ITI IIIIIIIIIIIIIIII
    52   52 A D     >  -     0   0   26 1212   86   W SLHYYS S  SD     WRN  S N D N AA   D NYSSSSNRN VTS WNSWWWWWWWWWWWWW
    53   53 A P  T  4 S+     0   0    0 1212   83   A HSTNAT T  NT     YSG  S N T T GG   S TPGGNTSPT TGK GYYAGGGGGSNAAGGG
    54   54 A N  T  4 S-     0   0   96 1213   69   G LDNNGD G  DG     EDG  S V K G SS   S DSSSDDDDG TDN DSSGGDDDDDDGGDDD
    55   55 A G  T  4 S-     0   0   69 1216   57   G GGGGGG s  GS     GSG  G G s S GG   G GGSSGGGES GSG GGGGGGGGGGGGGGGG
    56   56 A G     <  +     0   0   25  915   61   . .S.... s  S.     .SG  . . y N GG   . SSGSSR..N .A. ................
    57   57 A G        -     0   0   43 1195   77   S TSGDSS T  SG     STT  S N A S SS   S ITSSGTT.S AKY TSSSSSSSSSTSSTTS
    58   58 A T  E     -G   51   0B  62 1209   46   T TKGTKT T  TT     TTA  T L T A TT   N QTTTTTATA ATT TTTTTTTTTTTTTTTT
    59   59 A K  E     -G   50   0B  89 1212   88   N KYNDES L  YY     HYY  Y Y Y T YY   Y YHYYYYYET GWW NYYNDNNDNTSNNSSD
    60   60 A Y  E     -G   49   0B  46 1215    9   Y YYLYYY Y  YY     YYY  Y Y Y F YY   L YYYYYYYKY YYY YYYYYYYYYYYYYYYY
    61   61 A N    >>  -     0   0   12 1216   63   N NANNSN S  AA     NAA  S T V S NN   N SSNPAAAFS AAA HNNNNHHNHNHNNHHN
    62   62 A E  G >4 S+     0   0  148 1216   64   S PDPAPP D  DD     PAS  P P D S PP   P EQPDDDDYS PPD SPPSSSSSSSSSSSSS
    63   63 A K  G 34 S+     0   0  109 1216   64   A SSAAAA S  SS     ASS  S S S S AA   S SSSSSSSSS SSV ASSAAAAAADAAAAAA
    64   64 A F  G X> S+     0   0    5 1216   45   L LVLLLL V  VV     LVV  L L V F LL   L VVLVVVVDF VVV LLLLLLLLLLLLLLLL
    65   65 A K  T << S+     0   0  156 1216   40   M QKKKKK K  KK     KKK  K K K Q KK   K KQKKKKKSQ KEQ IKKMKIIKIKIMMIIK
    66   66 A S  T 34 S+     0   0  108 1216   35   S SGSSPS G  GG     SGG  S S G S SS   S GGSGGGGVS GGG SSSSSSSSSSSSSSSS
    67   67 A K  T <4 S+     0   0   33 1214   21   R RRRRRR R  RR     RRR  R R R R RR   R RRRRRRRRR RRR RRRRRRRRRRRRRRRR
    68   68 A A  E  <  -C   83   0A   2 1216   69   L VFLLLL F  FF     LFF  T T F F LL   V FFVFFFFFF FFF LIILLLLLLLLLLLLL
    69   69 A T  E     -C   82   0A  58 1216   37   S STSSSS I  TT     STI  S S T I SS   T ITTTTTTTI TTT TSSSSSSSSSTSSTTS
    70   70 A L  E     +C   81   0A   7 1216   27   I IIIIII I  II     IIT  I I I M II   L IVIIIIIVI III IIIIIIIIIIIIIIII
    71   71 A T  E     -C   80   0A  57 1213   47   S SSTTTT S  SS     TSS  S S S T TT   S SSSSSSSST SSS STTSSSSSSSSSSSSN
    72   72 A V  E     -C   79   0A  28 1216   71   K QRRRRR R  RR     RRR  R R R E KK   R RRKRRRRRE RRR KRRKKKKKKKKKKKKK
    73   73 A D  E   > -C   78   0A  69 1216    7   D DDDDDD D  DD     DDD  D D D D DD   D DEDDDDDDE DDD DDDDDDDDDDDDDDDD
    74   74 A K  T > 5S+     0   0  105 1216   62   N TNTTTT N  NN     TNN  T T D V TT   T NNTNNNNND NNS NTTNNNNNNNNNNNNN
    75   75 A P  T 3 5S+     0   0  122 1215   37   S SSSSSS A  GG     SSA  S S S S SS   S NSSAGAAAS GGG FSSSSSSSSSFSSYYS
    76   76 A S  T 3 5S-     0   0   37 1216   65   K KMKKKK K  NN     KRK  K K R K KK   K RNKKNKKRS QQQ KKKKKKKKKKKKKKKK
    77   77 A S  T < 5 +     0   0   24 1216   48   S RNSSSS N  SS     SNN  N N T S SS   N ASNNSNNNS SSS RNNSSSSSSSSSSRRS
    78   78 A T  E   < -BC  23  73A   8 1216   64   Q QTQQQQ T  LL     QTM  Q Q M T QQ   Q QMQTLSSSR TTT QQQQQQQQQQQQQQQQ
    79   79 A A  E     -BC  22  72A   0 1207   67   V FLVVVV L  LL     VLL  F F V Q VV   F LLFLLLLVQ LLV VYYVVVVVVVVVVVVV
    80   80 A Y  E     -BC  21  71A  61 1209   36   F SYSSSS Y  HH     YYY  S S Y Y YY   S NYSYHYYSY YYY FYYFFFFFFFYFFFFF
    81   81 A M  E     -BC  20  70A   0 1212    9   L LLLLLL L  LL     LLL  L L L L LL   L LLLLLLLNL LLL LLLLLLLLLLLLLLLL
    82   82 A Q  E     -BC  19  69A  69 1215   43   K KQSSSS Q  QQ     TQQ  Q Q Q E QQ   K QQKQQQHSE QQQ KQQKKKKKKKKKKKKK
    83   83 A L  E     -BC  18  68A   0 1215   14   M LMLLLL M  MM     LMM  L L M V LL   L MMLMMMMMI MMM LLLMMLLMLMLMMLLM
    84   84 A S        +     0   0   32 1215   56   N TNSSSS N  NN     NNN  S S N T TT   S NNSNNNNFK NNN TNNNNNNNNNNNNNNN
    85   85 A S  S    S-     0   0   89 1216   25   S SSSSSS S  SS     SSS  S S N S SS   S SSSSSSNLS SSS SSSSSSSSSSSSSSSS
    86   86 A L        +     0   0    2 1216   15   L VLVVVV L  LL     LLL  V V L L VV   V LLVPLLLQL LLL LVVLLLLLLLLLLLLL
    87   87 A T    >   -     0   0   61 1215   68   Q TRATTT R  KK     RRR  T T R T NN   T KRTRKRRRT EKK QTTQQQQQQQQQQQQQ
    88   88 A S  G >  S+     0   0   72 1216   59   T AASTTT A  AA     AVA  T T T A PP   A TAAAAAAVA AAA TTTTTTTTTTSTTSSI
    89   89 A E  G 3  S+     0   0  107 1216   21   D AEEEEE E  EE     EEE  E E E E EE   A EEAEEEEEE EEE DEEDDDDDDDDDDDDD
    90   90 A D  G <  S+     0   0    7 1216    3   D DDDDDD D  DD     DDD  D D D D DD   D DDDDDDDDD DDD DDDDDDDDDDDDDDDD
    91   91 A S    <   +     0   0   31 1216   34   T TTTTTT T  TT     TKT  T T M S TT   T STTTTTTTS TTT TTTTTTTTTTTTTTTT
    92   92 A A  E    S- H   0 116B  10 1214    5   A AAAAAA A  AA     AAA  A A A A AA   A AAAAAAAAA GGA AAAAAAAAAAAVAAAA
    93   93 A V  E     -EH  39 115B  21 1216   48   M MTVVVV V  TT     VLV  M V T V VV   V VMVVTVVTV TTT TTTMMTTRTMTMMTTK
    94   94 A Y  E     -EH  38 114B   0 1216    1   Y YYYYYY Y  YY     YYY  Y Y Y Y YY   Y YYYYYYYYY YYY YYYYYYYYYYYYYYYY
    95   95 A Y  E     -E   37   0B   1 1216    3   Y YFTYYY Y  YY     FYY  Y Y Y F YY   Y YYYYYYYYF YYY YYYYYYYYYYYYYYYY
    96   96 A a  E     +E   36   0B   0 1216    1   C CCCCCC C  CC     CCC  C C C C CC   C CCCCCCCCC CCC CCCCCCCCCCCCCCCC
    97   97 A A  E     -EI  35 110B   0 1215   24   A AAVTAA A  AS     AVT  A T T A AA   A AAAAAATAA AAT AAAAAAAAAAAAAAAA
    98   98 A R  E     -E   34   0B  13 1196   38   R RKRRRR R  RR     RRT  R R R R KK   R RRRRRERRR KKK RRRTRKKRKRRRRRRR
    99   99 A M  E     -EI  33 107B   5 1101   82   E QDFDDR H  DD     DHD  G D D E DD   H EDDDDTHVQ SCC GIGRNTLEPHGKDGGE
   100  100 A W  E >   -E   32   0B  89 1101   89   A AlgtqT g  tt     ttk  T t t t tt   t sStTtqsSt dia rteqYGInGPrGerrE
   101  101 A Y  T 3  S+     0   0  112  572   91   . .d.sg. y  ss     ...  V . q c yr   . ....s.... ..k ................
   102  102 A Y  T 3  S-     0   0  133  629   92   . .W.GV. Y  EE     ...  S . V C GN   . ....E..D. ..G ......Y..S.....E
   103  103 A G  S <  S+     0   0   38  705   79   . .e.yFf e  rr     ...  Y . l C Fy   . ....r..F. ..y ......Y.yY.....y
   104  104 A T        -     0   0   32  784   66   . Dygggg d  dd     p.h  a g g . pg   g sQgvdpgG. .g. ..gggPdggg.g....
   105  105 A Y        +     0   0   81  679   93   . Nhag.d g  ii     lay  r . . C c.   a g.frsvhDl wsd ld.yt.l.w.lglllf
   106  106 A Y        -     0   0   32  842   66   . WhdV.N s  RR     lSW  t . W l LL   S S.YfRHYyy aKC yA.yy.CYY.yylyyy
   107  107 A F  E     +I   99   0B   0  885   48   L Fmi.yI l  ..     e.A  l R . l VV   . .FIa.PPpv iVI lMFmmM.PFimmmmmm
   108  108 A D  E     +     0   0B  25  997   46   R GDDDDD D  EE     D.S  T D . D PP   . .PNFEGCDC DDD DDADDD.ADADDDDDD
   109  109 A Y  E     -J  168   0C 108 1059   61   L PVYFYY V  FF     MYY  I H S V LL   F .SFSFFVFT AAA YYYYYYYYVYYYYYYY
   110  110 A W  E     -I   97   0B  23 1092    2   W WWWWWW W  WW     WWW  W W W W WW   W WWWWWWWWW WWW WWWWWWWWWWWWWWWW
   111  111 A G        -     0   0    3 1067   15   G GGGGGG G         AGG    G   S GG   A INAS GGGG GGG GGGGGGGGGGGGGGGG
   112  112 A Q        -     0   0  141 1047   41   Q QQPRPP R         AQQ        L PP   K LLKS RRQL RRR QQQQQQQQAQQQQQQQ
   113  113 A G        -     0   0   20 1013   12   G GGGGGG G         M          S AA     VP G GGGA GGG GGGGGGGGGGGGGGGG
   114  114 A T  E     - H   0  94B   2  996   31   T TTVLLL V         G          G CC     IS G   TC TTT TTTTTTTTTTIATTTT
   115  115 A T  E     - H   0  93B  60  979   76   L LTLLLL L         T          I II     TS A   LT SSS SSLSSSTLTLSSSSSS
   116  116 A L  E     -dH  10  92B   1  972   19   V VVVVVV V         L          L VV     LK Q   VV VVV VVVVVVLVVVVVVVVV
   117  117 A T  E     -d   11   0B  57  953   21   T TTTTTT T                    Q        TK P   ST TTT TTTTTTTTTTTTTTTT
   118  118 A V  E     +d   12   0B   4  935    8   V VVVVVV V                    V        VI V   VV VVV VVVVVVVVVVVVVVVV
   119  119 A S              0   0   64  917   10   S SSSSSS S                    N        PS A   T  SSS SSSSSSSSSSSSSSSS
   120  120 A S              0   0  122  885   21   A SSSSSS S                    N        SN P   S  SSS SSASSSSASASSSSSS
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32           E       DQQ   QQ Q D Q N  D   Q         Q   Q                
   123    2 B A        -     0   0   19  713   70           I  S    ISS   SS S P A F  I I A         S   I                
   124    3 B V        -     0   0   84  765   49           V  A    EGV   VV V V V M  IAV A         V   V                
   125    4 B V  E     -Q  145   0D  10  820   26    M      L LL  LLLLL   LL L M L L  LVL V         L   L                
   126    5 B T  E     +Q  144   0D  69  829   11    T      T TT  TTTTT   TT T T T T  TTT T         T   T                
   127    6 B Q  E     -Q  143   0D  18  832    2  Q Q      Q QQ  QQQQQ   QQ Q Q Q Q  QQQ Q         Q   Q                
   128    7 B E        -     0   0   59  833   63  D S      S AP  PSSPP   PP P T P P  SPS P         Q   S                
   129    8 B S  S    S+     0   0  101  841   38  P P      P RA  APPPS   SS S P P H  PAP S         P   P                
   130    9 B A  E     -k  226   0C  59  842   50  V A      A SS  SSASS   SS S S S S  ASA E         S   A                
   131   10 B L  E     -k  227   0C  57  847   76  V S      T VV  VSLVV   VV V S V V  SVS V         L   I                
   132   11 B T  E     +k  228   0C  84  848   77  S L      L SS  SLASS   SS S T S S  LSL K         S   L                
   133   12 B T  E     -k  229   0C  18  848   68  V S      S VG  GAVGG   GG G S G E  AAS A         G   S                
   134   13 B S    >   -     0   0   55  849   70  A a      l ST  TvSSS   SS S a S S  aNr K         T   a                
   135   14 B P  T 3  S+     0   0   61  848   65  L v      p PL  LpPLL   PP P v L P  pPp V         P   p                
   136   15 B G  T 3  S+     0   0   46  850    7  G G      G GG  GGGGG   GG G G G G  GGG G         G   G                
   137   16 B E    <   -     0   0  108  850   56  Q E      E QQ  QEEQQ   EE Q G Q Q  EEE E         Q   E                
   138   17 B T  E     - R   0 199D  88  850   66  T T      R TS  TTRKR   RK R T R T  TTR T         R   K                
   139   18 B V  E     - R   0 198D  14  850   33  V V      A AV  VVVVV   VV V V V V  VVV V         V   V                
   140   19 B T  E     - R   0 197D  53  849   41  R T      T RT  TTTTT   TT T T T T  TKT R         T   T                
   141   20 B L  E     - R   0 196D   0  849   25  I I      L VI  ILIII   II I I I I  III I         I   M                
   142   21 B T  E     - R   0 195D  22  849   52  T T      S TT  SYSSS   SS S N S S  NTS T         S   T                
   143   22 B b  E     -QR 127 194D   0  850    2  C C      C CC  CCCCC   CC C C C C  CCC C         C   C                
   144   23 B R  E     -Q  126   0D 133  850   77  Q R      R GA  SRRTT   TT T Q T T  KSK S         T   S                
   145   24 B S  E >   -QS 125 148D  11  850   68  G A      A GG  GAAGG   GG G S G R  AGA G         G   A                
   146   25 B S  T 3  S+     0   0   81  850   27  D S      S DS  SSSSS   SS S S S S  SGS S         S   S                
   147   26 B T  T 3  S-     0   0   87  850   71  S G      Q NT  SQDSS   SS S Q S S  QSQ S         S   S                
   148   27 B G  B <  S+S  145   0D  39  850   55  L N      S iG  SSSSS   SS S N S G  sYS Y         N   s                
   149   28 B A        -     0   0   40  390   77  . .      . s.  ...NN   NN . . N S  t.. .         N   .                
   150   29 B V        -     0   0    3  620   45  . .      . V.  ..VIV   II N V I I  V.V .         I   .                
   151   30 B T    >   -     0   0   56  541   72  . .      . ..  S.SGG   GG I Y G .  F.S S         G   .                
   152   31 B T  G >  S+     0   0   94  694   78  R I      V .S  IVTGR   GG G S G A  S.G Y         G   .                
   153   32 B S  G 3  S+     0   0   84  802   62  K H      S .Y  GSLSG   GG D N G S  s.s g         G   .                
   154   33 B N  G <  S-     0   0   13  673   73  Y N      N .K  SN..D   SY N N N N  d.s y         Y   s                
   155   34 B Y    <   -     0   0   98  781   50  S Y      Y .Y  YY.YY   YN Y Y Y Y  V.Y S         Y   Y                
   156   35 B A        -     0   0    0  817   59  A L      L .I  MMMVG   VV V L V V  LYL Y         V   M                
   157   36 B N  E     -L  212   0C   0  827   79  T A      A QS  GSHNS   YQ N S G Q  VGN G         S   Y                
   158   37 B W  E     -LM 211 171C   0  849    0  W W      W WW  WWWWW   WW W W W W  WWW W         W   R                
   159   38 B V  E     -LM 210 169C   0  849   25  Y Y      Y YY  YYYFL   YH Y F Y Y  HYY F         Y   Y                
   160   39 B Q  E     -LM 209 168C  10  849   10  Q Q      Q QQ  QQQQQ   QQ Q Q Q Q  QQQ Q         Q   Q                
   161   40 B E  E     -LM 208 167C  20  849    8  K Q      Q QQ  QQQFQ   QQ Q Q Q Q  QQQ Q         Q   Q                
   162   41 B K  E  >  - M   0 166C  68  849   50  K K      K KH  IRKPL   LF L K I R  KkK k         F   K                
   163   42 B P  T  4 S+     0   0   98  843   23  P P      P PP  PPP.P   PP P P P P  PpP p         P   P                
   164   43 B D  T  4 S-     0   0  148  846   16  G G      G PG  GGGGG   GG G G G G  GGG G         E   G                
   165   44 B H  T  4 S+     0   0   90  845   66  Q K      Q QT  TQQTK   KK K Q S S  QSQ S         T   S                
   166   45 B L  E  <  - M   0 162C  92  846   57  A S      A AA  AVQAA   AA A P A A  AAA A         A   S                
   167   46 B F  E     + M   0 161C   9  847   19  P P      P PP  PPPPP   PP P P P P  PPP P         P   P                
   168   47 B T  E     -JM 109 160C  56  843   61  L Q      R .K  KRKRK   KK K K K T  KVR V         K   K                
   169   48 B G  E     + M   0 159C   1  848   64  F L      L VL  TPLTL   LL L L T T  RTL T         L   P                
   170   49 B L  E     +     0   0C   4  848   24  V L      L LL  LLLVL   IL I L L V  LVL V         L   W                
   171   50 B I  E     +NM 177 158C   0  848   19  I V      I VI  IIIII   II I I I I  III I         I   I                
   172   51 B G  E  >  +N  176   0C   0  849   33  S Y      Y MY  YYYYY   YY Y Y Y Y  YYY Y         Y   Y                
   173   52 B G  T  4 S-     0   0    9  848   87  A N      D SN  AYLGE   DG L L R E  GND D         G   G                
   174   53 B T  T  4 S+     0   0    9  849   68  A A      T aG  TAANS   NN D A S D  ANA N         N   T                
   175   54 B N  T  4 S+     0   0  102  841   49  Y K      S dN  NSSNS   SS S S T N  SNN T         S   S                
   176   55 B N  E  <  -N  172   0C  77  849   69  S T      Y EN  KSHNK   NN I T S Q  NNN N         N   N                
   177   56 B R  E     -N  171   0C 113  850   66  R L      R RR  RLLRR   RR T L R R  RRL R         R   L                
   178   57 B A    >   -     0   0    1  849   73  P A      A SA  AHEPP   PP E A P P  APA P         P   A                
   179   58 B P  T 3  S+     0   0   97  849   39  S D      T SS  SSSLS   SS S S S S  SSS S         S   S                
   180   59 B G  T 3  S+     0   0   83  850   18  G G      G GG  GGGGG   GG G G G G  GNG G         G   G                
   181   60 B V  S <  S-     0   0   13  848   23  I V      I II  VVVIV   VV V V V V  VIV I         V   V                
   182   61 B P    >   -     0   0   57  850    9  P P      P PP  PPPPP   PP P P P P  PPP P         P   P                
   183   62 B A  T 3  S+     0   0   77  850   59  D S      A ED  DAADD   DD D S D D  DSA S         D   A                
   184   63 B R  T 3  S+     0   0   58  850    5  R R      R RR  RRRRR   RR R R R R  RRR R         R   R                
   185   64 B F  E <   +T  198   0D   4  850    1  F F      F FF  FFFFF   FF F F F F  FFF F         F   F                
   186   65 B S  E     -T  197   0D  51  849   17  S S      S SS  SSSSS   SS S S S S  SSS S         S   S                
   187   66 B G  E     +T  196   0D   9  850    4  G G      G GG  GGGGG   GG G G G G  GGG G         G   G                
   188   67 B S  E     -T  195   0D  41  850    7  S S      S SS  SSSSS   SS S S S s  SSS S         S   S                
   189   68 B L  E     -T  194   0D  59  835   79  R G      G NT  KGGKR   KR K G R s  GTG R         K   G                
   190   69 B I  E >   -T  193   0D  86  842   31  S S      S SS  SSSSS   SS S S S S  SSS S         S   S                
   191   70 B G  T 3  S-     0   0   67  850   18  G G      G GG  GGGGG   GG G G G S  GGG G         G   G                
   192   71 B N  T 3  S+     0   0  105  828   57  N T      T NN  NTTSN   NS N T N N  TST S         N   T                
   193   72 B K  E <  S- T   0 190D  68  833   67  T Q      D TT  TDDSS   SS S Q T S  DTD T         S   S                
   194   73 B A  E     -RT 143 189D   0  838   81  A Y      F AM  AFFAA   GG G F A A  FNF G         A   Y                
   195   74 B A  E     -RT 142 188D   0  849   57  S S      T TS  TSTTS   IT T T T S  TTT T         S   S                
   196   75 B L  E     -RT 141 187D   0  850    2  L L      L LL  LLLLL   LL L L L L  LLL L         L   L                
   197   76 B T  E     -RT 140 186D  19  850   33  T K      T TT  TTTTT   TT T T T T  TTT T         T   T                
   198   77 B I  E     -RT 139 185D   0  849    5  I I      I II  IIIII   II I I I I  III I         I   I                
   199   78 B T  E    S+R  138   0D  78  850   46  T N      S SS  STDTT   TT T S S S  STS T         T   S                
   200   79 B G  S    S-     0   0   15  850   57  G S      S GG  GGPGG   GG G G S G  NGS G         G   S                
   201   80 B A        -     0   0    0  849   51  T L      L VL  LVVLL   LL L V L L  FVL V         L   M                
   202   81 B Q    >   -     0   0   80  849   32  Q Q      E EQ  QEEQQ   QQ Q Q Q K  QQE Q         Q   E                
   203   82 B T  G >  S+     0   0   84  850   59  A P      P AA  APAAA   AA A C A T  AAP A         P   A                
   204   83 B E  G 3  S+     0   0   99  850   17  E E      E GE  EEDEE   EE E D E E  EEE E         E   E                
   205   84 B D  G <   +     0   0    1  850    2  D D      D DD  DDDDD   DD D D D D  DDD D         D   D                
   206   85 B E    <   +     0   0   71  849   74  E F      F EE  EFTEE   EE E A E E  AEA E         E   A                
   207   86 B A  E    S- O   0 227C   3  850   14  A G      A AA  AAAPA   AA A A A A  AAA A         A   A                
   208   87 B I  E     -LO 161 226C  55  850   71  D S      V DD  DDTED   DD D T D D  VDH V         V   T                
   209   88 B Y  E     -LO 160 225C   0  850    0  H Y      Y YY  YYYYY   YY Y Y Y Y  YYY Y         Y   Y                
   210   89 B F  E     -L  159   0C   5  848    8  Y Y      Y YY  YYYYY   YY Y Y Y Y  YYY F         Y   Y                
   211   90 B b  E     -L  158   0C   0  849    1  C C      C CC  CCCCC   CC C C C C  CCC C         C   C                
   212   91 B A  E     -LP 157 221C   0  848   73  S Q      Q QH  GLQAE   SE S A A Q  QGQ G         Q   Q                
   213   92 B L  E     - P   0 220C   0  845   83  S H      H VA  SQQLS   AS A G T S   SQ S         S   Q                
   214   93 B W  E     + P   0 219C  21  834   71  R F      R WY  YWSWW   AY W Y Y Y   WY Y         Y   Y                
   215   94 B Y  E >  S- P   0 218C  33  829   88  D W      S DQ  YGWDD   DD D Y E D   EK E         D   H                
   216   95 B S  T 3  S-     0   0  106  829   66  S S      N SS  SSNDN   SN D Y S S   CS G         K   S                
   217   96 B N  T 3  S+     0   0  105  824   81  s T      W sL  SSDNS   SS S S S s   cY S         s                    
   218   97 B H  E <   -P  215   0C  39  647   66  h P      P hP  DPP..   .. . . . h   np           k                    
   219   98 B L  E     -P  214   0C   1  382   85  w W      I mI  ..W..   .. . . . .   gq           .                    
   220   99 B V  E     -P  213   0C  12  489   66  I T      T LS  ..T..   I. . . S .   IC           .                    
   221  100 B F  E     -P  212   0C  17  540   30  F F      F FL  ..FLL   Y. L . Y .   FF           .                    
   222  101 B G        -     0   0    1  481   35  G G      G GG  S.G.S   S. N G . .   GS           .                    
   223  102 B G        -     0   0   51  513   58  G G      Q GS  S.G.A   SA A S H .   SQ           .                    
   224  103 B G        -     0   0    8  528   33  G G      G GG  D.G.P   TG P G G .   GG           .                    
   225  104 B T  E     - O   0 209C   0  550   33  T T      T TA  T.TNT    G T T T .   T            .                    
   226  105 B K  E     -kO 130 208C  82  547   67  K K      R RQ  V.KAV    A V   V .   T            A                    
   227  106 B L  E     -kO 131 207C   0  546   44  L L      L LL  LLLHL    R L   L .   L            I                    
   228  107 B T  E     -k  132   0C  34  614   65  T E      D T   QTET     T     Q T   T            T                    
   229  108 B V  E     -k  133   0C   3  593   35  V I      I V   A LV     V     A V   V            V                    
   230  109 B L              0   0  120  399   31             L   R  L     L     R L   L            L                    
   231  110 B G              0   0   62  207   39             G   G              G     G                                 
## ALIGNMENTS 1261 - 1330
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....7....:....8....:....9....:....0....:....1....:....2....:....3
     1    1 A E              0   0  185  771   30       EEEEE      Q     QQQ       QQ QQQEQDDD DDDDQ  QEEE  E E   Q      
     2    2 A V        +     0   0   18  834   19       VEEEE      V     VVV       VV VVVVLVVV IIIIV  VEEV  E I   V      
     3    3 A Q  E     -A   25   0A  90  836   34       QKNKK      Q     QQQ       KK RRQRQQQQ QQQQQ  QQQQ  Q K   Q      
     4    4 A L  E     -A   24   0A  13  881    3       LLLLL      L     LLL       LL LLLLLLLL LLLLL  LLLL  L H   L      
     5    5 A Q  E     -A   23   0A 107  882   70       VVVVV      V     QQQ       LL QQQVQVVV VVVVQ  QVVV  V E   K      
     6    6 A Q  E     -A   22   0A  14  887   31       EEEEE      E     EQE       EE EEEEEEEE EEEEE  EEEE  E Q   E      
     7    7 A S        -     0   0   33  892   13       SSSSS      S     SSS       SS SSSSSSSS SSSSS  SSSS  S S   S      
     8    8 A G        -     0   0   52  907   11       GGGGG      G     GGG       GG GGGGGGGG GGGGG  GGGG  G P   G      
     9    9 A A        -     0   0   80 1179   51       GGGGG      G     GGGPPPPP  PP PPPGPGGG GGGGP  PGGG  G S   P      
    10   10 A E  E     -d  116   0B  68 1189   46       DGGGG      G     GGGGGGGG  GG SSSGGDDD DDDDG  GGGG  G E   G      
    11   11 A L  E     +d  117   0B 130 1195   22       MLLLL      V     LLLLLLLL  LL LLLLLLLV VVVVL  LLLL  L V   V      
    12   12 A V  E     -d  118   0B  28 1197   47       VVVVV      V     VVVVVVVV  VV VVVVVRRR RRRRV  VVVV  V K   V      
    13   13 A K    >   -     0   0  145 1201   50       KQQQQ      Q     QQQKKKKK  KK KKKEKQQQ QQQQR  KQQP  Q K   K      
    14   14 A P  T 3  S+     0   0   70 1203    8       PPPPP      P     AAPPPPPP  PP PPPPPPPP PPPPP  PPPP  P P   P      
    15   15 A G  T 3  S+     0   0   59 1209   28       GGGGG      G     GGGSSSSS  SS SSSGSGGG GGGGS  SGGG  G G   S      
    16   16 A A    <   -     0   0   36 1213   63       GGGGG      R     GDGQQQQQ  EE QQQGEGGG GGGGE  QGGG  G E   Q      
    17   17 A S        -     0   0   66 1210   29       SSSSS      S     SSSTTTTT  TT TTTFTSSS SSSST  TSSS  S K   T      
    18   18 A V  E     - B   0  83A  10 1213   32       LLLLL      L     LLLLLLLL  LL LLLLLLLL LLLLL  LLLL  L V   L      
    19   19 A K  E     - B   0  82A 119 1211   53       RRRRR      R     RRRSXSSS  SS SSSRSRRK KKKKS  SRRR  R K   S      
    20   20 A L  E     - B   0  81A   0 1214   21       LLLLL      L     LLLLLLLL  LL LLLLLLLL LLLLL  LLLL  L M   L      
    21   21 A S  E     - B   0  80A  31 1215   35       SSSSS      S     SSSTTTTT  NN TTTSTSSS SSSST  TSSP  S S   T      
    22   22 A a  E     -AB   6  79A   0 1216    0       CCCCC      C     CCCCCCCC  CC CCCCCCCC CCCCC  CCCC  C C   C      
    23   23 A K  E     -AB   5  78A 113 1216   70       VVVVV      A     AEAAAAAA  TT TTTVAKKK KKKKA  TAAA  A I   A      
    24   24 A A  E     +A    4   0A   2 1216   49       AGGGG      A     AAAIIIII  VV VVVVVAAA AAAAV  VAAA  A T   F      
    25   25 A S  E     +A    3   0A  49 1216   12       SSSSS      S     SSSSSSSS  SS SSSSSSSS SSSSS  SSSS  S S   S      
    26   26 A G  S    S+     0   0   56 1215    3       GGGGG      G     GGGGGGGG  GG GGGGGGGG GGGGG  GGGG  G G   G      
    27   27 A Y  S    S-     0   0   39 1216   33       FFIFF      F     RRNDGDDD  RR FFFFGFFF FFFFY  FFFF  F Y   F      
    28   28 A T    >   -     0   0   90 1216   52       TTTTR      A     TTISSSSS  SS SSSTSSST TTTTS  STTT  S T   S      
    29   29 A F  G >  S+     0   0   13 1216   27       FFFFN      F     GSDVVVVV  II LLLFIFFF FFFFI  IFFF  F M   L      
    30   30 A T  G 3  S+     0   0   40 1216   55       SNSST      S     SHRSSSSS  TT TTSSSSSS SSSSS  TSSS  R T   T      
    31   31 A S  G <  S+     0   0   23 1216   57       SsRYn      D     TgLsssss  nn sssdnssS SSNSs  tDNG  S d   S      
    32   32 A Y  E <  S-E  100   0B  40 1139   28       YyYYy      Y     YyYatasa  yy ...yhyyY YYYYy  yYYY  Y f   Y      
    33   33 A W  E     -E   99   0B  40 1148   92       Y.SE.      A     DGAAaAaA  YY daa..GGY EGWDW  DRRW  P .   V      
    34   34 A M  E     -EF  98  51B   0 1206   49       MIVII      M     MMMWWWWW  WW VVVMWMMM MMMMW  WMMI  M I   V      
    35   35 A H  E     -EF  97  50B   0 1212   72       YNTSN      H     GGANNNNN  AA VHNDSSSS NYSSS  TNNS  N S   S      
    36   36 A W  E     -EF  96  49B   0 1216    0       WWWWW      W     WWWWWWWW  WW WWWWWWWW WWWWW  WWWW  W W   W      
    37   37 A V  E     -EF  95  47B   0 1216   17       AVVVV      V     FFYIIIII  FF VVVVIVVV VIVVI  IVVA  V I   V      
    38   38 A K  E     -EF  94  46B   7 1216   22       RRRRR      R     RRRRRRRR  RR RRRRRRRR RRRRR  RRRR  R R   R      
    39   39 A Q  E     +EF  93  45B  20 1216    5       QQQQQ      Q     QQQQQQQQ  QQ QQQQQQQQ QQQQQ  QQQQ  Q Q   Q      
    40   40 A R    >   -     0   0   35 1216   71       AAAAA      A     AVASSSSS  PP AAAAPAAA AAAAP  TAAA  A R   A      
    41   41 A P  T 3  S+     0   0  130 1215   15       PPPPP      P     PPAPPPPP  PP PPPPPPPP PPPPP  PPPP  P P   P      
    42   42 A G  T 3  S+     0   0   83 1216   22       GGGGG      G     GGGSSSSS  GG GGGGGGGG GGGGG  GGGG  G G   G      
    43   43 A R  S <  S-     0   0  156 1216   43       KKKKK      K     KKKRRGRR  KK KKKKKKKK KKKKK  KKKK  K N   K      
    44   44 A G        -     0   0   16 1215   36       GGGGG      G     EEQGGGGD  GG VVAGGGGG GGGGG  GGGK  G A   G      
    45   45 A L  E     -F   39   0B   8 1215   10       LLLLL      L     RRRLLLLL  LL PPLLLLLL LLLLL  LLLL  L L   L      
    46   46 A E  E     -F   38   0B  34 1216    6       QEEEE      E     EEEEEEEE  EE EEEDEEEE EEEEE  EEEE  E E   E      
    47   47 A W  E     -F   37   0B   3 1216   10       WWWWW      W     SLLWWWWW  WW WWWWWWWW WWWWW  WWWW  W W   W      
    48   48 A I  E     -     0   0B   0 1215   31       VLLLL      V     VVVLLLLL  II LLVVIVVV LVLVI  MVVV  V I   V      
    49   49 A G  E     -FG  36  60B   0 1216   35       SAAAA      A     AAAGGGGG  GG AGGSGAAS SSSSG  GAAS  A G   G      
    50   50 A R  E     -FG  35  59B  32 1216   94       HGGAQ      v     AAIRrRRr  SS QGQSLIIL NANYY  CYYD  L R   A      
    51   51 A I  E     -FG  34  58B   0 1207   17       IIVSI      v     IIATyTTy  II IIIIIIII IIIII  ITTI  I M   I      
    52   52 A D     >  -     0   0   26 1212   86       NADGS      G     NRHYYYYY  HH SADSSYYD NSNSY  NSSS  S N   A      
    53   53 A P  T  4 S+     0   0    0 1212   83       KRRCS      T     WWLYRYYR  HH PTNTGTTT GNGSH  NYYG  S A   G      
    54   54 A N  T  4 S-     0   0   96 1213   69       DGGGG      S     DSSRSRRS  TT RGGGSSSG PDAGS  NGGD  G G   S      
    55   55 A G  T  4 S-     0   0   69 1216   57       GssgY      t     SGGsKssK  GG GGGsGSQS GGGGG  GddS  r S   G      
    56   56 A G     <  +     0   0   25  915   61       SgggG      a     AV.wWwwW  .. ...sGG.. SSSS.  .nnS  g N   G      
    57   57 A G        -     0   0   43 1195   77       SSRRT      E     RELYYYYY  PP NSITSN.S SSSSS  NPPI  N S   S      
    58   58 A T  E     -G   51   0B  62 1209   46       TSTTA      S     TTLINHHN  TT TTTTTAAT TTTTT  TIIT  T A   T      
    59   59 A K  E     -G   50   0B  89 1212   88       SYDYY      Y     YYTDDEDD  YY YFNLDYYS YYNNY  YHSY  Y T   Y      
    60   60 A Y  E     -G   49   0B  46 1215    9       YYYYY      Y     YHYYYYYY  EE YYYYYYYY YYYYY  YYYY  Y F   Y      
    61   61 A N    >>  -     0   0   12 1216   63       AAAVA      A     AKAAAAAA  NN NKNPNAAA AAAAN  SAAA  A S   N      
    62   62 A E  G >4 S+     0   0  148 1216   64       DDDDD      N     SDDVVVPV  PP QPADPDDD DDDDP  PAAA  T S   P      
    63   63 A K  G 34 S+     0   0  109 1216   64       ASSSS      S     SSSSSSFS  PP AAASSSSS SSSSS  SSSS  S S   A      
    64   64 A F  G X> S+     0   0    5 1216   45       VVVVV      V     VVVVVVVV  LL LLLVLVVV VVVVL  LVVV  V F   L      
    65   65 A K  T << S+     0   0  156 1216   40       KKKKK      K     RKKKKKKK  KK KMKKKKKK KKKKK  KKKK  K Q   K      
    66   66 A S  T 34 S+     0   0  108 1216   35       GGGGG      G     GGGSSSSS  SS SSSGSGGG GGGGS  SGGG  G S   S      
    67   67 A K  T <4 S+     0   0   33 1214   21       RRRRR      R     RRRRRRRR  RR RRRRRRRR RRRRR  RRRR  H R   R      
    68   68 A A  E  <  -C   83   0A   2 1216   69       FFFFF      F     FFFIIIVI  VV LLLFVFFF FFFFA  TFFF  F F   L      
    69   69 A T  E     -C   82   0A  58 1216   37       TTTTT      S     TTTTITTT  TT SSSITTTT TTTTT  STTT  T I   S      
    70   70 A L  E     +C   81   0A   7 1216   27       IIIII      I     IIVIIIII  MM IIIIIIII IIIII  IIII  I M   I      
    71   71 A T  E     -C   80   0A  57 1213   47       SSSSS      S     SSSNXYNN  SS TTTSSSSS SSSSS  SSSS  S T   T      
    72   72 A V  E     -C   79   0A  28 1216   71       RRRKR      R     RRRSPPPP  VI RRRRTKKR RRRRA  RRRR  R E   K      
    73   73 A D  E   > -C   78   0A  69 1216    7       DDDDD      D     DDDDDDDD  DD DDDDDDDD DDDDD  DDDD  D D   D      
    74   74 A K  T > 5S+     0   0  105 1216   62       NNDNN      T     NNNTTITT  TT TSTNTNNN NNNNT  TNNN  N E   T      
    75   75 A P  T 3 5S+     0   0  122 1215   37       ASSSW      S     AAASSPSS  SS SSSASAAG GGGGS  SAAA  A S   S      
    76   76 A S  T 3 5S-     0   0   37 1216   65       KRQQQ      K     KKKKKKKK  KK KKKKKNNN NNNNK  KKKK  K K   K      
    77   77 A S  T < 5 +     0   0   24 1216   48       NNNNN      N     KNNNNNNN  NN SSSNNSSS SSSSN  NNNN  N S   S      
    78   78 A T  E   < -BC  23  73A   8 1216   64       TTTTT      T     TMTQQQQQ  QQ QQQTQLLL LLLLQ  QTTT  S T   Q      
    79   79 A A  E     -BC  22  72A   0 1207   67       LDAAA      I     VVVFFFFF  VV VVVLFVVL LLLLF  FLLL  L Q   V      
    80   80 A Y  E     -BC  21  71A  61 1209   36       YYYYY      Y     YYYSSSTS  SS SSSYSNNH HHHHS  TYYY  Y Y   Y      
    81   81 A M  E     -BC  20  70A   0 1212    9       LLLLL      L     LLLLLLML  LL LLLLLLLL LLLLL  LLLL  L L   L      
    82   82 A Q  E     -BC  19  69A  69 1215   43       QQQQQ      Q     QQQQQQQQ  RR SSSQKQQQ QQQQR  QQQQ  Q E   Q      
    83   83 A L  E     -BC  18  68A   0 1215   14       MMMMM      M     MMMLLLLL  LL LLLMLMMM MMMML  LMMM  M V   L      
    84   84 A S        +     0   0   32 1215   56       NNNNN      N     NNHNNNQN  RR NSSNSNNN NNNNS  SSSN  G T   T      
    85   85 A S  S    S-     0   0   89 1216   25       SSSSS      S     SSSSSSSS  SS SSSSSSSS SSSSS  SSSS  S S   S      
    86   86 A L        +     0   0    2 1216   15       LLLLL      L     LLLVVVVV  VV VVVLVLLL LLLLV  VLLL  L L   V      
    87   87 A T    >   -     0   0   61 1215   68       RRRRR      R     KKKTTTTT  TT TTTRTKKK KKKKT  TRRR  R T   N      
    88   88 A S  G >  S+     0   0   72 1216   59       ATTTA      P     PPPPPPPP  AA TSTAATTA AAAAA  TAAA  S A   P      
    89   89 A E  G 3  S+     0   0  107 1216   21       EEEEE      E     EEEEEEEE  KA EDEEAEEE EEEEA  EEEE  D E   E      
    90   90 A D  G <  S+     0   0    7 1216    3       DDDDD      D     DDDDDDDD  DD DDDDDDDD DDDDD  DDDD  D D   D      
    91   91 A S    <   +     0   0   31 1216   34       TTTTT      T     TTTTTTAT  AA TTTTTTTT TTTTT  TTTT  T S   T      
    92   92 A A  E    S- H   0 116B  10 1214    5       AAAAA      A     AAAAAAAA  AA AAAAAAAA AAAAA  AAAA  A A   A      
    93   93 A V  E     -EH  39 115B  21 1216   48       VRRRH      V     VVVVVVVV  VV VVVVVLLT TTTTV  VVVL  L V   V      
    94   94 A Y  E     -EH  38 114B   0 1216    1       YYYYY      Y     YYYYYYYY  YY YYYYYYYY YYYYY  YYYY  Y Y   Y      
    95   95 A Y  E     -E   37   0B   1 1216    3       YYYYY      Y     TYYFYYFY  YY FYWYYYYY YYYYY  FYYY  Y F   Y      
    96   96 A a  E     +E   36   0B   0 1216    1       CCCCC      C     CCCCCCCC  CC CCSCCCCC CCCCC  CCCC  C C   C      
    97   97 A A  E     -EI  35 110B   0 1215   24       AAAAT      A     GANAAAAA  AA VAAAAAAA AAAAA  AAAA  A A   A      
    98   98 A R  E     -E   34   0B  13 1196   38       KRGRR      R     AARRRTRR  RR RRTRRRRG RRRRG  RRRK  R R   K      
    99   99 A M  E     -EI  33 107B   5 1101   82       DGCPG      R     GRAQDGDK  HH CDCHIDDD DDDDH  HDYA  H H   D      
   100  100 A W  E >   -E   32   0B  89 1101   89       TviyD      G     EtYMLNeV  LL siLgdttt tttts  sttv  t t   t      
   101  101 A Y  T 3  S+     0   0  112  572   91       .yyr.      .     ........  GG c..yh..s ssssy  f...  . .   g      
   102  102 A Y  T 3  S-     0   0  133  629   92       .CHC.      D     ........  HH W..YE..E EEEEH  Y...  . .   T      
   103  103 A G  S <  S+     0   0   38  705   79       .yYW.      Y     .....Y..  cc h.yed..r rrrrh  F...  . .   g      
   104  104 A T        -     0   0   32  784   66       vgdg.      s     grggS.gS  gg ggsdgppd ddddg  S..g  . .   g      
   105  105 A Y        +     0   0   81  679   93       ryni.      e     tpp....L  nn .vggy..s slis.  .vvt  v l   c      
   106  106 A Y        -     0   0   32  842   66       RynYY      N     WvT.fY.s  WW .wHny..R RFRR.  .QQS  Q y   L      
   107  107 A F  E     +I   99   0B   0  885   48       .lm.N      F     .f.ffFMf  LL Ii.ll... .R...  FLL.  L l   V      
   108  108 A D  E     +     0   0B  25  997   46       PDD.E      Q     DA.DDDDD  DD DEADD..E EEEE.  SEE.  E D   P      
   109  109 A Y  E     -J  168   0C 108 1059   61       LLLLL      H     SYYYFSVI  PP YTYVS..F FFFF.  AVVY  V V   L      
   110  110 A W  E     -I   97   0B  23 1092    2       WWWWW      W     WWWWWWWW  WW WWWWWWWW WWWWW  RWWW  W W   W      
   111  111 A G        -     0   0    3 1067   15       TGGGG      G     GGGGGGGG  GG GGSGGEE      S  RSSG  A S   G      
   112  112 A Q        -     0   0  141 1047   41       QPPPP      Q     QQKQQRQQ  QQ PPPRQDD      Q  PGGK  G L   P      
   113  113 A G        -     0   0   20 1013   12       DGGGG      G     GGGGGGGG  GG GGGGGSS      V  SSS   S S   A      
   114  114 A T  E     - H   0  94B   2  996   31       SVVVV      T     TTTTTTTT  TT LLLVV        E  SCC   C G   C      
   115  115 A T  E     - H   0  93B  60  979   76       VEEEE      L     QQLLMLTM  LL LLLLV        A  LVV   V I   I      
   116  116 A L  E     -dH  10  92B   1  972   19       YVVVV      V     VVVAVVVV  VV IVVVV        V  LVV   V L   V      
   117  117 A T  E     -d   11   0B  57  953   21       NVVVV      A     TTTTTTTT  LI TTTTT        A  SSS   S Q          
   118  118 A V  E     +d   12   0B   4  935    8       YVVVV      V     VVVVVVVV  VV VVVVV        S  VSS   S V          
   119  119 A S              0   0   64  917   10       SSSSS      S     SSSSSSSS  SS SSSSS        E  SSS   S N          
   120  120 A S              0   0  122  885   21       SSSSS      S     SSSSSSSS  SS SSSSS        S          N          
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32  QEN       QQQ QE DEE           D                  Q    QQ Q DDD  D D Q
   123    2 B A        -     0   0   19  713   70  FNI       SSS SI IIL           I                  S    AS A ITI II I P
   124    3 B V        -     0   0   84  765   49  GVVMM     AAAVAV QIT           Q  V               V    PV V VVV VVAV V
   125    4 B V  E     -Q  145   0D  10  820   26  VLMII     LLLLLL MLLMM        LM  M        V      L    LL L VLV LVLMML
   126    5 B T  E     +Q  144   0D  69  829   11  STTQQ     TTTSTT TTTTT        TT  T        T      T    TT T TTT STTTTT
   127    6 B Q  E     -Q  143   0D  18  832    2  QQQSS     QQQQQQ QQQQQ        QQ  Q        Q      Q    QQ Q QQQ QQQQQQ
   128    7 B E        -     0   0   59  833   63  PSSPP     PPPPPS SSSSS        PT  S        P     PP    PP P SSS SSPSSP
   129    8 B S  S    S+     0   0  101  841   38  EPPSS     APRPPP SPPPP        DT  P        A     SP    PS P PPP PPDPPP
   130    9 B A  E     -k  226   0C  59  842   50  SAKSS     SSSSSG SAGSS        SS  S        S     SS    SS S AAA AESDSS
   131   10 B L  E     -k  227   0C  57  847   76  VISLL     VAVVVT STTSS        VS  S        V     LL    VV V SSS SFVSSL
   132   11 B T  E     +k  228   0C  84  848   77  SMMSS     SSSSSL LLLLL        SL  L        S     TS    SS S LLV LLSLLS
   133   12 B T  E     -k  229   0C  18  848   68  GASAA     GGGVGS SSSSP        VS  S        G     VG    GG G AAA SSAASA
   134   13 B S    >   -     0   0   55  849   70  SamSS     SSSASl avlaa        Sa  a        T     qA    TS S kkk gvNvaS
   135   14 B P  T 3  S+     0   0   61  848   65  PlvLL     PLPPPp lppvv        Pl  v        L     lL    PP L qqq ppLplP
   136   15 B G  T 3  S+     0   0   46  850    7  GGGGG     GGGGGG GGGGG        GG  G        G     GG    GG G GGG GGGGGG
   137   16 B E    <   -     0   0  108  850   56  QQEDD     QQQQQE DEEDD        QD  D        Q     QQ    TE Q EEE EEEEDS
   138   17 B T  E     - R   0 199D  88  850   66  TKRII     SSSTSR RRRRR        TR  R        T     MK    SR R TTT RRTRTS
   139   18 B V  E     - R   0 198D  14  850   33  AVVVV     IVLAVA VAAVV        AV  V        V     VV    VV V VVV VVVVVA
   140   19 B T  E     - R   0 197D  53  849   41  TTTTT     TTTRTT TTTTT        RT  T        T     TT    TT T TTT TTRSTR
   141   20 B L  E     - R   0 196D   0  849   25  IMLMM     IIIIIL ILLII        II  I        I     II    II I III IIRLIL
   142   21 B T  E     - R   0 195D  22  849   52  STTTT     SSSTSS SSSTT        TS  T        S     FS    SS S NNN SSTNTT
   143   22 B b  E     -QR 127 194D   0  850    2  CCCCC     CCCCCC CCCCC        CC  C        C     CC    CC C CCC CCCCCC
   144   23 B R  E     -Q  126   0D 133  850   77  TSKQQ     TTSGTR RRRRR        SR  R        S     TT    AT T KKK KKSKRT
   145   24 B S  E >   -QS 125 148D  11  850   68  IAAAA     GGGGGA AAAAA        GA  A        G     GG    GG G AAA ATGSAL
   146   25 B S  T 3  S+     0   0   81  850   27  SSSSS     TTADTS SSSSS        DS  S        S     SS    SS S SSS SSDSSR
   147   26 B T  T 3  S-     0   0   87  850   71  SSEQQ     TSPGSQ QQQQQ        AQ  Q        S     SS    SS S QQQ ESSQQS
   148   27 B G  B <  S+S  145   0D  39  850   55  RSNGG     SSCISS DSSST        LD  S        S     ST    SS S SSS SGYsGG
   149   28 B A        -     0   0   40  390   77  T....     DDD.D. .....        ..  .        N     N.    DN N ... ...q..
   150   29 B V        -     0   0    3  620   45  VV...     VVV.V. .VV..        ..  .        I     IN    VI I VV. LV.S.I
   151   30 B T    >   -     0   0   56  541   72  .SV..     GGD.GV .SSI.        ..  .        G     GI    GG G S.. T..N.N
   152   31 B T  G >  S+     0   0   94  694   78  .SVTT     SGGGSS ITSSI        PI  I        S     YG    GS G K.V P..KIV
   153   32 B S  G 3  S+     0   0   84  802   62  gSTSN     YYCGYS SNSSN        KS  S        G     GG    YY G NSS sS.KSg
   154   33 B N  G <  S-     0   0   13  673   73  y..II     NNEKNS N...S        KN  S        .     CY    N. N .NS sN.NKy
   155   34 B Y    <   -     0   0   98  781   50  FYYNN     FYSSRY Y.YYY        YY  Y        H     YY    RH C .YY YYDYYR
   156   35 B A        -     0   0    0  817   59  VLVLL     VVVVVL LLLLL        AL  L        V     AV    VV V LLL LLYLLI
   157   36 B N  E     -L  212   0C   0  827   79  SHSNN     SSSHSA NAANN        YN  N        S     HS    SS G ASA NNGANF
   158   37 B W  E     -LM 211 171C   0  849    0  WWWWW     WWWWWW WWWWW        WW  W        W     WW    WW W WWW WWWWWW
   159   38 B V  E     -LM 210 169C   0  849   25  YYYFF     YYYYYY YYYYY        YY  Y        Y     YH    YH Y YYY YYYYYY
   160   39 B Q  E     -LM 209 168C  10  849   10  QQQQQ     QQQQQQ QQQQQ        QQ  Q        Q     QQ    QQ Q QQQ QQQQQQ
   161   40 B E  E     -LM 208 167C  20  849    8  QQQQQ     QQQQQQ QQQQQ        QQ  Q        Q     QQ    QQ Q QQQ QQQQQQ
   162   41 B K  E  >  - M   0 166C  68  849   50  RKKKK     NHHKPK KKKKK        KK  K        I     LL    HL I KKK KKkKKK
   163   42 B P  T  4 S+     0   0   98  843   23  PSPPP     PAPPPP PPPPP        SP  P        P     PP    PP P PPP HPpPPP
   164   43 B D  T  4 S-     0   0  148  846   16  GGEGG     GGGGGG DGGGG        GD  G        G     GG    GG G GGG GGGGGE
   165   44 B H  T  4 S+     0   0   90  845   66  SAQKK     KKKQTQ GQQKK        QG  K        T     TT    TK S QQQ QKSQKS
   166   45 B L  E  <  - M   0 162C  92  846   57  GSSAA     AAAAAA TAAAA        AT  A        A     VA    AA A AAA AAASSP
   167   46 B F  E     + M   0 161C   9  847   19  PPPPP     PPPPPP VPPPP        PV  P        P     PP    PP P PPP PPPPPp
   168   47 B T  E     -JM 109 160C  56  843   61  TKKKK     KKKVKR KRRKK        VK  K        K     RR    KK K KKK RKVKKy
   169   48 B G  E     + M   0 159C   1  848   64  IPLLL     LVLLLL LLLLL        LL  L        R     TT    LP T LLL LLTLLL
   170   49 B L  E     +     0   0C   4  848   24  VLLLL     MIIVML LLLLL        VL  L        L     II    LL L LLL LLVLLL
   171   50 B I  E     +NM 177 158C   0  848   19  MIIII     IIIVII IIIII        II  I        I     II    II I III IIIIIS
   172   51 B G  E  >  +N  176   0C   0  849   33  YHYYY     YYYHYY YYYYY        YY  Y        Y     YD    YY Y YYY YYYSYY
   173   52 B G  T  4 S-     0   0    9  848   87  GRGGG     EEGEEG YGGAG        EY  A        S     DS    DE R GKK WAAWYY
   174   53 B T  T  4 S+     0   0    9  849   68  YTAAA     GVFDVA TAAAA        DT  A        S     DS    VS S AAA AANATt
   175   54 B N  T  4 S+     0   0  102  841   49  DSSSS     NNSNSS SSSST        SS  S        A     NN    SS T SSS NTTSSs
   176   55 B N  E  <  -N  172   0C  77  849   69  RNNII     KKNDNS RISSS        KR  S        S     NN    TK S SSS KTNNNN
   177   56 B R  E     -N  171   0C 113  850   66  RLRLL     RRRRRR LRRLL        RL  L        R     RR    RR R RRR LLRRLK
   178   57 B A    >   -     0   0    1  849   73  PAYEE     PPPPPA HAAQQ        PH  Q        A     PP    PP P AAA AHPEEH
   179   58 B P  T 3  S+     0   0   97  849   39  SSTDD     SSSAST STTSS        SS  S        S     SS    SS S SSS SSSSTQ
   180   59 B G  T 3  S+     0   0   83  850   18  GGGGG     GGGGGG GGGGG        GG  G        R     GG    GG G GGG GGNGGg
   181   60 B V  S <  S-     0   0   13  848   23  VVVVV     VVVIVI VIIVV        IV  V        V     II    II V VVV VVIVVv
   182   61 B P    >   -     0   0   57  850    9  PPPPP     SPPPPP PSPPP        PP  P        P     PP    PP P PPP PPPPPP
   183   62 B A  T 3  S+     0   0   77  850   59  DADSS     NDLEDD SADSS        KS  S        D     DD    ED D DDD AASDSS
   184   63 B R  T 3  S+     0   0   58  850    5  RRRRR     RRRRRR RRRRR        RR  R        R     RR    RR R RRR RRRRRR
   185   64 B F  E <   +T  198   0D   4  850    1  FFFFF     FFFFFF FFFFF        FF  F        F     FF    FF F FFF FFFFFF
   186   65 B S  E     -T  197   0D  51  849   17  SSTSS     SSSSSS SSSSS        SS  S        S     SS    SS S SSS SSSSSS
   187   66 B G  E     +T  196   0D   9  850    4  GGGGG     GGGGGG GGGGG        GG  G        G     GG    GG G GGG GGGGGG
   188   67 B S  E     -T  195   0D  41  850    7  sSSSS     SSSSSS SSSSS        SS  S        S     SS    SS S SSS SSSSSs
   189   68 B L  E     -T  194   0D  59  835   79  sGGRR     KKKNKG GGGGR        SG  G        R     KT    KK R GGG GGKGGa
   190   69 B I  E >   -T  193   0D  86  842   31  SSSYY     SSSSSS SSSSS        SS  S        S     SS    SS S SSS SSSSSS
   191   70 B G  T 3  S-     0   0   67  850   18  SGAGG     GGGGGG GGGGG        GG  G        G     GG    GG G GGG GGGGGA
   192   71 B N  T 3  S+     0   0  105  828   57  RTTTT     KNDNNT TTTTT        TT  T        N     SS    NS N TTT TTSTTN
   193   72 B K  E <  S- T   0 190D  68  833   67  SSDDD     TTATTD DEDDD        MD  D        T     SS    TS T DDD DDTDDA
   194   73 B A  E     -RT 143 189D   0  838   81  AYFFF     AAAAAF YFFFF        AY  F        A     AA    AA A FFF FFAFYG
   195   74 B A  E     -RT 142 188D   0  849   57  SSTTT     SSSAST STTTT        TS  T        T     TT    TS T TTT TSTTSI
   196   75 B L  E     -RT 141 187D   0  850    2  LLLLL     LLLLLL LLLLL        LL  L        L     LL    LL L FFL LLLLLL
   197   76 B T  E     -RT 140 186D  19  850   33  TTTTT     TTTTTT TNTTT        TT  T        T     TT    TT T TTT TTTTTH
   198   77 B I  E     -RT 139 185D   0  849    5  IIIII     IVIIII IIIII        II  I        I     II    II I III IIIIII
   199   78 B T  E    S+R  138   0D  78  850   46  SSSSS     SSSSSS STSSS        SS  S        S     TT    ST S SSS SSTSSS
   200   79 B G  S    S-     0   0   15  850   57  GSSSS     GGGRGR NSRSS        GN  S        G     GG    GG S NNN SKGSGG
   201   80 B A        -     0   0    0  849   51  LVVLL     LLLVLL LLLLL        AL  L        L     LL    LL L FFF LVVLLL
   202   81 B Q    >   -     0   0   80  849   32  QEQEE     QQQEQE EQEQQ        QE  Q        Q     QQ    QQ Q QQQ EEQQQQ
   203   82 B T  G >  S+     0   0   84  850   59  PAADD     VAVAAP PSPPP        VQ  P        G     AA    AA A APA PAAAAA
   204   83 B E  G 3  S+     0   0   99  850   17  EEEEE     EEEGEE EGEEE        EE  E        E     EE    EE E EEE EEEEEE
   205   84 B D  G <   +     0   0    1  850    2  DDDDD     DDDDDD DDDDD        DD  D        D     DD    DD D DDD DDDDDD
   206   85 B E    <   +     0   0   71  849   74  EDLMM     EEEEEC ILFFF        EI  F        E     EE    EE E AAA AAEVIE
   207   86 B A  E    S- O   0 227C   3  850   14  AAAAA     AAAAAA AAAAA        AA  A        A     AA    AA A AAA AAAAAA
   208   87 B I  E     -LO 161 226C  55  850   71  DTDTT     DDDDDV TLVTT        DT  T        D     DD    DD D VVV HVVADD
   209   88 B Y  E     -LO 160 225C   0  850    0  YYYYY     YYYYYY YYYYY        YY  Y        Y     YY    YY Y YYY YYYYYY
   210   89 B F  E     -L  159   0C   5  848    8  YYHFF     YYYYYY YFYYY        YF  Y        Y     YY    YY Y YYY YHYYYY
   211   90 B b  E     -L  158   0C   0  849    1  CCCCC     CCCCCC CCCCC        CC  C        C     CC    CC C CCC CCCCCC
   212   91 B A  E     -LP 157 221C   0  848   73  QQGLL     CSSESQ QQQQQ        YQ  Q        G     QA    CE A QQQ QQGQEA
   213   92 B L  E     - P   0 220C   0  845   83  SQQQQ     SSSVLQ QQQQQ        SQ  Q        L     SS    SS T LQL QQGQQI
   214   93 B W  E     + P   0 219C  21  834   71  YWGHH     YYYWYY YYYAS        TG  S        W     YW    YY Y YSY SWYYYW
   215   94 B Y  E >  S- P   0 218C  33  829   88  DSYST     AEADTG SGGNY        DN  Y        G     DD    TD E YYY YDDYNY
   216   95 B S  T 3  S-     0   0  106  829   66  GGSYY     GGDDSS NDSRS        TT  S        S     SS    SS S SNS DSSSNS
   217   96 B N  T 3  S+     0   0  105  824   81  nYYLL     nSsrSS LwSFt        sL  T        E     ss    Ss S anv swS wn
   218   97 B H  E <   -P  215   0C  39  647   66  gPPPP     rd.h.P PprPr        hP  P        .     hk    sn . ppp ppt hh
   219   98 B L  E     -P  214   0C   1  382   85  A.YYY     .fvVSL LYyL.        gL  V        .     ..    l. . ... T.g .t
   220   99 B V  E     -P  213   0C  12  489   66  V.TTT     VVIVTT TTTTT        VT  T        .     ..    H. S ... V.I .N
   221  100 B F  E     -P  212   0C  17  540   30  FFFFF     FFFFFF FFFFF        FF  F        .     ..    S. Y ... F.F .r
   222  101 B G        -     0   0    1  481   35  GGGGG     GGGG G GGGGG        GG  G        .     ..    G. . ... ..G .g
   223  102 B G        -     0   0   51  513   58  ASGGG     GTAG G AQQGQ        GA  Q        .     .G    AG H ... Q.S .S
   224  103 B G        -     0   0    8  528   33  GGGGG     GGGG G GGGGG        GG  G        .     .H    GP G ... G.G .G
   225  104 B T  E     - O   0 209C   0  550   33  TTTTT     TTTT T TTTTT        TT  T        T     .T    ST T ... T.T TT
   226  105 B K  E     -kO 130 208C  82  547   67  QKKKK     RKKK K KKKKK         K  R        K     .V     V V ... E.T VK
   227  106 B L  E     -kO 131 207C   0  546   44  LLLLL     VVLL V LLLVL         L  L              .L     L L .P. L.L L 
   228  107 B T  E     -k  132   0C  34  614   65  TEEEE     TTTT E EEEEE         E  E              TR     Q Q TTT RTT Q 
   229  108 B V  E     -k  133   0C   3  593   35  VIIII     VVVV I LIIII         L  I              VA         VVV AVV V 
   230  109 B L              0   0  120  399   31  L         LLLL                                   LY         LLL AIL I 
   231  110 B G              0   0   62  207   39  G         SG G                                    G             G G A 
## ALIGNMENTS 1331 - 1400
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....4....:....5....:....6....:....7....:....8....:....9....:....0
     1    1 A E              0   0  185  771   30    DQE ED                 E     DD QQ   E       QQQ         Q  Q   EE Q
     2    2 A V        +     0   0   18  834   19   IIVVVVV    VV           E     VV VA   V       VVV         V  V   VV V
     3    3 A Q  E     -A   25   0A  90  836   34   IPZQQQQ    QQ           K     QH HQ   Q       QQQ         Q  Q   QQ Q
     4    4 A L  E     -A   24   0A  13  881    3   LLLLLLL   LLL           L     LL LL   L       LLL         L  L   LL L
     5    5 A Q  E     -A   23   0A 107  882   70   TVVLLVV   QVV           V     QQ KL   L       QQQ         Q  V   VV Q
     6    6 A Q  E     -A   22   0A  14  887   31   QEZEEEE   EEE           E     EE EQ   E       EEE         E  E   EE E
     7    7 A S        -     0   0   33  892   13   PSSSSSSS  SSS           S     SS TS   S       SSS         S  S   SS S
     8    8 A G        -     0   0   52  907   11   GGGGGGGE  GGG           G     GG GG   G       GGG         G  G   GG G
     9    9 A A        -     0   0   80 1179   51   AGGGGGGP  PGG   PPPPP   G     PP PP   G       GGG  PPPP   P  P   GG P
    10   10 A E  E     -d  116   0B  68 1189   46   EDGGGGGV  GGG   GGGTG   G     GG GE   G       GGG  GGGG   S  G   GG G
    11   11 A L  E     +d  117   0B 130 1195   22   FLALLLLI  LLL   LLLLL   L     LL LV   L       LLL  LLLL   L  V   SL L
    12   12 A V  E     -d  118   0B  28 1197   47   KRVVVVVK  VQQ   VVVVV   V     VV VK   A       VVV  VVVV   V  V   VV V
    13   13 A K    >   -     0   0  145 1201   50   NQZQQQKR  KQQ   IAAKA   Q     KK AL   Q       QQQ  KKEK   K  K   QH K
    14   14 A P  T 3  S+     0   0   70 1203    8   SPPPPPPP  PPP   PPPPP   P     PP PP   P       AAA  PPPP   P  P   PP P
    15   15 A G  T 3  S+     0   0   59 1209   28   GGGGGGGG  SGG   SSSSS   G     SS SG   G       GGG  SSSS   S  S   GG S
    16   16 A A    <   -     0   0   36 1213   63   DGRGGGGE  QGG   QQQQQ   G     QQ QA   G       DGD  QQQQ   Q  E   GG Q
    17   17 A S        -     0   0   66 1210   29   SSSSSSSS  TSS   SSSTS   S     SS SS   S       SSS  TTTT   T  P   SS T
    18   18 A V  E     - B   0  83A  10 1213   32   VLLLLLLH  LLL   LLLLL   L     LL LV   L       LLL  LLLL   L  L   LL L
    19   19 A K  E     - B   0  82A 119 1211   53   RKRRRRRT  SRR   SSSSS   R     SS SK   R       RRR  SSSX   S  R   RR S
    20   20 A L  E     - B   0  81A   0 1214   21   LLLLLLLL  LLL   LIILI   L     LL IV   L       LLL  LLLL   L  L   LL L
    21   21 A S  E     - B   0  80A  31 1215   35   SSSSSSST  TSS   TTTTT   S     TT TS   S       SSS  TTTT   T  S   SS T
    22   22 A a  E     -AB   6  79A   0 1216    0   CCCCCCCC  CCC   CCCCC   C     CC CC   C       CCC  CCCC   C  C   CC C
    23   23 A K  E     -AB   5  78A 113 1216   70   KKAAAAAT  AKK   STTST   V     SS TN   A       EAA  AAAA   T  A   AA S
    24   24 A A  E     +A    4   0A   2 1216   49   TAAAAAAA  VGG   VVVVV   G     VV VP   A       AAA  IIII   V  V   AA V
    25   25 A S  E     +A    3   0A  49 1216   12   SSSSSSSS  SST   TSSTS   S     TT ST   S       SSS  SSSS   S  S   SS S
    26   26 A G  S    S+     0   0   56 1215    3   GGGGGGGG  GGG   GGGGG   G     GG GD   G       GGG  GGGG   R  G   GG G
    27   27 A Y  S    S-     0   0   39 1216   33   YFFFFFFF  FFF   YFFDF   F     YY FY   F       RRR  DDDD   F  F   FF F
    28   28 A T    >   -     0   0   90 1216   52   TTSTTTTT  SDT   SSSSS   D     SS SK   S       TTT  SSSS   S  L   TT S
    29   29 A F  G >  S+     0   0   13 1216   27   YFFFFFFF  IFL   ILLIL   F     II LF   F       SSS  VVVV   L  I   FF L
    30   30 A T  G 3  S+     0   0   40 1216   55   TTSSSSSS  TSS   TTATT   S     AT TG   S       HHH  SSSS   T  T   SS T
    31   31 A S  G <  S+     0   0   23 1216   57   sSTsattS  tSS   sSSsS   D     sr DS   t       ggg  ttss   s  t   ss S
    32   32 A Y  E <  S-E  100   0B  40 1139   28   yYY..y.Y  yFF   yYYyY   Y     yy YY   .       yyy  aata   v  y   .. Y
    33   33 A W  E     -E   99   0B  40 1148   92   .GAaa.wD  RRG   YGG.G   A     YN GD   a       GGG  TAaA   .  C   gg D
    34   34 A M  E     -EF  98  51B   0 1206   49   LMMMM.MM  WLM   WVVWV   F     WW VI   M       MMM  WWWW   V  W   MM V
    35   35 A H  E     -EF  97  50B   0 1212   72   HNHSS.KH  SGS   NHSSS   S     SN HS   A       GGG  NNNN   G  H   NN H
    36   36 A W  E     -EF  96  49B   0 1216    0   WWWWWWWW  WWW   WWWWW   W     WW WW   W       WWW  WWWW   W  W   WW W
    37   37 A V  E     -EF  95  47B   0 1216   17   IIVVVVVV  IVI   IVVIV   V     FI VV   V       FFF  IIII   V  N   VV I
    38   38 A K  E     -EF  94  46B   7 1216   22   RRRRRRRR  RRR   RRRRR   R     RR RR   R       RRR  RRRR   R  W   RR R
    39   39 A Q  E     +EF  93  45B  20 1216    5   QQQQQQQQ  QQQ   HQQKQ   Q     QR QQ   Q       QQQ  QQQQ   Q  Q   QQ Q
    40   40 A R    >   -     0   0   35 1216   71   SAAAAAAT  PAA   FPPFP   A     FF PA   A       VVI  SSSS   P  T   AA A
    41   41 A P  T 3  S+     0   0  130 1215   15   PPPPPPPP  PPP   PPPPP   P     PP PP   P       PPP  PPPP   P  P   PP P
    42   42 A G  T 3  S+     0   0   83 1216   22   EGGGGGGG  GEG   GGGGG   G     GG GG   G       GGG  SSSS   G  G   RG G
    43   43 A R  S <  S-     0   0  156 1216   43   NKKKKKKK  KKK   NKKNK   K     DN KQ   K       KKK  RRRR   K  K   KK K
    44   44 A G        -     0   0   16 1215   36   GGGGGGGG  RGG   KGGKG   G     KK GG   G       EEE  GGGG   A  E   GG G
    45   45 A L  E     -F   39   0B   8 1215   10   LLLLLLLL  LLL   LLLFL   L     LL LL   L       RRR  LLLL   L  L   LL L
    46   46 A E  E     -F   38   0B  34 1216    6   EEZEEEEE  EEE   EEEEE   E     EE EE   E       EEE  EEEE   E  E   EE E
    47   47 A W  E     -F   37   0B   3 1216   10   WWWWWWWW  WPP   WWWYW   S     WW WW   W       LLL  WWWW   W  W   WW W
    48   48 A I  E     -     0   0B   0 1215   31   IVLVVVVV  IVV   MLLVL   L     MM LM   V       VVV  LLLL   L  V   VV V
    49   49 A G  E     -FG  36  60B   0 1216   35   VSSAAGVA  GAA   GGGGG   A     GG IG   S       AAA  GGGG   G  G   AA G
    50   50 A R  E     -FG  35  59B  32 1216   94   KYVWWWwE  GIG   YVVYV   G     YY Vw   A       AAA  rrRR   I  A   VV A
    51   51 A I  E     -FG  34  58B   0 1207   17   IIIKK.vV  III   IIIII   I     II Il   I       III  yyTT   F  I   II V
    52   52 A D     >  -     0   0   26 1212   86   NNSYYRES  RSS   GWWDW   W     SN WY   G       RRR  YYYY   N  C   WW W
    53   53 A P  T  4 S+     0   0    0 1212   83   TGYEEYQT  NLS   YAGYG   S     FY SD   G       WWW  RRYY   S  Y   YY G
    54   54 A N  T  4 S-     0   0   96 1213   69   GABNNEVG  DDS   DGDSD   S     DD DG   R       SSS  SSRR   D  E   DD G
    55   55 A G  T  4 S-     0   0   69 1216   57   SGGGGgVS  GGG   GGGGG   G     GG GN   D       GGG  QKss   G  G   GG G
    56   56 A G     <  +     0   0   25  915   61   GSBNNs..  ..S   .....   L     .. ..   E       LTR  WWww   .  .   SS .
    57   57 A G        -     0   0   43 1195   77   NSBDDLES  DSD   NSSTS   S     NS S.   G       ESN  FYLY   N  S   QQ S
    58   58 A T  E     -G   51   0B  62 1209   46   GTZKKTKK  TTT   NTTTT   T     IN PA   S       TTT  TDNN   I  V   KK T
    59   59 A K  E     -G   50   0B  89 1212   88   DSYHHHAY  KYY   NNNYN   Y     NN NR   Y       YYY  DDDD   F  Y   YY D
    60   60 A Y  E     -G   49   0B  46 1215    9   FYYYYYFY  YYY   YNYYY   Y     YY YP   Y       HYY  YYYY   L  Y   YY Y
    61   61 A N    >>  -     0   0   12 1216   63   HAAAAAAS  NAA   TNHNH   A     NN NT   A       KAA  AAAA   N  A   AA N
    62   62 A E  G >4 S+     0   0  148 1216   64   PDADDVNQ  PDD   PSSPS   E     PP PQ   E       DDD  VVTV   S  S   DD P
    63   63 A K  G 34 S+     0   0  109 1216   64   SSSSSSSS  SAA   SAASA   S     SS AN   S       SSS  SSFS   A  S   SS T
    64   64 A F  G X> S+     0   0    5 1216   45   FVVVVVVV  LVV   LLLLL   V     LL LF   L       VVV  VVVV   L  F   VV L
    65   65 A K  T << S+     0   0  156 1216   40   QKKNNQNQ  KKQ   KMIKI   K     KK KK   K       KKK  RKKK   K  K   KK K
    66   66 A S  T 34 S+     0   0  108 1216   35   GGGGGGGG  SGG   NSSSS   G     NN SD   G       GGG  SSSS   S  S   GG S
    67   67 A K  T <4 S+     0   0   33 1214   21   RRRRRRRR  RRR   RRRRR   R     RR RR   R       RRR  RRRR   R  R   RR R
    68   68 A A  E  <  -C   83   0A   2 1216   69   FFFFFFFF  VFF   ILLIL   F     II LI   L       FFF  IIII   L  A   FF L
    69   69 A T  E     -C   82   0A  58 1216   37   TTTTTTTT  STT   SSSAS   T     SS SN   T       TTT  ATTT   S  T   TT S
    70   70 A L  E     +C   81   0A   7 1216   27   IIIIIIII  III   IIIII   I     IV II   I       III  IIII   V  I   II I
    71   71 A T  E     -C   80   0A  57 1213   47   SSSSSSSS  SSS   TSSTS   S     TT SI   S       SSS  NNNX   I  S   SS T
    72   72 A V  E     -C   79   0A  28 1216   71   QRRRRRRR  RRR   RKKRK   R     RR KK   R       RRR  PPPP   R  R   RR R
    73   73 A D  E   > -C   78   0A  69 1216    7   DDBNNNND  DDD   DDDDD   D     DD DD   D       DDD  DDDD   D  D   DD D
    74   74 A K  T > 5S+     0   0  105 1216   62   VNBDDDDN  TNN   TNNTN   D     TT NT   N       NNN  TTTT   I  M   NN M
    75   75 A P  T 3 5S+     0   0  122 1215   37   SGSSSSSS  SGG   SSSSS   S     SS PS   S       TVV  SSSS   A  A   AA S
    76   76 A S  T 3 5S-     0   0   37 1216   65   ANKKKKKK  KQQ   SKKKK   Q     KK KT   K       KKK  KKKK   E  K   KK K
    77   77 A S  T < 5 +     0   0   24 1216   48   TSBNNNNQ  NSS   NSSNS   N     NN SN   N       NND  NNNN   S  N   NN S
    78   78 A T  E   < -BC  23  73A   8 1216   64   TLTTTTTQ  QTT   QQQQQ   T     QQ QI   T       MMM  QQQQ   Q  E   MM Q
    79   79 A A  E     -BC  22  72A   0 1207   67   ALMLLLLV  FLL   FVVYV   A     FF VV   V       VVL  LFFF   L  F   LA V
    80   80 A Y  E     -BC  21  71A  61 1209   36   FHYYYYYY  SYY   FFFSF   Y     FF FY   Y       YYY  SSSS   S  S   YY Y
    81   81 A M  E     -BC  20  70A   0 1212    9   LLLLLLLL  LLL   LLLLL   L     LL LM   L       LLL  LLLL   L  L   LL L
    82   82 A Q  E     -BC  19  69A  69 1215   43   QQELQQQE  QQQ   KKKQK   Q     RK KE   Q       QQQ  QQQQ   S  Q   QH T
    83   83 A L  E     -BC  18  68A   0 1215   14   IMMMMMMM  LMM   LMLLL   M     LM MM   M       MMM  LLLL   L  L   IM L
    84   84 A S        +     0   0   32 1215   56   HNNNNLIN  SDN   DNNSN   N     NN NR   D       NNN  SNSN   S  N   NN N
    85   85 A S  S    S-     0   0   89 1216   25   HSSSGSSS  SSG   SSSSS   S     SS SG   R       SSS  SSSS   S  S   SS S
    86   86 A L        +     0   0    2 1216   15   LLLLLLVL  MLL   VLLVL   L     VV LL   L       LLL  VVVV   V  V   LL M
    87   87 A T    >   -     0   0   61 1215   68   RKRQQETK  TKK   TQQTQ   R     TT QT   R       KKK  TTTT   S  T   RR R
    88   88 A S  G >  S+     0   0   72 1216   59   LAAAAPPT  TAA   TTTTT   T     PT TP   A       PPP  PPPP   A  D   AA G
    89   89 A E  G 3  S+     0   0  107 1216   21   EEEZZZZE  EEE   EDDED   E     EE DD   D       EEE  EDEE   E  A   DE E
    90   90 A D  G <  S+     0   0    7 1216    3   DDNBVBBD  DDD   DDDDD   D     DD DD   D       DDD  DDDD   D  D   DD D
    91   91 A S    <   +     0   0   31 1216   34   TTTTSTTS  TPT   TTTTT   T     TT TT   T       TTT  TTTT   T  T   TT T
    92   92 A A  E    S- H   0 116B  10 1214    5   AAAAAAAA  AAA   AAAAA   A     AA AA   A       AAA  AAAA   A  A   AA A
    93   93 A V  E     -EH  39 115B  21 1216   48   MMVLIVVV  TTT   TMTTT   R     TT MT   I       VVV  VVVV   V  L   MM V
    94   94 A Y  E     -EH  38 114B   0 1216    1   YYYYYYYY  YYY   YYYYY   Y     YY YY   Y       YYY  YYYY   Y  Y   YY Y
    95   95 A Y  E     -E   37   0B   1 1216    3   YYYYYYYY  YYY   YYYFY   F     FY YF   F       YHT  YYYF   Y  Y   YY F
    96   96 A a  E     +E   36   0B   0 1216    1   CCCCCCCC  CCC   CCCCC   C     CC CC   C       CCC  CCCC   C  C   CC C
    97   97 A A  E     -EI  35 110B   0 1215   24   AAAAAAAA  AVA   AAAAA   A     VA AV   T       AAA  VAAA   A  A   TT A
    98   98 A R  E     -E   34   0B  13 1196   38   TRRRRRRR  RRK   RRKRK   G     RR RR   K       AAV  RRRS   S  R   AA R
    99   99 A M  E     -EI  33 107B   5 1101   82   DDSDDVVE  AAC   GVLSR   C     PL GG   I       RRR  LDDG   F  E   DD D
   100  100 A W  E >   -E   32   0B  89 1101   89   QtgAATvS  TvA   REIpG   Y     Li gT   D       ttt  VtlN   y  S   Lt t
   101  101 A Y  T 3  S+     0   0  112  572   91   .s......  ..T   .....   .     .g ..   .       ...  ....   y  .   .. a
   102  102 A Y  T 3  S-     0   0  133  629   92   .E......  ..D   ..Y..   R     YY ..   .       ...  ....   I  .   .. G
   103  103 A G  S <  S+     0   0   38  705   79   .r......  ..W   W.Y..   W     yy ..   W       ...  ...Y   Y  .   .. a
   104  104 A T        -     0   0   32  784   66   .daggp.h  .ig   SqdgG   d     .d ga   s       rrr  g.g.   D  P   .g g
   105  105 A Y        +     0   0   81  679   93   .sgtttts  .ap   .sly.   e     yY g.   t       ppp  sr..   Y  .   .. s
   106  106 A Y        -     0   0   32  842   66   .RTFFFSK  .Fw   CSCF.   y     yy y.   F       vvv  WLlF   w  .   .. C
   107  107 A F  E     +I   99   0B   0  885   48   ...FFSML  VIl   ...FF   i     tm fl   .       fff  LFvF   i  .   .. .
   108  108 A D  E     +     0   0B  25  997   46   .EDAAADS  SVD   D..AA   D     DD AD   D       AAA  DDED   H  T   RN .
   109  109 A Y  E     -J  168   0C 108 1059   61   IFYHHVVV  LAA   VYYNY   L     YY YP   N       YYY  YYYS   Y  V   FV .
   110  110 A W  E     -I   97   0B  23 1092    2   WWWYWWWW  WWW   WWWWW   W     WW WW   W       WWW  WWWW   W  W   WW W
   111  111 A G        -     0   0    3 1067   15   G GGGGGG  EGG   GGGGG   G     GG GG   G       GGG  GGGG   G       A A
   112  112 A Q        -     0   0  141 1047   41     ZQQQQQ  GRR   AQQQQ   P     QQ QQ   R       QQQ  QQQQ   P       P Q
   113  113 A G        -     0   0   20 1013   12     GGGGGG  SGG   GGGGG   G     GG GG   G       GGG  GGGG   G       E G
   114  114 A T  E     - H   0  94B   2  996   31     TTTTTS   TA   TTTTT   V     AT TT   T       TTT  TATT   L       E F
   115  115 A T  E     - H   0  93B  60  979   76     LLLLPT   SS   TLTLL   E        LL   L       QQQ  LLLL   L       V P
   116  116 A L  E     -dH  10  92B   1  972   19     VVVVVF   VV   VVLVV   V        VV   V       VVV  VVVV   V         L
   117  117 A T  E     -d   11   0B  57  953   21     TTTTTT   TT   TTTTT   V        TT   T       TTT  TTTT   T         K
   118  118 A V  E     +d   12   0B   4  935    8     I        VV   VVVVV   V        VV   V       VVV  VVVV   I         L
   119  119 A S              0   0   64  917   10     S        SS   SSSSS   S        SS   S       SSS  SSSS   S         S
   120  120 A S              0   0  122  885   21     S        SS   SASAA   S        AS   S       SSS  SSSS   S         A
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32           QH   QQQ     EEQ Q QQQ  Q  DEQ  QDEEED   QQ      Q EQ QQQ  Q 
   123    2 B A        -     0   0   19  713   70           IS   SSY     IIS S SSS  P  INA SAILLLI   PS      S IA YSS  S 
   124    3 B V        -     0   0   84  765   49           TV   VVV     VVV AAVEV  V  QLV VRQVTVQ   VV      A VA VGV  V 
   125    4 B V  E     -Q  145   0D  10  820   26           VL   LLL     MLL LLLLL  L  MLL LLMMLMM   LL    L L ML LLL  L 
   126    5 B T  E     +Q  144   0D  69  829   11  T        TT   TTT     TTT TTTTT  T  TTT TTTTTTT   TT    T T TT TTT  T 
   127    6 B Q  E     -Q  143   0D  18  832    2  Q        QQ   QQQ     QQQ QQQQQ  Q  QQQ QQQQQQQ   QQ    Q Q QQ QQQ  Q 
   128    7 B E        -     0   0   59  833   63  L        PP   PPP     SSP PPPPP  S  SSP PPTSSSS   PP    S P SP PPP  P 
   129    8 B S  S    S+     0   0  101  841   38  P        GP   AAP     PPP RPPPS  S  PPA PQIPPPP   SP    P A PA APS  S 
   130    9 B A  E     -k  226   0C  59  842   50  S        AS   SSS     AGS SSSSS  S  SAS SSSSDAS   SS    G S AS SSS  S 
   131   10 B L  E     -k  227   0C  57  847   76  V        VL   VVV     TTV VVVVL  A  SIL VVSSTTS   HV    T V SV VVE  V 
   132   11 B T  E     +k  228   0C  84  848   77  S        SS   SSS     LLS SSSSS  S  LMS STLLLLL   SS    L S LS SSS  S 
   133   12 B T  E     -k  229   0C  18  848   68  V        SG   GGV     SSG GVGGG  A  SSA GASASSP   AA    S G SA VGG  G 
   134   13 B S    >   -     0   0   55  849   70  S        AT   SSS     vlS SSAGS  S  aaS SSaalla   SA    lSS lN SSA  A 
   135   14 B P  T 3  S+     0   0   61  848   65  L        VP   LLP     ppL PPLLL  L  vpP PPlvppv   SP    pPP qP VLV  P 
   136   15 B G  T 3  S+     0   0   46  850    7  G        GG   GGG     GGG GGGGG  G  GGG GGGGGGG   GG    GGG EG GGG  G 
   137   16 B E    <   -     0   0  108  850   56  Q        DE   QQQ     EEE QQQQQ  S  DEA QQDDEED   AQ    DQQ EE GQQ  E 
   138   17 B T  E     - R   0 199D  88  850   66  T        TR   RRN     RRR STRTR  S  RKS RTRRRGR   SK    RTS KT TKK  R 
   139   18 B V  E     - R   0 198D  14  850   33  A        VV   VVA     AAV VAVVV  V  VVA AAVVAAV   VV    AVV VV VVV  V 
   140   19 B T  E     - R   0 197D  53  849   41  R        TT   TTQ     TTT TVTTT  K  TTS TTTTTTT   RT    TTS TK KTT  T 
   141   20 B L  E     - R   0 196D   0  849   25  I        II   IIL     LLI IIIII  L  IML ILIFLLI   LI    LII II LII  I 
   142   21 B T  E     - R   0 195D  22  849   52  T        KS   SST     SSS STSSS  T  TTT STSTSST   TS    SSS TT TSS  S 
   143   22 B b  E     -QR 127 194D   0  850    2  C        CC   CCC     CCC CCCCC  C  CCC CCCCCCC   CC    CCC CC CCC  C 
   144   23 B R  E     -Q  126   0D 133  850   77  G        RT   TTS     RRS TSTAT  T  RST TMRRRRR   MS    RTT RS ETT  T 
   145   24 B S  E >   -QS 125 148D  11  850   68  G        TG   GGG     AAG GGGGG  L  AAL GGAAAAA   LG    ARG AG GGG  G 
   146   25 B S  T 3  S+     0   0   81  850   27  N        SN   SSN     SSS TDSSG  S  SSR SDSSSSS   SS    SST SG DSS  S 
   147   26 B T  T 3  S-     0   0   87  850   71  N        QS   SSN     QQS SNSRS  S  QSS SSQQQQQ   SS    QSI QG DSS  S 
   148   27 B G  B <  S+S  145   0D  39  850   55  I        NN   SSI     SST SLSST  G  SSG SHDSSST   GS    SGN SS iSS  T 
   149   28 B A        -     0   0   40  390   77  .        ..   NN.     ..N D.N.N  .  ... NS.....   .N    .SD .. aNN  N 
   150   29 B V        -     0   0    3  620   45  .        VN   II.     .VV V.INI  .  ... IV..V..   FI    .IV .Y VII  I 
   151   30 B T    >   -     0   0   56  541   72  .        YI   GG.     .SG G.GIG  .  ... GG..S..   SG    LAG .A .GG  G 
   152   31 B T  G >  S+     0   0   94  694   78  G        NG   RR.     VSG AERGD  H  I.. RNIISVI   VN    RSG VG .GR  N 
   153   32 B S  G 3  S+     0   0   84  802   62  S        NG   GGg     SSN YKGIG  s  SV. GENSSGN   gN    SNY SS .SG  G 
   154   33 B N  G <  S-     0   0   13  673   73  K        NN   ..k     N.. NTNAY  y  SS. N.NS.SN   f.    S.R SY ...  Y 
   155   34 B Y    <   -     0   0   98  781   50  N        YY   YYA     NYG SFYGS  I  YY. YGYYYYY   WY    QYF YY .YY  Y 
   156   35 B A        -     0   0    0  817   59  A        LV   VVV     LLV VVVVV  I  LV. VALLLLL   IV    LVV LY .VV  V 
   157   36 B N  E     -L  212   0C   0  827   79  Y        HH   GGH     AAE SSSNY  A  NY. EASNAAN   RS    VQS AG HNS  H 
   158   37 B W  E     -LM 211 171C   0  849    0  W        WW   WWW     WWW WWWWW  W  WW. WWWWWWW   WW    WWW WW WWW  W 
   159   38 B V  E     -LM 210 169C   0  849   25  Y        YY   YYY     YYY YFYYY  H  YY. YLYYYYY   YY    YYY YY YFF  Y 
   160   39 B Q  E     -LM 209 168C  10  849   10  Q        QQ   QQQ     QQQ QQQQQ  Q  QL. QQQQQQQ   QQ    QQQ QQ QQQ  Q 
   161   40 B E  E     -LM 208 167C  20  849    8  Q        QQ   QQQ     QQQ QQQQQ  Q  QQ. QQQQQQQ   QQ    QQR QQ QFQ  Q 
   162   41 B K  E  >  - M   0 166C  68  849   50  K        KL   LLK     KKV HRLHH  Q  KK. LHKKKKK   KL    KRR Kk MPL  L 
   163   42 B P  T  4 S+     0   0   98  843   23  P        DP   PPP     PPP PPSPQ  P  PP. PPPPPPP   PP    PPP Pp ..P  P 
   164   43 B D  T  4 S-     0   0  148  846   16  G        GE   GGG     GGR GGGGG  G  GG. GGDGGGG   GG    GGG GG .GG  G 
   165   44 B H  T  4 S+     0   0   90  845   66  Q        GT   TTS     QQK KQTKK  K  KS. KQGKQQK   NT    QSK QS .TT  K 
   166   45 B L  E  <  - M   0 162C  92  846   57  S        VA   GGA     PAA ASAAA  A  AS. AATAAAV   PA    RAA AA LAS  V 
   167   46 B F  E     + M   0 161C   9  847   19  P        PP   PPP     PPP PPPPP  p  PPI PPVPPPP   PP    PPP PP pPP  P 
   168   47 B T  E     -JM 109 160C  56  843   61  V        KK   RRL     RRK KLKKK  k  KRN KRKKRRK   RK    RTK KV rRR  K 
   169   48 B G  E     + M   0 159C   1  848   64  L        LL   TTL     LLL LLLLT  L  LLV LLLLLLL   YL    LTL LT LTT  L 
   170   49 B L  E     +     0   0C   4  848   24  V        LF   LLV     LLL MVLLI  E  LLC LLLLLLL   LL    LVI LV IVV  I 
   171   50 B I  E     +NM 177 158C   0  848   19  I        II   III     III IIIII  G  IIT ITIIIII   LI    III II III  I 
   172   51 B G  E  >  +N  176   0C   0  849   33  Y        YY   YYY     YYY FYYYY  S  YYP YLYYYYY   YY    YYS YY YYY  Y 
   173   52 B G  T  4 S-     0   0    9  848   87  Y        LG   DDS     GGD DHGGG  G  ADR DRYAGGA   YD    GED GD SGS  E 
   174   53 B T  T  4 S+     0   0    9  849   68  S        AN   NND     AAN VTNST  S  ATI VNTAAAA   hN    VDV TN DNS  Y 
   175   54 B N  T  4 S+     0   0  102  841   49  N        SS   SSS     SSS TSSSS  Y  SSY NNSSSSS   sN    SNI ST DNN  S 
   176   55 B N  E  <  -N  172   0C  77  849   69  N        NN   NNN     TSN KENNS  N  SNW NQRSSSS   NK    NQR NN NNY  K 
   177   56 B R  E     -N  171   0C 113  850   66  R        RR   RRR     RRR RRRRR  K  LLQ RRLLRRL   KR    RRR RR RRR  R 
   178   57 B A    >   -     0   0    1  849   73  P        AH   PPP     AAP PPPPP  G  QAG APHQAAQ   GP    APP AP PPP  P 
   179   58 B P  T 3  S+     0   0   97  849   39  S        SS   SSS     TTS SSSSS  S  SSS SSSSTTS   QS    TSS TS DLS  S 
   180   59 B G  T 3  S+     0   0   83  850   18  G        GG   GGG     GGG GEGGG  G  GGG GGGGGGG   gG    GGG GN GGG  G 
   181   60 B V  S <  S-     0   0   13  848   23  I        IV   VVI     III VIVVV  V  VVV VVVVIIV   vI    IVV VI III  I 
   182   61 B P    >   -     0   0   57  850    9  P        PP   PPP     PPS PPPPP  P  PPP PSPPPPP   PP    PPP PP PPP  P 
   183   62 B A  T 3  S+     0   0   77  850   59  E        AD   DDD     ADD DEDDE  D  SVS NESSDDS   SD    DDD SS EDD  D 
   184   63 B R  T 3  S+     0   0   58  850    5  R        RR   RRR     RRR RRRRR  R  RRR RRRRRRR   RR    RRR RR RRR  R 
   185   64 B F  E <   +T  198   0D   4  850    1  F        FF   FFF     FFF LFFFF  F  FFF FFFFFFF   FF    FFF FF FFF  F 
   186   65 B S  E     -T  197   0D  51  849   17  S        TS   SSS     SSS SSSSS  S  SSS SSSSSSS   SS    SSS SS SSS  S 
   187   66 B G  E     +T  196   0D   9  850    4  G        GG   GGG     GGG GGGGG  G  GGG GGGGGGG   GG    GGS GG gGG  G 
   188   67 B S  E     -T  195   0D  41  850    7  S        SS   SSA     SSS SSSSS  S  SSs SSSSSSS   sS    SsS SS sSS  S 
   189   68 B L  E     -T  194   0D  59  835   79  N        GK   KKN     GGR KSKTR  S  GGa KRGGGGG   aK    GiK GP .KS  R 
   190   69 B I  E >   -T  193   0D  86  842   31  S        SS   SSS     SSS SSSSS  S  SSS SSSSSSS   SS    ASS SS .SS  S 
   191   70 B G  T 3  S-     0   0   67  850   18  G        NG   GGG     GGG GGGGG  G  GGA GGGGGGG   AG    GSD GG GGG  G 
   192   71 B N  T 3  S+     0   0  105  828   57  N        SN   SSN     TTS DASNN  A  TTN NSTTTTT   NT    TNN TS NSS  S 
   193   72 B K  E <  S- T   0 190D  68  833   67  M        DS   TTT     EDS TTTTT  D  DSA SMDDDDD   AS    DST DT TSS  S 
   194   73 B A  E     -RT 143 189D   0  838   81  A        FA   AAA     FFG AAGGG  R  FYG VAYFFFF   GA    FAA FN AAA  A 
   195   74 B A  E     -RT 142 188D   0  849   57  T        TS   TTT     TTT STSSS  Y  TSI SSSTTTT   IT    TSY ST STT  S 
   196   75 B L  E     -RT 141 187D   0  850    2  L        LL   LLL     LLL LLLLL  L  LLL LLLLLLL   LL    LLL FL LLL  L 
   197   76 B T  E     -RT 140 186D  19  850   33  T        TT   TTT     TTT TTTTT  T  TTL TSTTTTT   RG    TST TT ETT  T 
   198   77 B I  E     -RT 139 185D   0  849    5  I        II   III     III IIIII  I  III IIIIIII   II    III II III  I 
   199   78 B T  E    S+R  138   0D  78  850   46  S        ST   SST     SST SSTTT  S  SSS TSTSSSS   ST    SSS ST STT  T 
   200   79 B G  S    S-     0   0   15  850   57  G        GG   GGG     RRG GGGGG  N  SRG GGNSRRT   GG    RGG SG GGG  G 
   201   80 B A        -     0   0    0  849   51  V        VL   LLV     LLL LALLL  L  LML LLLLLLL   LL    LLL LV ALL  L 
   202   81 B Q    >   -     0   0   80  849   32  Q        QQ   QQQ     QEQ RQQQK  Q  QEQ QQEQEEQ   QQ    EKQ EQ QQQ  Q 
   203   82 B T  G >  S+     0   0   84  850   59  A        AP   AAA     SPA ASAAT  F  PAS AAQPPPP   PT    PTA PV AAA  A 
   204   83 B E  G 3  S+     0   0   99  850   17  E        EE   EEQ     EEE DVEEE  E  EEE EEEEEEE   EG    EEE EE GEE  E 
   205   84 B D  G <   +     0   0    1  850    2  D        DD   DDD     DDD DDDDD  D  DDD DDDDDDD   DD    DDD DD DDD  D 
   206   85 B E    <   +     0   0   71  849   74  E        AE   EEE     FFE EEEEE  E  FAE KEVFFFF   EE    FEE VE EEE  E 
   207   86 B A  E    S- O   0 227C   3  850   14  A        AA   AAA     AAA AAAAA  A  AAA AAAAAAA   AA    AAA AA APA  A 
   208   87 B I  E     -LO 161 226C  55  850   71  D        VV   DDD     VVD DDDDD  D  TTD DDTTVVT   DD    VDD VI DED  D 
   209   88 B Y  E     -LO 160 225C   0  850    0  Y        YY   YYY     YYY YYYYY  Y  YYY YYYYYYY   YY    YYY YY YYY  Y 
   210   89 B F  E     -L  159   0C   5  848    8  Y        YY   YYY     YYY YFYYY  Y  YYY YYFYYYY   YY    YYY YF YYY  Y 
   211   90 B b  E     -L  158   0C   0  849    1  C        CC   CCC     CCC CCCCC  C  CCC CCCCCCC   CC    CCC CC CCC  C 
   212   91 B A  E     -LP 157 221C   0  848   73  A        QQ   SSQ     QQS CQALS  E  QQM ESQQQQQ   GG    QQS QG QAS  Q 
   213   92 B L  E     - P   0 220C   0  845   83  T        SS   TTV     QQA STASS  T  QQI DAQQQQQ   TT    QLS QS MLL  S 
   214   93 B W  E     + P   0 219C  21  834   71  Y        YY   YYW     YYW YWWVW  W  SWW WWGSYYT   WW    YMY YY YWW  Y 
   215   94 B Y  E >  S- P   0 218C  33  829   88  H        HD   DDD     NGD ADDDD  D  YTH GDNYGGY   HD    GMT NE TDD  D 
   216   95 B S  T 3  S-     0   0  106  829   66  P        YD   SSS     NSS GTSVK  S  SSS NSTSSSI   SS    SAS SG NDS  S 
   217   96 B N  T 3  S+     0   0  105  824   81  S        pS   SSn     wST RiSTS  N  TYS ssLTSST   NS    sAs GS sNs  S 
   218   97 B H  E <   -P  215   0C  39  647   66  w        q.   ..h     pP. y..R.     .PA nsPPPPP    .    ..t .. p.k  . 
   219   98 B L  E     -P  214   0C   1  382   85  l        D.   ..p     WW. va...     LFL ..YITGL    .    y.y .. y..  . 
   220   99 B V  E     -P  213   0C  12  489   66  T        V.   ..A     TT. II...     TTV GATTTTT    .    T.V .. I..  . 
   221  100 B F  E     -P  212   0C  17  540   30  S        F.   LLr     FFL FFL.L     FFF YYFFFFF    L    F.F Y. F..  I 
   222  101 B G        -     0   0    1  481   35  G        T.   SSg     GGG GG.GS     GGG ..GGGGG    S    G.G .T G..  S 
   223  102 B G        -     0   0   51  513   58  A         .   GGK     QQG GG.AG     GSG ..GQQQG    A    Q.T .S G..  G 
   224  103 B G        -     0   0    8  528   33  G         .   GGG     GGA GG.DH     GGG ..GGGGG    G    G.G .A G..  P 
   225  104 B T  E     - O   0 209C   0  550   33  R         .   TTS     TTT TTNTT     TTT ..TTTTT         T.T TA T..  T 
   226  105 B K  E     -kO 130 208C  82  547   67  E         .   VVK     RKV KKAVV     KKK ..KRKKK         K.K  A Q.G  V 
   227  106 B L  E     -kO 131 207C   0  546   44  L         L   LLI     VVL LLHLL     VLL ..LLVVV         L.V  L L.H  L 
   228  107 B T  E     -k  132   0C  34  614   65  S         D   QQT     EEQ TTT R     EET TTEEEEE         E.T  T T.T  Q 
   229  108 B V  E     -k  133   0C   3  593   35  L         V     V     II  VVV V     ILV VVIIIII         I.V    V.V    
   230  109 B L              0   0  120  399   31  F               L         LLL         L LL               LL    LLL    
   231  110 B G              0   0   62  207   39                  G         GS                             G     TN     
## ALIGNMENTS 1401 - 1470
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 A E              0   0  185  771   30  Q QQQ E        EE   Q    DQ          EEEEEE       QQ    Q             
     2    2 A V        +     0   0   18  834   19  V VVV V        VV   V  V IV          EEEEEE       LV    V             
     3    3 A Q  E     -A   25   0A  90  836   34  Q QQQ K        QQ   Q  Q QL          KKKKKK       QQ    Q             
     4    4 A L  E     -A   24   0A  13  881    3  L LLL L        LL   L  L LL          LVLLLL       LL    L             
     5    5 A Q  E     -A   23   0A 107  882   70  Q RRK V        VA   V  V VV          VVVVVV       QQ    Q             
     6    6 A Q  E     -A   22   0A  14  887   31  EEEEE E        EE   Q  E EE          EEEEEE       EQ    E             
     7    7 A S        -     0   0   33  892   13  SSSSS S        SS   S  S SS          SSSSSS       SS    S             
     8    8 A G        -     0   0   52  907   11  GEGGG G        GG   G  G GG          GGGGGG       GG    G             
     9    9 A A        -     0   0   80 1179   51  PGPPP G        GG   G  G GGP         GGGGGR       PP    G    P PAP    
    10   10 A E  E     -d  116   0B  68 1189   46  GGSSG N        GG   G  G DDS         GGGGGG       GG    G    GGGGG    
    11   11 A L  E     +d  117   0B 130 1195   22  LLLLV L        LL   L  L VVL         LLLLLL       LL    L    LLLLL    
    12   12 A V  E     -d  118   0B  28 1197   47  VFVVV G        VV   V  Q RKV         VVVVVV       VV    V    VVVVV    
    13   13 A K    >   -     0   0  145 1201   50  KKKKK Q        QQ   K  Q QKK         QQQQQQ       KK    Q    EKKKK    
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPPP P        PP   P  P PPP         PPPPPP       SP    P    XPPPP    
    15   15 A G  T 3  S+     0   0   59 1209   28  STSSS G        GG   G  G GGS         GGGGGG       AS    G    SSSSS    
    16   16 A A    <   -     0   0   36 1213   63  QDQQQ G        GG   G  G GDQ         GGGGGG       EE    G    QQQQQ    
    17   17 A S        -     0   0   66 1210   29  TTTTT S        AS   S  S SST         SSSSSS       TT    S    TTTTT    
    18   18 A V  E     - B   0  83A  10 1213   32  LLLLL L        LL   L  L LLL         LLLLLL       LL    L    LLLLL    
    19   19 A K  E     - B   0  82A 119 1211   53  STSSS R        RR   R  R KRS         RRRRRR       SS    R    SSSSS    
    20   20 A L  E     - B   0  81A   0 1214   21  LLLLL L        VL   L  L LLL         LLLLLL       LL    L    LLLLL    
    21   21 A S  E     - B   0  80A  31 1215   35  TTTTT S        SS   S  S SST         SSSSSS       TT    S    TTTTT    
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCCC C        CC   C  C CCC         CCCCCC       CC    C    CCCCC    
    23   23 A K  E     -AB   5  78A 113 1216   70  TTTTA V        VA   V  K KKS         VVVVVV       ST    T    AAAAA    
    24   24 A A  E     +A    4   0A   2 1216   49  VVVVV A        AA   A  G AAV         GGGGGG       VV    A    IIIVI    
    25   25 A S  E     +A    3   0A  49 1216   12  SSSSS S        SS   S  T SST         SSSSSS       PS    S    SSSSS    
    26   26 A G  S    S+     0   0   56 1215    3  GGGGG G        GG   G  G GGG         GGGGGG       DG    G    GGGGG    
    27   27 A Y  S    S-     0   0   39 1216   33  FFFFF F        FF   F  F FFD         FFFFFF       GG    S    DDDDD    
    28   28 A T    >   -     0   0   90 1216   52  SSSSS T        TT   S  D TTS         DDTTDD       YS    I    SSSSS    
    29   29 A F  G >  S+     0   0   13 1216   27  LLLLL F        FF   F  F FFI         FFFGFF       LI    S    VVVVV    
    30   30 A T  G 3  S+     0   0   40 1216   55  TSSST D        SS   R  S SST         SSSSKS       SS    S    SSSSS    
    31   31 A S  G <  S+     0   0   23 1216   57  Sssss D        DG   D  D SSs         DddSKr       ds    i    snsss    
    32   32 A Y  E <  S-E  100   0B  40 1139   28  Y.... Y        YY   F  F YYy         Yf.YYh       yy    .    aaala    
    33   33 A W  E     -E   99   0B  40 1148   92  Pagga G        GE   Y  D YN.         A.ePA.       .Y    a    ATGTA    
    34   34 A M  E     -EF  98  51B   0 1206   49  VIVVV M        MM   M  M MMW         F.LIVI       WW    M    WWWWW    
    35   35 A H  E     -EF  97  50B   0 1212   72  NSVGG S        AH   S  T YNN         SSIGTN       GG    G    SNNNN    
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWWW W        WW   W  W WWW         WWWWWW       WW    W    WWWWW    
    37   37 A V  E     -EF  95  47B   0 1216   17  IVVVV V        VV   I  V IVI         VVVVVV       II    Y    IIVII    
    38   38 A K  E     -EF  94  46B   7 1216   22  RRRRR R        RR   R  R RRR         RRRRRR       RR    R    RRRRR    
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQQ Q        QQ   Z  Q QQK         QQQQQQ       QQ    Q    QQQQQ    
    40   40 A R    >   -     0   0   35 1216   71  AAAAA A        AA   T  A AAF         AAAAAA       PS    A    SSSSS    
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPPP P        TP   P  A PPP         PPPPPP       PP    P    PPPPP    
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGGG G        GG   G  G GAG         GGGGGG       GG    G    SSSSS    
    43   43 A R  S <  S-     0   0  156 1216   43  KNKKK K        KK   K  K KKN         KKKKKK       QK    S    RRRRR    
    44   44 A G        -     0   0   16 1215   36  GGAAG G        GW   G  G GGK         GGGGGG       GG    K    GGGGG    
    45   45 A L  E     -F   39   0B   8 1215   10  LLLLL P        LL   L  L LLL         LLLLLL       LL    R    LLLLL    
    46   46 A E  E     -F   38   0B  34 1216    6  EEEEE Q        EE   Z  E EEE         EEEEEE       EE    E    EEEEE    
    47   47 A W  E     -F   37   0B   3 1216   10  WWWWW W        WS   W  Y WWY         WWWSWW       WW    F    WWWWW    
    48   48 A I  E     -     0   0B   0 1215   31  VILVV V        VV   V  V VVM         VLLLLL       II    V    LLLLL    
    49   49 A G  E     -FG  36  60B   0 1216   35  GGGGG S        SS   S  A SAG         AAAAAA       GG    A    GGGGG    
    50   50 A R  E     -FG  35  59B  32 1216   94  VAGGA S        SV   Y  G YHY         AVASGS       Ts    H    RrrRr    
    51   51 A I  E     -FG  34  58B   0 1207   17  MIIII I        II   I  I III         ITIIVI       Vy    I    TyyTy    
    52   52 A D     >  -     0   0   26 1212   86  FGCDA T        SG   G  N NKS         AGSDGS       SS    T    YYYYY    
    53   53 A P  T  4 S+     0   0    0 1212   83  GSSNG G        QG   G  R GSY         TTTSTT       YG    N    YRRYR    
    54   54 A N  T  4 S-     0   0   96 1213   69  GSGDS D        PD   S  H AAS         SGSGSA       SS    T    RSSRS    
    55   55 A G  T  4 S-     0   0   69 1216   57  GGGGG S        sS   G  G GPG         dGGsGG       Gt    G    sTRsK    
    56   56 A G     <  +     0   0   25  915   61  ....G S        sS   S  N S..         gG.gTR       .g    .    wWWwW    
    57   57 A G        -     0   0   43 1195   77  SSSDS N        NY   T  D S.S         SDTNTD       TS    V    YYYSY    
    58   58 A T  E     -G   51   0B  62 1209   46  TATTT I        TT   L  P TTT         TTTTTT       PP    T    NNNYN    
    59   59 A K  E     -G   50   0B  89 1212   88  YYSYY Y        YH   Y  D SYY         YYSYHY       YY    E    DDDED    
    60   60 A Y  E     -G   49   0B  46 1215    9  YYFYY Y        YY   Y  Y YYF         YYYYYY       YY    F    YYYYY    
    61   61 A N    >>  -     0   0   12 1216   63  NANNN T        LA   A  A AAN         ATAAAA       TA    A    AAAAA    
    62   62 A E  G >4 S+     0   0  148 1216   64  PSPPP D        DD   D  D DDP         DEDDDD       PP    D    VVVVV    
    63   63 A K  G 34 S+     0   0  109 1216   64  TWAAA S        PS   S  A SSS         SSSSSS       SS    S    SSSSS    
    64   64 A F  G X> S+     0   0    5 1216   45  LALLL V        VV   V  L VVL         VVVVVV       LL    V    MVVVV    
    65   65 A K  T << S+     0   0  156 1216   40  KKKKK K        KK   K  E KKK         KKKKKK       KR    K    KRKKK    
    66   66 A S  T 34 S+     0   0  108 1216   35  SSSSS G        GG   G  G GGS         GGGGGG       SS    G    SSSSS    
    67   67 A K  T <4 S+     0   0   33 1214   21  RRRRR R        RR   R  R RRR         RRRRRR       RR    R    RRRRR    
    68   68 A A  E  <  -C   83   0A   2 1216   69  LSLLL F        FF   F  F FFI         FFFFFF       LV    F    IIIII    
    69   69 A T  E     -C   82   0A  58 1216   37  STSSS T        TT   T  T TTS         TTTTTT       TI    T    TTTLT    
    70   70 A L  E     +C   81   0A   7 1216   27  IIIII I        II   I  I III         IIIIIV       II    I    IIIII    
    71   71 A T  E     -C   80   0A  57 1213   47  TTTTT S        SS   S  S SST         SSSSSS       HS    S    NNNNN    
    72   72 A V  E     -C   79   0A  28 1216   71  RRKKR R        RR   R  R RRR         SRRSRR       VV    R    PPPPP    
    73   73 A D  E   > -C   78   0A  69 1216    7  DNDDD D        DD   D  D DDD         DFDDDD       DD    D    DDDDD    
    74   74 A K  T > 5S+     0   0  105 1216   62  TTNNT N        NN   N  N NNT         DDNDNN       PT    N    TTTTT    
    75   75 A P  T 3 5S+     0   0  122 1215   37  SNSSS A        AA   A  G GPS         SSSSSS       SS    A    SSSSS    
    76   76 A S  T 3 5S-     0   0   37 1216   65  KLKKK K        KK   Q  Q NNK         QQQQQQ       KK    K    KKKKK    
    77   77 A S  T < 5 +     0   0   24 1216   48  SNSSS N        NN   K  S SNN         NKNNNN       SN    T    NNNNN    
    78   78 A T  E   < -BC  23  73A   8 1216   64  QTQQQ T        TS   S  T LLQ         MTTTTT       QQ    T    QQQQQ    
    79   79 A A  E     -BC  22  72A   0 1207   67  VVVVV L        LL   L  V LLY         VAAVAA       IL    V    FFFFF    
    80   80 A Y  E     -BC  21  71A  61 1209   36  YTSSY Y        YS   Y  Y HHY         YYFYYY       FS    D    SSSSS    
    81   81 A M  E     -BC  20  70A   0 1212    9  LLLLL L        LL   L  L LLL         LLLLLL       LL    L    LLLLL    
    82   82 A Q  E     -BC  19  69A  69 1215   43  TKSSQ Q        QQ   Z  Q QQQ         QQQQQQ       NR    Q    QQHQQ    
    83   83 A L  E     -BC  18  68A   0 1215   14  LMVVL M        IM   M  M MML         MMMMMM       LL    M    LLLLL    
    84   84 A S        +     0   0   32 1215   56  NTSST N        NN   B  N NTN         NNKTSN       TS    N    NNNSN    
    85   85 A S  S    S-     0   0   89 1216   25  SSSSS W        SS   S  S SGS         SSSSGS       SS    S    SSSSS    
    86   86 A L        +     0   0    2 1216   15  LLVVV L        LL   L  L LLV         LLQLLL       VV    L    VVVVV    
    87   87 A T    >   -     0   0   61 1215   68  RTTTN T        RR   R  K KKT         RRRRRR       TT    K    TITTT    
    88   88 A S  G >  S+     0   0   72 1216   59  AAPPP R        AA   T  A APT         TTTTTT       AA    P    PPPPP    
    89   89 A E  G 3  S+     0   0  107 1216   21  EAEEE E        EE   Z  E EEE         EEEEEE       AA    E    EEEDE    
    90   90 A D  G <  S+     0   0    7 1216    3  DDDDD D        DD   B  D DDD         DDDDDD       DD    D    DDDDD    
    91   91 A S    <   +     0   0   31 1216   34  TTTTT T        TT   T  T TTT         TTTTTT       TT    T    TTTTT    
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAAA A        AA   A  A AAA         AAAAAA       AA    A    AAAAA    
    93   93 A V  E     -EH  39 115B  21 1216   48  VTTTV L        VV   V  T TRT         RRRRRR       VV    V    VVLVV    
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYYY F        YY   Y  Y YYY         YYYYYY       YY    Y    YYYYY    
    95   95 A Y  E     -E   37   0B   1 1216    3  YFYYY Y        YY   Y  Y YYY         YYYYYF       YY    Y    YYYFY    
    96   96 A a  E     +E   36   0B   0 1216    1  CCCCC C        CC   C  C CCC         CCCCCC       CC    C    CCCCC    
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAAA A        AT   A  A AAT         AVAVSA       VA    A    AAVAA    
    98   98 A R  E     -E   34   0B  13 1196   38  KRRKK I        RR   A  R RRG         MSRGRR       RS    A    SRRGK    
    99   99 A M  E     -EI  33 107B   5 1101   82  HDDDD A        DD   T  L DDH         AMYCGG       HP    T    GDDGG    
   100  100 A W  E >   -E   32   0B  89 1101   89  ttTTt t        Tt   b  a tIr         gFyslR       gt    D    aMgPg    
   101  101 A Y  T 3  S+     0   0  112  572   91  a...c .        ..   f  h s..         v.tsf.       yg    .    g....    
   102  102 A Y  T 3  S-     0   0  133  629   92  G...I .        ..   B  T E..         AKWGW.       SC    .    Y....    
   103  103 A G  S <  S+     0   0   38  705   79  a...e .        ..   W  y r..         FYyfY.       FY    W    Y....    
   104  104 A T        -     0   0   32  784   66  gcGG. s        vg   S  g d.g         a..pgg       aA    g    .g.ge    
   105  105 A Y        +     0   0   81  679   93  sD..t e        rl   T  s sT.         pVytfd       a.    i    .saa.    
   106  106 A Y        -     0   0   32  842   66  CY..T y        fK   f  F RV.         HIyDFc       YF    k    yyyE.    
   107  107 A F  E     +I   99   0B   0  885   48  .F... f        aA   l  I .Tm         MLiMTm       FF    i    mffFM    
   108  108 A D  E     +     0   0B  25  997   46  .NKK. L        FF   B  D EDD         DGEDDD       PQ    D    DHHDA    
   109  109 A Y  E     -J  168   0C 108 1059   61  .IYYY L        SS   Y  A FGY         LLLLLL       FH    H    VYYYV    
   110  110 A W  E     -I   97   0B  23 1092    2  WWRRW W        WW   W  W WWW         WWWWWW       WW    W    WWWWW    
   111  111 A G        -     0   0    3 1067   15  AGGGI          SS   G  G  MG         GGGGGG       GG    G    GGGGG    
   112  112 A Q        -     0   0  141 1047   41  QPPPK          SS   Z  R  DQ         PPPPPP       QQ    K    QQQQQ    
   113  113 A G        -     0   0   20 1013   12  GGQQL          GG   G  G  GG         GGGGGG       GG    G    GGGGG    
   114  114 A T  E     - H   0  94B   2  996   31  FTVVK          GG   B  T  RT         VVVVVV       AF    T    TTTTT    
   115  115 A T  E     - H   0  93B  60  979   76  PLDDI          AA   L  S  VS         EEEEEE       PL    Q    TLLLL    
   116  116 A L  E     -dH  10  92B   1  972   19  LVLLL          PQ   V  V  VV         VVVVVV       VV    V    VVVVV    
   117  117 A T  E     -d   11   0B  57  953   21  KTSST          PP   T  T  AT         VVVVVV       TT    T    TTTTT    
   118  118 A V  E     +d   12   0B   4  935    8  LVVV           VV   V  V  GV         VVVVVV       VV    V    VVVVV    
   119  119 A S              0   0   64  917   10  SSGG           AA   S  S  TS         SSSSSS       SS    S    SSSSS    
   120  120 A S              0   0  122  885   21  ASSS           PP   S  S  GS         SSSSSS       SS    S    SSSSS    
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32       D DQQQQEQD  QDQ Q  Q   EEDDDDEEQ       QQEDQQ  DDEE DDDD      EDD
   123    2 B A        -     0   0   19  713   70       T TAAIAVSI  SIS V  I   IIIIIIIIS      SSSIISS  IIII IIII      III
   124    3 B V        -     0   0   84  765   49       V VAATVVVQ  VQV T  V   VVVVVQVVV      VVVVVVA  QVVV QKQQ      VVV
   125    4 B V  E     -Q  145   0D  10  820   26       L LVVMLFLM  LML VL L   LLLLLMLLL      LLLMLLL  MMML MMLL     LLMM
   126    5 B T  E     +Q  144   0D  69  829   11       T TTTTTTTT  TTT TT T   TTTTATTTT      TTTTTTT  TTTT TTTT     TTST
   127    6 B Q  E     -Q  143   0D  18  832    2       Q QQQQQQQQ  QQQ QQ Q   QQQQQQQQQ      QQQQQQQ  QQQQ QQQQ     QQQQ
   128    7 B E        -     0   0   59  833   63       S SPPSPPPS  PSP PP S   SSSSSTSSP      PPPSSPP  SSSS TSSS     PSSS
   129    8 B S  S    S+     0   0  101  841   38       P PAAPPHPP  PPA PS P   PPPPPTPPS      SSPPPPR  PPPP TPPP     DPPP
   130    9 B A  E     -k  226   0C  59  842   50       A ASSSSSSS  SSS VS A   GGAAASAAS      TSSAASS  SSAG SSSS     SGSD
   131   10 B L  E     -k  227   0C  57  847   76       S SVVLVVVS  MSV EV I   TTSSSSIIV      VVVTSAV  SLTT SSSS     ATST
   132   11 B T  E     +k  228   0C  84  848   77       L LSSLSSSL  SLS TS M   LLLLLLTTS      SSSLLSS  LLLL LLMM     SLLL
   133   12 B T  E     -k  229   0C  18  848   68       A AAASGGAS  GSG FV S   SSAATSAAG      VGGSAGG  SSSS SSYY     ASPS
   134   13 B S    >   -     0   0   55  849   70       k kNNvSSAa  AaS TT a   llvvvaaaA      ASAvvTS  aavl aaaa     Slvl
   135   14 B P  T 3  S+     0   0   61  848   65       q qPPpLPPv  PlL PP p   ppllllllL      LLLplPP  vtpp llll     Lpvp
   136   15 B G  T 3  S+     0   0   46  850    7       G GGGGGGGG  RGG GG G   GGGGGGGGG      GGGGGGG  GGGG GGGG     GGGG
   137   16 B E    <   -     0   0  108  850   56       E EEEDQQQD  EDQ NQ E   EEQQQDQQQ      QQQEQQQ  DDEE DEEE     AEEE
   138   17 B T  E     - R   0 199D  88  850   66       T TTTTRTRT  TTR TT K   RRRRRRKKS      TRTRRRS  RRRR RRRR     SRKR
   139   18 B V  E     - R   0 198D  14  850   33       V VVVVVVVV  VVV VA V   AAAAAVVVV      AVVGAVV  VVAA VVVV     VAVA
   140   19 B T  E     - R   0 197D  53  849   41       T TKKTTTTT  TTT TR T   TTTTTTTTT      RTTTTTT  TTTT TSTT     KTTT
   141   20 B L  E     - R   0 196D   0  849   25       I IIIIIIII  III LI M   LLIIIIIII      VIIIIII  IILL ILII     LLLL
   142   21 B T  E     - R   0 195D  22  849   52       N NTTSSSST  SSS TT T   SSSSSSTTS      TSSSSSS  TSSS STTT     TSSS
   143   22 B b  E     -QR 127 194D   0  850    2       C CCCCCCCC  CCC CC C   CCCCCCCCC      CCCCCCC  CCCC CCCC     CCCC
   144   23 B R  E     -Q  126   0D 133  850   77       K KSSRTTSR  LQT NG S   RRRRRRSST      QTARRST  RRRR RRKK     TRKR
   145   24 B S  E >   -QS 125 148D  11  850   68       A AGGAGRGA  GAG TG A   AAAAAAAAG      VGGAAGG  AMAA AAAA     LASA
   146   25 B S  T 3  S+     0   0   81  850   27       S SGGSSSSS  SSS NN S   SSSSSSSSS      GSSSSST  SSSS SSSS     SSSS
   147   26 B T  T 3  S-     0   0   87  850   71       Q QSSQSSSQ  SQS PN S   QQKKQQSSS      NSRQQSS  QQQQ QQQQ     SQQQ
   148   27 B G  B <  S+S  145   0D  39  850   55       S SSSDSGSG  SGS kI s   SSSSSDssS      lSSSSSS  GGSS DEDD     GSsS
   149   28 B A        -     0   0   40  390   77       . .S..NSN.  N.N t. .   .........      sNN..ND  .... ....     ..l.
   150   29 B V        -     0   0    3  620   45       V .Y..III.  I.I W. .   .VVVV....      VII.VIV  .... ....     ..Y.
   151   30 B T    >   -     0   0   56  541   72       . .Y..GGG.  G.G T. .   VSSSS...N      FGG.SGG  ...V .I..     HVSV
   152   31 B T  G >  S+     0   0   94  694   78       . VG.IGSRI  LIR D. .   SSTTTI..V      FSTVTSG  IIVS ISII     SSGS
   153   32 B S  G 3  S+     0   0   84  802   62       s SC.SGSSS  GSG gg .   SSsssN..g      KNVSsNY  SSSS SGNN     SSnS
   154   33 B N  G <  S-     0   0   13  673   73       n N.NKN..N  NK. sk s   G.sssNssy      ...Nn.N  NSSS N.NN     YNnG
   155   34 B Y    <   -     0   0   98  781   50       Y YAWYCYYY  YYY RY Y   YYYYYYYYD      .YRYYTY  YYNY YYYY     AYYY
   156   35 B A        -     0   0    0  817   59       L LYYLVVVL  VLV VV M   LLMMMLMMV      AVVLMVV  LLLL LLLL     ILLL
   157   36 B N  E     -L  212   0C   0  827   79       S SGGNGYSN  HNG HQ Y   GAHHHNHHQ      HSNAHNS  AAAA NSSS     AAAA
   158   37 B W  E     -LM 211 171C   0  849    0       W WWWWWWWW  WWW WW W   WWWWWWWWW      WWWWWWW  WWWW WWWW     WWWW
   159   38 B V  E     -LM 210 169C   0  849   25       Y YYFYYYYY  YYY YY Y   YYYYYYYYF      YYYYYYY  YYYY YLLL     HYYY
   160   39 B Q  E     -LM 209 168C  10  849   10       Q QQQQQQQQ  QQQ QQ Q   QQQQQQQQQ      QQQQQQQ  QQQQ QQQQ     QQQQ
   161   40 B E  E     -LM 208 167C  20  849    8       Q QQQQQQQQ  QQQ QQ Q   QQQQQQQQQ      QQQQQQQ  QQQQ QQQQ     QQQQ
   162   41 B K  E  >  - M   0 166C  68  849   50       K KkkKIRVK  PKL KK K   KKKKKKKKL      KLLKRLH  KKKK KKKK     QRKK
   163   42 B P  T  4 S+     0   0   98  843   23       P PppHPPPP  QPP PP P   PPPPPPSSP      PPPPPPP  PPPP PPPP     PPPP
   164   43 B D  T  4 S-     0   0  148  846   16       G GGGGGGGG  GGG GA G   GGGGGDGGG      AGGGGGG  GGGG DDGG     EGGG
   165   44 B H  T  4 S+     0   0   90  845   66       Q QSSQSSTK  MKT QQ S   QQQQQGTTT      QTKQQTK  KKQQ GGKK     KQQQ
   166   45 B L  E  <  - M   0 162C  92  846   57       A AVASAAAA  ASG AS S   AAPPPTSSA      RTASPAA  VAAA TTSS     GASA
   167   46 B F  E     + M   0 161C   9  847   19       P PPPPPPPP  PPP PP P   PPPPPVPPP      PPPPPPP  PPPP VVPP     pPPP
   168   47 B T  E     -JM 109 160C  56  843   61       K KVVKKTKK  KKR KL R   RRKKKKKKK      AKKRKKK  KERR KKKK     kRKR
   169   48 B G  E     + M   0 159C   1  848   64       L LTTLTTLL  LLT LL L   LLLLLLPPT      LTLLLLL  SLLL LRTT     LLLL
   170   49 B L  E     +     0   0C   4  848   24       L LVVLLVLL  ILL LV W   LLLLLLWWL      LILLLLM  LLLL VLLL     NLLL
   171   50 B I  E     +NM 177 158C   0  848   19       M IIIIIIII  III II I   IIIIIIIII      IIIIIII  IIII IIII     SIII
   172   51 B G  E  >  +N  176   0C   0  849   33       Y YYYYYYYY  YYY YY Y   YYYYKYYYY      YYHYKYY  YYYY YYYY     DYYY
   173   52 B G  T  4 S-     0   0    9  848   87       R KGDNRKQY  DYD NG D   GGLLYYEEY      RGARYSD  AACG YARR     GGWG
   174   53 B T  T  4 S+     0   0    9  849   68       A ASNTSDDA  NTS GT T   AAAAATIIT      DDNAANV  AAAT TAAA     SAAA
   175   54 B N  T  4 S+     0   0  102  841   49       S STTNTNNN  SSS IS S   SSSSSSSSS      SNNSSNS  SSSS SSNN     HSSS
   176   55 B N  E  <  -N  172   0C  77  849   69       S SGNNSQKR  NNS NN N   SSNSNRKKS      NSRNNQK  TTTS RTRR     SSAS
   177   56 B R  E     -N  171   0C 113  850   66       R RRRLRRRL  RLR KR L   RRLLLLLLR      RRRRLRR  LLRR LLLL     KRRR
   178   57 B A    >   -     0   0    1  849   73       A APPHPPPE  PEP PP V   AAEEEHAAP      APPAEPP  QQAA HHVV     GAEA
   179   58 B P  T 3  S+     0   0   97  849   39       S SSSSSSSS  STS SS S   TTSSSSSSS      SSSTSSS  SSTT SSDD     DTST
   180   59 B G  T 3  S+     0   0   83  850   18       G GNNGGGGG  GGG gG G   GGGGGGGGG      GGGGGGG  GGGG GGGG     GGGG
   181   60 B V  S <  S-     0   0   13  848   23       V VIIIVVVV  VVV vI V   IIVVVVVVV      VVVIVVV  VVII VVVV     IIVI
   182   61 B P    >   -     0   0   57  850    9       P PPPPPPSP  PPP PP P   PPPPPPPPP      PPPPPPP  PPPP PPPP     PPPP
   183   62 B A  T 3  S+     0   0   77  850   59       D DSSSDDDS  DSD TD A   DDAAASAAD      DEEAADD  SSAD SKSS     DDDD
   184   63 B R  T 3  S+     0   0   58  850    5       R RRRRRRRR  RRR RR R   RRRRRRRRR      RRRRRRR  RRRR RRRR     RRRR
   185   64 B F  E <   +T  198   0D   4  850    1       F FFFFFFFF  FFF FF F   FFFFFFFFF      FFFFFFF  FFFF FFFF     FLFF
   186   65 B S  E     -T  197   0D  51  849   17       S SSSSSSSS  SSS SS S   SSSSSSSSS      SSSSSSS  SSSS SSSS     SSTS
   187   66 B G  E     +T  196   0D   9  850    4       G GGGGGGGG  GGG GG G   GGGGGGGGG      GGGGGGG  GGGG GGGG     GGGG
   188   67 B S  E     -T  195   0D  41  850    7       S SSSSSsSS  SSS RS S   SSSSSSSSS      SSSSSSS  SSSS SSSS     SSSS
   189   68 B L  E     -T  194   0D  59  835   79       G GKLGRsKG  TGR GK R   GGGGGGGGK      RKKGGKK  GGGG GRGG     SGGG
   190   69 B I  E >   -T  193   0D  86  842   31       S SSSSSSSS  SSS NS S   SSSSSSSSS      SSPSSSS  SSSS SSSS     SSSS
   191   70 B G  T 3  S-     0   0   67  850   18       G GGGGGSGG  GGG GG G   GGGGGGGGG      GGGGGGG  GGGE GGGG     GGGG
   192   71 B N  T 3  S+     0   0  105  828   57       T TSSTNNTT  STS IN T   TTTTTTTTN      GSSTTTN  TTTT TSQQ     ATTT
   193   72 B K  E <  S- T   0 190D  68  833   67       D DTTDTSSD  SDT DT S   DDDDDDSSS      MTTDDST  DDED DDDD     EDDD
   194   73 B A  E     -RT 143 189D   0  838   81       F FAAYAAAF  GYA AA Y   FFFFFYYYA      TGGFFAA  FFFF YYYY     RFFF
   195   74 B A  E     -RT 142 188D   0  849   57       T TTTTTSST  SST AT S   TTTTTSSSS      TTTTTSS  TTTT SSSS     YTTT
   196   75 B L  E     -RT 141 187D   0  850    2       F FLLLLLLL  LLL LL L   LLLLLLLLL      LLLLLLL  LLLL LLLL     LLLL
   197   76 B T  E     -RT 140 186D  19  850   33       T TTTTTTTT  TTT TT T   TTNNNTTTT      TTTTNAT  TTTT TTTT     TTST
   198   77 B I  E     -RT 139 185D   0  849    5       I IIIIIIII  III IV I   IIIIIIIII      IIIIIII  IIII IIII     IIII
   199   78 B T  E    S+R  138   0D  78  850   46       S STTSSSTS  TSS SS S   SSHQHSSSR      TTTSHSS  SSSS SSSS     SNSS
   200   79 B G  S    S-     0   0   15  850   57       N NGgSSGGS  GGG EG S   RRPPPNSSG      GGGSPGG  SCSR NSSS     SRSR
   201   80 B A        -     0   0    0  849   51       F FVqVLL.L  LLL VA M   LLVVVLMML      ALLVVLL  LLLL LLLL     LLVL
   202   81 B Q    >   -     0   0   80  849   32       Q QQAEQK.Q  QQQ QQ E   EEEEEEEEQ      QQQEEQQ  QQQE GEEE     QEKE
   203   82 B T  G >  S+     0   0   84  850   59       A PAKTASTP  SAA AS A   PPEEEQAAA      AAAPESA  PSFP PSYY     SPTP
   204   83 B E  G 3  S+     0   0   99  850   17       E EEHEEEGE  EEE EG E   EEEEEEEEE      EEEEEEE  EEEE EDEE     EEEE
   205   84 B D  G <   +     0   0    1  850    2       D DDEDDDDD  DDD DD D   DDDDDDDDD      DDDDDDD  DDDD DDDD     DDDD
   206   85 B E    <   +     0   0   71  849   74       A AEEAEEEF  EVE AE A   FFAADIAAE      EEEFTEE  VFFF IFMM     EFLF
   207   86 B A  E    S- O   0 227C   3  850   14       A AAAGATAA  AAA AA A   AAAAAAAAA      AAAAAAA  AAAA AAGG     AAAA
   208   87 B I  E     -LO 161 226C  55  850   71       V VVVVDDDT  DDD VD T   VVTIATIID      DDDVTDD  TTVV TDII     DVVV
   209   88 B Y  E     -LO 160 225C   0  850    0       Y YYYYYYYY  YYY YY Y   YYYYYYYYY      YYYYYYY  YYYY YYYY     YYYY
   210   89 B F  E     -L  159   0C   5  848    8       Y YYYYYYYY  FFY YY Y   YYYYYFYYY      YYYYYYY  YYYY YYYY     YFYY
   211   90 B b  E     -L  158   0C   0  849    1       C CCCCCCCC  CCC CC C   CCCCCCCCC      CCCCCCC  CCCC CCCC     CCCC
   212   91 B A  E     -LP 157 221C   0  848   73       Q QGGFAQGQ  QQS QQ Q   QQQQQQQQE      QSSQQAC  QQQQ QLLL     QQQQ
   213   92 B L  E     - P   0 220C   0  845   83       Q QNAQTSAQ  SQA SV Q   QQHHHQQQT      SAAQHAS  KQHQ QQKK     TQQQ
   214   93 B W  E     + P   0 219C  21  834   71       G SYYHYYWY  YHY YW Y   YYSSSGWWY      WWWYSWY  YYYY YYYY     LYYY
   215   94 B Y  E >  S- P   0 218C  33  829   88       Y YDDKEDDN  DND HD S   GGRRWKNND      GDDNWDA  NYNG SADD     GGYD
   216   95 B S  T 3  S-     0   0  106  829   66       N NSGSSSSS  DSS EG G   STEEETYYS      SDGTEDG  SSNS KSEE     HTST
   217   96 B N  T 3  S+     0   0  105  824   81       N NSsWsSSd  SsS  n     lsLLIlppS      GssgISS  afWs lDFF     WsYS
   218   97 B H  E <   -P  215   0C  39  647   66       P P.gPhS.p  .p.  h     rrPPPr...      NrrhP..  rpP. pPPP     HrPp
   219   98 B L  E     -P  214   0C   1  382   85       . ..g.....  ...  .     ..LLL.wi.      ....L.Y  ..Ff .WLL     V.Lw
   220   99 B V  E     -P  213   0C  12  489   66       . ..I.....  ...  .     TTTTTTTT.      ....T.T  TTTT TTTT     VPTT
   221  100 B F  E     -P  212   0C  17  540   30       . ..FF.YL.  L.L  .     FFFFFFFFL      ....FlF  FFFF FFFF     FFFF
   222  101 B G        -     0   0    1  481   35       . .GG.G...  G.S  .     GGGGGGGGS      ...SGg   GGGG GGGG     GGGG
   223  102 B G        -     0   0   51  513   58       . .TS.T...  A.G  S     QQAAAGGGG      .AADAP   PQPP GGAA     GQAQ
   224  103 B G        -     0   0    8  528   33       . .GG.V...  P.G  D     GGGGGGGGH      .HHSG    GGGG GGGG     GGGG
   225  104 B T  E     - O   0 209C   0  550   33       . . T.L.S.  TTT  T     TTTTTTTTT      .TTTT    TTTT TTTT     TTTT
   226  105 B K  E     -kO 130 208C  82  547   67       A P T.Q.A.  VVV        KKKKKKKKL      .EE K    KKKK KKKK     HRKK
   227  106 B L  E     -kO 131 207C   0  546   44       P P L.VHH.  LLL        VVLLLLLLL      .LL L    LVVV LLLL     LLLV
   228  107 B T  E     -k  132   0C  34  614   65       T T TTRTTT  QQQ        EEEE EEE       .QQ E    EEDD EEEE     TEVE
   229  108 B V  E     -k  133   0C   3  593   35       V V VVVVVV  TV         IILL III       .AA I    IIII IILL      ILI
   230  109 B L              0   0  120  399   31       L L LLALLL  HI                        LRR                        
   231  110 B G              0   0   62  207   39             G     G                         AGG                        
## ALIGNMENTS 1471 - 1540
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 A E              0   0  185  771   30  QQ   E        QQQ  Q Q                  EE  RQE                       
     2    2 A V        +     0   0   18  834   19  VV   V        VVV  V V                 VVIV LVV M  V                  
     3    3 A Q  E     -A   25   0A  90  836   34  RR   Q        QQQ  Q Q                 NKRT QQQ E  Q                  
     4    4 A L  E     -A   24   0A  13  881    3  LLL  L        LLL  L L                LLLLL LLLLS  L                  
     5    5 A Q  E     -A   23   0A 107  882   70  QQE  V        QQQ  Q R                TTETD QVLTI  V                  
     6    6 A Q  E     -A   22   0A  14  887   31  EEE  E        EEE  E E                QEEQE EEEQP  E                  
     7    7 A S        -     0   0   33  892   13  SSS  S       SSSS  S S                SSSSS SSSSS  S                  
     8    8 A G        -     0   0   52  907   11  GGG  G       GGGG  G G                EGEDR GGGET  G                  
     9    9 A A        -     0   0   80 1179   51  PPG  G       PPPP  P P                PGGGG PGGPP  G  PP              
    10   10 A E  E     -d  116   0B  68 1189   46  SSG  G       GGGG  G S                VDGEG GGGVV  G  ST              
    11   11 A L  E     +d  117   0B 130 1195   22  LLV  L       LLLL  L L                VVVTL LVLVL  L  LL              
    12   12 A V  E     -d  118   0B  28 1197   47  VVV  V       VVVV  V V                KKKLQ VVVKK  Q  VV              
    13   13 A K    >   -     0   0  145 1201   50  KKQ  Q       KKKK  K K                RKRKT KQQNN  Q  KN              
    14   14 A P  T 3  S+     0   0   70 1203    8  PSP  P       HPPP  P P                PPPPP PAPPP  P  PP              
    15   15 A G  T 3  S+     0   0   59 1209   28  YSG  K       SSSS  S S                GGGGG SGGGQ  G  SS              
    16   16 A A    <   -     0   0   36 1213   63  QQK  G       QEQQ  Q Q                EEDEG ETGNE  G  QR              
    17   17 A S        -     0   0   66 1210   29  TTS  S       TTTT  T T                SSSSS TSSST  S  TT              
    18   18 A V  E     - B   0  83A  10 1213   32  LLL  L       LLLL  L L                HLLLL LLLHL  L  LL              
    19   19 A K  E     - B   0  82A 119 1211   53  SSR  K       SSSS  T S                TKSKT SRRRS  R  SS              
    20   20 A L  E     - B   0  81A   0 1214   21  LLL  L       LLLL  L L                LLLLL LLLLL  L  LL              
    21   21 A S  E     - B   0  80A  31 1215   35  TTS  S       TTTT  T T                TSSTV TSSTS  S  TT              
    22   22 A a  E     -AB   6  79A   0 1216    0  CCC  C       CCCC  C C                CCCCC CCCCC  C  CC              
    23   23 A K  E     -AB   5  78A 113 1216   70  ATT  A       TSST  S T                SKKAK ITATR  K  SS              
    24   24 A A  E     +A    4   0A   2 1216   49  VVA  A       VVVV  V V                AAAVG VAAAG  G  VV              
    25   25 A S  E     +A    3   0A  49 1216   12  SSS  S       SSSS  S S                SSSSS SSSST  T  TT              
    26   26 A G  S    S+     0   0   56 1215    3  GGG  G       GGGE  G G                GGGGG GAGGG  G  GG              
    27   27 A Y  S    S-     0   0   39 1216   33  FFF  F       FFFF  F F                FFFEF GFFFF  F  DD              
    28   28 A T    >   -     0   0   90 1216   52  PSI  D       SSSS  S S                TSTST PNTTS  D  SS              
    29   29 A F  G >  S+     0   0   13 1216   27  LLF  F       LLII  I L                FFFIF ILFFF  F  II              
    30   30 A T  G 3  S+     0   0   40 1216   55  STS  N       TTTT  T S                SSSSS RSSSG  S  TT              
    31   31 A S  G <  S+     0   0   23 1216   57  NsD  T       SStt  t s                DSSss rDrNS  D  ss              
    32   32 A Y  E <  S-E  100   0B  40 1139   28  Y.F  Y       YYyy  y .                YHFf. yYlYY  F  .y              
    33   33 A W  E     -E   99   0B  40 1148   92  GaG  A       GGCy  S g                GWY.t YA.FA  D  n.              
    34   34 A M  E     -EF  98  51B   0 1206   49  VVM  M       VVWW  W V                MMMWM WMSMM  M  WW              
    35   35 A H  E     -EF  97  50B   0 1212   72  EGH  S       HNNS  S V                HHDNH GHSHH  T  NS              
    36   36 A W  E     -EF  96  49B   0 1216    0  WWW  W       WWWW  W W                WWWWW WWWWW  W  WW              
    37   37 A V  E     -EF  95  47B   0 1216   17  VVV  V       INIF  I V                VVVIV IVVII  V  II              
    38   38 A K  E     -EF  94  46B   7 1216   22  RRR  R       RRRR  R R                RRRRR RRRRR  R  RR              
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQ  Q       QQQQ  Q Q                QQQQQ QQQQQ  Q  KK              
    40   40 A R    >   -     0   0   35 1216   71  AAA  A       AAPP  F A                APAPA PAAAP  A  FF              
    41   41 A P  T 3  S+     0   0  130 1215   15  PPP  P       PPPP  P P                PPPSP PPPPA  A  PP              
    42   42 A G  T 3  S+     0   0   83 1216   22  GGG  G       GGGG  R G                GGGGG GGGGG  G  GG              
    43   43 A R  S <  S-     0   0  156 1216   43  KKK  K       KKKK  K K                KKKKK KKKKK  K  NN              
    44   44 A G        -     0   0   16 1215   36  AAG  G       GGGG  G A                GGDGG GGGGT  G  KK              
    45   45 A L  E     -F   39   0B   8 1215   10  LPL  L       LLLL  L L                LLLLL LLLLL  L  FL              
    46   46 A E  E     -F   38   0B  34 1216    6  EEE  D       EEEE  E E                EEEEE EZEEE  E  EE              
    47   47 A W  E     -F   37   0B   3 1216   10  WWS  W       WWWW  F W                WWWWW WWWWW  Y  YY              
    48   48 A I  E     -     0   0B   0 1215   31  VVV  V       VVMI  I L                ILILV IVVIL  V  MM              
    49   49 A G  E     -FG  36  60B   0 1216   35  GAA  A       GGGG  G G                SAAGA GASAG  A  GG              
    50   50 A R  E     -FG  35  59B  32 1216   94  EGT  s       VVSY  E G                AYELG GLgTI  G  YY              
    51   51 A I  E     -FG  34  58B   0 1207   17  III  i       MMII  I I                IIIII VIlII  I  II              
    52   52 A D     >  -     0   0   26 1212   86  KHW  K       FWCR  Y C                NSGDY YSNRW  Q  SD              
    53   53 A P  T  4 S+     0   0    0 1212   83  DNS  T       GDSY  N S                TGTYS YYATY  R  YY              
    54   54 A N  T  4 S-     0   0   96 1213   69  ISD  H       GGGE  D G                DPSTD TGSSD  D  SS              
    55   55 A G  T  4 S-     0   0   69 1216   57  GGG  N       GGGG  G G                GsSWG GGSgA  G  DG              
    56   56 A G     <  +     0   0   25  915   61  ..S  Y       ....  . .                SsS.S .S.yS  N  ..              
    57   57 A G        -     0   0   43 1195   77  TSN  A       SSDN  S S                ITPEY SBNAK  D  ST              
    58   58 A T  E     -G   51   0B  62 1209   46  AIE  T       TTTA  T T                QKLTT ITLTT  P  TT              
    59   59 A K  E     -G   50   0B  89 1212   88  EGK  L       DDYY  Y S                YRRDY YYHYV  D  YY              
    60   60 A Y  E     -G   49   0B  46 1215    9  YYY  Y       YYYY  Y F                YYYYY YYFYY  Y  YY              
    61   61 A N    >>  -     0   0   12 1216   63  NNA  A       NNMS  S N                SSSGA NAASA  A  NN              
    62   62 A E  G >4 S+     0   0  148 1216   64  PPD  D       PPPP  P P                EQDSP PDVQS  D  PP              
    63   63 A K  G 34 S+     0   0  109 1216   64  AAS  S       TTSS  S A                SSAAA SSSSS  A  SS              
    64   64 A F  G X> S+     0   0    5 1216   45  LLV  V       LLLL  L L                VVVFV LVAVV  V  LL              
    65   65 A K  T << S+     0   0  156 1216   40  KKT  K       KKKK  K K                KNKSK RRQQE  Q  KR              
    66   66 A S  T 34 S+     0   0  108 1216   35  SSG  E       SSSS  S S                GGGSG GGGGG  G  SS              
    67   67 A K  T <4 S+     0   0   33 1214   21  RRR  R       RRRR  R R                RRRRR RRRRR  R  RR              
    68   68 A A  E  <  -C   83   0A   2 1216   69  LLF  F       LLTT  T L                FFFIA VFFFI  F  II              
    69   69 A T  E     -C   82   0A  58 1216   37  TSA  T       SSSS  S S                ITINT TTTTE  T  SA              
    70   70 A L  E     +C   81   0A   7 1216   27  III  I       IIII  I I                IIIII IIIII  I  II              
    71   71 A T  E     -C   80   0A  57 1213   47  STS  S       TTSS  S T                SSSTS SSSST  S  TT              
    72   72 A V  E     -C   79   0A  28 1216   71  RRR  R       RRRR  R K                RRRVR VRRRR  R  RR              
    73   73 A D  E   > -C   78   0A  69 1216    7  EDD  D       DDDD  D D                DEDDD DBNDD  D  DD              
    74   74 A K  T > 5S+     0   0  105 1216   62  TTN  D       TTTT  T N                NNDDN TIDDN  N  TT              
    75   75 A P  T 3 5S+     0   0  122 1215   37  SSS  S       SSSS  S S                NSSSG SSSSS  G  SS              
    76   76 A S  T 3 5S-     0   0   37 1216   65  KKK  Q       KKKK  K K                RKNRQ RKKSN  Q  KK              
    77   77 A S  T < 5 +     0   0   24 1216   48  SSN  S       SSNN  N S                AKSNS NBNSS  S  NN              
    78   78 A T  E   < -BC  23  73A   8 1216   64  QQM  M       QQQQ  Q Q                QMLET QTTKM  T  QQ              
    79   79 A A  E     -BC  22  72A   0 1207   67  VVL  V       VVFF  F V                LLLYV FLLLV  V  CY              
    80   80 A Y  E     -BC  21  71A  61 1209   36  SSY  Y       YYYS  S S                NHYYK SYYYY  Y  YS              
    81   81 A M  E     -BC  20  70A   0 1212    9  LLL  L       LLLL  L L                LLLLL LLLLL  L  LL              
    82   82 A Q  E     -BC  19  69A  69 1215   43  SSH  Q       TTQQ  Q S                QQQQQ NZQQR  Q  QH              
    83   83 A L  E     -BC  18  68A   0 1215   14  LLM  M       LLLL  L V                MMMLL LMMML  M  LL              
    84   84 A S        +     0   0   32 1215   56  SSD  N       NNSS  S S                NDNNN RKLNS  N  NS              
    85   85 A S  S    S-     0   0   89 1216   25  SSN  N       RSSS  S S                SSSSS STSNS  S  SS              
    86   86 A L        +     0   0    2 1216   15  VVL  L       LLMV  M V                LLLVL MLLLL  L  VV              
    87   87 A T    >   -     0   0   61 1215   68  TTR  K       RRTT  T T                KRKTK SRQKK  K  TT              
    88   88 A S  G >  S+     0   0   72 1216   59  IAA  T       ATTT  T P                TVKTA ATATP  A  TT              
    89   89 A E  G 3  S+     0   0  107 1216   21  DEE  E       EEQE  E E                EEEAE AEZEE  E  EE              
    90   90 A D  G <  S+     0   0    7 1216    3  DDD  D       DDDD  D D                DDDDD DDBDD  D  DD              
    91   91 A S    <   +     0   0   31 1216   34  ATT  T       TTTS  T T                STSST TTTTS  T  TT              
    92   92 A A  E    S- H   0 116B  10 1214    5  APA  A       AAAA  A A                AAAGG AAAAA  A  AA              
    93   93 A V  E     -EH  39 115B  21 1216   48  VMV  L       VMVV  M T                VMITT MVLVV  T  TT              
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYY  Y       YYYY  Y Y                YYYYY YYYYY  Y  YY              
    95   95 A Y  E     -E   37   0B   1 1216    3  YYY  Y       FFYY  Y Y                YYYYF YYYYY  Y  YF              
    96   96 A a  E     +E   36   0B   0 1216    1  CCC  C       CYCC  C C                CCCCC CCCCC  C  CC              
    97   97 A A  E     -EI  35 110B   0 1215   24  AAA  T       AAAT  A A                AASAA AAAAA  T  AA              
    98   98 A R  E     -E   34   0B  13 1196   38  KRR  V       RRRR  R R                RRPRK RKRRR  R  RR              
    99   99 A M  E     -EI  33 107B   5 1101   82  NDD  A       DEDH  H D                EEVDN GLLEH  L  SS              
   100  100 A W  E >   -E   32   0B  89 1101   89  Gya  q       tttS  t T                syEtd nIsTt  a  Pp              
   101  101 A Y  T 3  S+     0   0  112  572   91  ..i  .       ....  . .                ccSsg y...y  h  ..              
   102  102 A Y  T 3  S-     0   0  133  629   92  ..T  .       ....  . .                RAPIC Y..QS  T  ..              
   103  103 A G  S <  S+     0   0   38  705   79  y.f  .       ....  . .                fFFfn d..yf  y  y.              
   104  104 A T        -     0   0   32  784   66  ggr  d       .pge  g e                sEp.d ga.dg  g  ag              
   105  105 A Y        +     0   0   81  679   93  gah  q       slrs  e m                l..na dra..  s  .y              
   106  106 A Y        -     0   0   32  842   66  FCk  F       ClSW  c V                YF.LR dBv..  F  WF              
   107  107 A F  E     +I   99   0B   0  885   48  IIm  R       .d.Y  l I                .SfF. i.f..  I  FF              
   108  108 A D  E     +     0   0B  25  997   46  EDD  D       .D.R  G D                NTEKG D.DQT  D  AI              
   109  109 A Y  E     -J  168   0C 108 1059   61  YYV  S       .M.L  Y S                FEYIF VFVFY  A  YH              
   110  110 A W  E     -I   97   0B  23 1092    2  WWW  W       WWWW  W W                FWYWW WWWRR  W  WW              
   111  111 A G        -     0   0    3 1067   15  GGG  P       AAGP    S                SDFG  GGGEG  G  GG              
   112  112 A Q        -     0   0  141 1047   41  PPQ  A       Q PP    P                SDD   QQQGQ  R  QQ              
   113  113 A G        -     0   0   20 1013   12  GGG  G       G                        PDA   GGGP   G  GG              
   114  114 A T  E     - H   0  94B   2  996   31  LLT          F                        PIV   TTTI   T  TT              
   115  115 A T  E     - H   0  93B  60  979   76  LLT          P                        LLL   TLKK   S  LL              
   116  116 A L  E     -dH  10  92B   1  972   19  VVV          L                        VLV   VVVL   V  VV              
   117  117 A T  E     -d   11   0B  57  953   21  TTI          K                        TGV   HTST   T  TT              
   118  118 A V  E     +d   12   0B   4  935    8  VVV          L                        LVV   VV L   V  VV              
   119  119 A S              0   0   64  917   10  SSS          S                        G     SS A   S  SS              
   120  120 A S              0   0  122  885   21  SSS          A                        G     S  T   S  A               
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32     DD QQE   Q    QQ E QQED Q   QDQN Q      Q     Q  EQ  DDDD EEEDDDDEE
   123    2 B A        -     0   0   19  713   70     II AAV   A    SA I SSII AIIISISI S      S     S  VY  IIIIIIIIIIIIII
   124    3 B V        -     0   0   84  765   49     VV AAV  VA    VP V VVVV AVVVVQVQ V      A     V  VV  QQQQVVVVVVVVVV
   125    4 B V  E     -Q  145   0D  10  820   26     ML VLFMLVV    LL L LLML LLLLLMLMMLL     P     LL FL  MMMMMLLMLLMMLL
   126    5 B T  E     +Q  144   0D  69  829   11     TT TTTTTTT    TT T TTTT TTTTTTTTTTT     T     TT TT  TTTTTTTTTTTTTT
   127    6 B Q  E     -Q  143   0D  18  832    2     QQ QQQQQQQ    QQ Q QQQQ QQQQQQQQQQQ     Q     QQ QQ  QQQQQQQQQQQQQQ
   128    7 B E        -     0   0   59  833   63     SS PPPSPPP    PP S PPSS PSSSPSPSSPE     P     PP PP  SSSSTSSSSSSSSS
   129    8 B S  S    S+     0   0  101  841   38     PP AAHPAPA    SP P PPPPAAPPPPPPPPPP     P     PS HP  PPPPPPPPPPPPPP
   130    9 B A  E     -k  226   0C  59  842   50     SA SSSASLS    SA G SSAASSAAASSSSSSA     S     SS SS  SSSSSGGVAADDAA
   131   10 B L  E     -k  227   0C  57  847   76     SS VVVTVVV    VV T VATSLVSSSASVSSMM     V     LV VV  SSSSSTTTSSSSII
   132   11 B T  E     +k  228   0C  84  848   77     LM SSSLSSS    SS L SSLLASLLLSLSLLSS     S     SS SS  LLLLKLLLLLLLTT
   133   12 B T  E     -k  229   0C  18  848   68     TY AAGSGVA    GG S AGSAKASSSGSASSGV     G     GV GV  SSSSSSSSAAAVAA
   134   13 B S    >   -     0   0   55  849   70     va NNSlATN    ST l ATvkSNrgsAaAaaSA     S     TT SS  aaaavllvvvvvaa
   135   14 B P  T 3  S+     0   0   61  848   65     al PLPpLPL    PP p PPpqQPpppPvPvlPL     P     PP PP  vvvvvpppllllll
   136   15 B G  T 3  S+     0   0   46  850    7     GG GGGGGGG    GG G GGGGGGGGKGGGGGRG     G     GG GG  GGGGGGGGGGGGGG
   137   16 B E    <   -     0   0  108  850   56     EE EGQEQQE    QT E QQEEEEEEEQDQDDEQ     Q     QQ QQ  DDDDDEEEQQEEQQ
   138   17 B T  E     - R   0 199D  88  850   66     KR TTTRTTT    RS R KRRTTTRRRSTRTTTT     S     KT TN  RRRRTRRRRRRRKK
   139   18 B V  E     - R   0 198D  14  850   33     VV VVVAIAV    VV A VIAVVVVVVVVVVVVA     V     VA VA  VVVVVAAAAAAAVV
   140   19 B T  E     - R   0 197D  53  849   41     TT KKTTTSK    TT T TTTTTKTTTTTTTTTR     T     TR TQ  TTTTTTTTTTTTTT
   141   20 B L  E     - R   0 196D   0  849   25     MI IIILIII    II L IILIIIIIIIIIIIII     I     II IL  IIIIILLLIIIIII
   142   21 B T  E     - R   0 195D  22  849   52     ST TTSSSTT    SS S SSSNNTSSNSTSTRST     S     ST ST  TTTTNSSSSSNNTT
   143   22 B b  E     -QR 127 194D   0  850    2     CC CCCCCCC    CC C CCCCCCCCCCCCCCCC     C     CC CC  CCCCCCCCCCCCCC
   144   23 B R  E     -Q  126   0D 133  850   77     KK SSTRTGS    TA R SSRKKSKKKSRSKQLQ     T     TG TS  RRRRQRRRRRKRSS
   145   24 B S  E >   -QS 125 148D  11  850   68     SA GGRAGGG    GG A GGAAAGAAAGAGAAGG     G     GG RG  AAAAAAAAAASSAA
   146   25 B S  T 3  S+     0   0   81  850   27     SS GGSSTDS    SS S SSSSSGSSSSSSSSSD     T     SN SN  SSGSSSSSSSSSSS
   147   26 B T  T 3  S-     0   0   87  850   71     QQ GSSQSNS    SS Q SSQQQSQQQSQSQQSL     S     SN SN  QQHQQQQQEEQQSS
   148   27 B G  B <  S+S  145   0D  39  850   55     sD SGGSNIS    TN S SSSSSSSsSSGSGGSL     S     SI GL  GSNDSSSSSSssss
   149   28 B A        -     0   0   40  390   77     l. ..S.D..    ND . NN.....n.N.N..N.     D     N. S.  ..........ll..
   150   29 B V        -     0   0    3  620   45     N. ..IVI..    II . II..VYVAVIII.II.     I     I. I.  ....VVV.VVYY..
   151   30 B T    >   -     0   0   56  541   72     S. ..DSG..    GG V GG..SYSFSG.G.NG.     G     G. ..  ....YSSIDDSS..
   152   31 B T  G >  S+     0   0   94  694   78     GI ..SSRA.    LR D NSVVNGGGTS.RINGR     Y     S. ..  IIIISNNSNNSS..
   153   32 B S  G 3  S+     0   0   84  802   62     nN S.ESYS.    GY S NNSSDNsSsNSSSEGS     Y     Dg dg  RSTTNSSNsynn..
   154   33 B N  G <  S-     0   0   13  673   73     nS S...NR.    .N N ..SS.YsSs.N.N.YY     N     .k rk  NNNNN..Ssnnnss
   155   34 B Y    <   -     0   0   98  781   50     YY YSY.AYA    YL Y YTYY.YYYYYYCY.SY     A     NS YY  DYFYRYFYFFYYYY
   156   35 B A        -     0   0    0  817   59     LL YYVLVVY    VV L VVLLLYLLLVLVLLVS     V     VV VV  LLLVLLLLMMLLMM
   157   36 B N  E     -L  212   0C   0  827   79     TS GGQASSG    HS G SNANGGNHNYASANQA     S     HH YQ  TNSNAAAANNAAHH
   158   37 B W  E     -LM 211 171C   0  849    0     WW WWWWWWW    WW W WWWWWWWWWWWWWWWW     W     WW WW  WWWWWWWWWWWWWW
   159   38 B V  E     -LM 210 169C   0  849   25     HF YFYYHHY    YY Y YYYYYYYYYYYYYYYH     Y     YY YY  YYYFFYYYFFYYYY
   160   39 B Q  E     -LM 209 168C  10  849   10     QQ QQQQQQQ    QQ Q QQQQQQQQQQQQQQQQ     Q     QQ QQ  QQQQQQQQQQQQQQ
   161   40 B E  E     -LM 208 167C  20  849    8     QQ QQQQQQQ    QQ Q QQQQQQQQQQQQQQQQ     Q     QQ QQ  QQQQQQQQQQQQQQ
   162   41 B K  E  >  - M   0 166C  68  849   50     KK kkRKYKk    VR R LLKKKkKKKLKVKKPK     H     FK RK  KKKRKKKKKKKKKK
   163   42 B P  T  4 S+     0   0   98  843   23     PP ppPPPPp    PP P PPPPPpPPPSPPPPQP     P     PP PP  PPPPPPPPPPPPSS
   164   43 B D  T  4 S-     0   0  148  846   16     GG GGGGGGG    GG G GGGGGGGGGGGGGGGG     G     EA GG  GGGGGGGSGGGGGG
   165   44 B H  T  4 S+     0   0   90  845   66     QK SSSQKQS    KR Q TTQQQSQQQKKTTAMQ     T     TH SS  TKKQQQQGQQQQTT
   166   45 B L  E  <  - M   0 162C  92  846   57     PS AAAAATV    AA A AAAAAAAVAAAASSAA     A     AS AA  AAAAPAASPPPASS
   167   46 B F  E     + M   0 161C   9  847   19     PP LPPPPPP    PP P PPPPPPPPPPPPPPPP     P     PP PP  PPPPPPPPPPPPPP
   168   47 B T  E     -JM 109 160C  56  843   61     KK VVTRKVV    KK R KKRKKVRRKKKKKKKV     K     KL TL  KKTKKRRRKKKKKK
   169   48 B G  E     + M   0 159C   1  848   64     MT TTTLATT    LL L ILLLLTLLLLLLLLLQ     L     LL TL  RLLVLLLLLLLLPP
   170   49 B L  E     +     0   0C   4  848   24     LL VVVLLIV    LL L LLLLLVLLLLLLLLIV     M     LI VV  LLLLLLLLLLLLWW
   171   50 B I  E     +NM 177 158C   0  848   19     II IIIIIII    II I IIIIIIIIIIIIIIIM     I     II II  IIIIIIIIIIIFII
   172   51 B G  E  >  +N  176   0C   0  849   33     YY YYYYYNY    YY Y YYYYYYYYYYYYYYYY     Y     YY YY  YYYYYYYYYYYSYY
   173   52 B G  T  4 S-     0   0    9  848   87     WR ENKGGGG    ED G DDGGASYYLNAQYAGH     G     GE DD  GAAGKGVGAAWWEE
   174   53 B T  T  4 S+     0   0    9  849   68     AA SNDAVNS    DV A NNAAANAAANADAANN     V     DD DN  AAVAAAAAAAAAII
   175   54 B N  T  4 S+     0   0  102  841   49     SN SNNSNNT    SS S NNSSSTNNTNSNSSSD     S     SS NS  TSSSSSSSSSSSSS
   176   55 B N  E  <  -N  172   0C  77  849   69     TR KNQSTNG    KT S KKNDSNSKNQSKTTNK     N     NK QN  SSNITSSTNNTTKK
   177   56 B R  E     -N  171   0C 113  850   66     RL RRRRRQR    RR R RRRRRRLLLRLRLLRR     R     RR RR  LLLLLRRRQQRRLL
   178   57 B A    >   -     0   0    1  849   73     EV PPPVPPP    PP A PPAAAPAAAPQPQQPS     P     PP PP  QQQEAAAAGGEEAA
   179   58 B P  T 3  S+     0   0   97  849   39     SD SSSTSSS    SS T SSTSSSSSSSSSSSSS     S     SS SS  SSVTSTTTSSSSSS
   180   59 B G  T 3  S+     0   0   83  850   18     GG NDGGGGN    GG G GGGGGNGGGGGGGGGG     G     GG GG  GGGGGGGGGGGGGG
   181   60 B V  S <  S-     0   0   13  848   23     VV IIVIIII    VI V IVIVVIVVVVVVVVVI     V     VI VI  VVVVVIIIVVVVVV
   182   61 B P    >   -     0   0   57  850    9     PP PPPPPPP    PP P SPPPPPPPPPPSPPPP     S     PP PP  PTPPPPPPPPPPPP
   183   62 B A  T 3  S+     0   0   77  850   59     DS SSDDDES    DE D DDADDSAAADSDSSDD     D     DD DN  SSSSSDDAAADDAA
   184   63 B R  T 3  S+     0   0   58  850    5     RR RRRRRQR    RR R RRRRRRRRRRRRRRRR     R     RR RR  RRRRRRRRRRRRRR
   185   64 B F  E <   +T  198   0D   4  850    1     FF FFFFFFF    FF F FFFFFFFFFFFFFFFF     F     FF FF  FFFFFFFFFFFFFF
   186   65 B S  E     -T  197   0D  51  849   17     TS SSSSSSS    SS S SSSSSSSSSSSSSSSS     S     SS SS  SSSSKSSSSSSSSS
   187   66 B G  E     +T  196   0D   9  850    4     GG GGGGGGG    GG A GGGGGGGGGGGGGGGG     G     GG GG  GGGGGGGGGGGGGG
   188   67 B S  E     -T  195   0D  41  850    7     SS SSsSSSS    SS S SSSSSSSSSSSSSSSS     S     SS sA  SSSSSSSSSSSSSS
   189   68 B L  E     -T  194   0D  59  835   79     GG TKsGKKK    KK G KKGGGTGGGKGKGGKY     K     KN sK  GGGGGGGGGGGGGG
   190   69 B I  E >   -T  193   0D  86  842   31     SS SSSSSSS    SS S SSSSSSSSSSSSSYSS     S     SS SS  SSSSSSSSSSSSSS
   191   70 B G  T 3  S-     0   0   67  850   18     GG GGSEGGG    GG G GGGGGGGGGGGGGGGG     G     GG SG  GGGGGGGGGGGGGG
   192   71 B N  T 3  S+     0   0  105  828   57     TQ SSNTNNS    NN T TTTTTSTTTTTTTTSN     N     NN NN  TTATTTTTTTTTTT
   193   72 B K  E <  S- T   0 190D  68  833   67     DD TTSDTMT    ST D SSDDDTDDDSDSDDST     T     ST ST  EDEDQDDEDDDDSS
   194   73 B A  E     -RT 143 189D   0  838   81     FY NAAYAAG    GA F AAFFFSFFFAFAFFGV     A     GA AA  FFFFFFFFFFFFYY
   195   74 B A  E     -RT 142 188D   0  849   57     TS TTSTSTT    TT T TSTTTTTTTSTSTTST     S     ST ST  TTTTTTTTSSTTSS
   196   75 B L  E     -RT 141 187D   0  850    2     LL LLLLLLL    LL L LLLLFLLLLLLLLLLL     L     LL LL  LLLFLLLLLLLLLL
   197   76 B T  E     -RT 140 186D  19  850   33     TT TTATTTT    TT S GATTTTTTTATATTTT     T     TT TT  TTTTTTTTNNTTTT
   198   77 B I  E     -RT 139 185D   0  849    5     II IIIFIII    II I IIIIIIIIIIIIIIII     I     II II  IIIIIIIIIIIIII
   199   78 B T  E    S+R  138   0D  78  850   46     SS TTSSSST    TS S TSSNSTSSSSSTSSTS     S     TS ST  NSSSSSSSHHSPSS
   200   79 B G  S    S-     0   0   15  850   57     SS GGGSGGG    GG R GGSNNGSSSGSGGGGG     G     GG GG  SSSSDRRSPPSGSS
   201   80 B A        -     0   0    0  849   51     VL VVLLLVV    LL L LLLFFVLLLLLLLLLA     L     LA LV  LLLLVLLLMMLLMM
   202   81 B Q    >   -     0   0   80  849   32     QE QQKQQQQ    QQ E QQEQQQEEEQQQQQQQ     Q     QQ KQ  QQQQQEEQEEQQEE
   203   82 B T  G >  S+     0   0   84  850   59     AY AASAAAA    AA P TSPAPAPPPSPTAASA     A     PD SA  PPPPCPPSEEAAAA
   204   83 B E  G 3  S+     0   0   99  850   17     EE DEEGEKE    EE E GEEDEEEEEEEGEEEE     E     EG EQ  EEEEADEEDDEEEE
   205   84 B D  G <   +     0   0    1  850    2     DD DDDDDDD    DD D DDDDDDDDDDDDDDDD     D     DD DD  DDDDDDDDDDDDDD
   206   85 B E    <   +     0   0   71  849   74     LM EEEVEEE    EE F EEFAAEGAAEFEFAEE     E     EE ED  FSFIAFFFTTVVAA
   207   86 B A  E    S- O   0 227C   3  850   14     AG AAAAAAA    AA A AAAAAAGAAAAAAAAA     A     AA AA  AAAAAAAAAAAAAA
   208   87 B I  E     -LO 161 226C  55  850   71     VI VVDVEDV    DD V DDVVVVDHHDTDSTDD     D     VD DD  TTTTTVVVMMVVII
   209   88 B Y  E     -LO 160 225C   0  850    0     YY YYYYYYY    SY Y YYYYYYYYYYYYYYYY     Y     YY YY  YYYYYYYYYYYYYY
   210   89 B F  E     -L  159   0C   5  848    8     YY FFYYYYY    YY Y YYYYYFYYYYYYYYYY     Y     YY YY  YYYYYYYYFFYYYY
   211   90 B b  E     -L  158   0C   0  849    1     CC CCCCCCC    CC C CCCCCCCCCCCCCCCC     C     CC CC  CCCCCCCCCCCCCC
   212   91 B A  E     -LP 157 221C   0  848   73     QL GGQQALG    QC Q GAQLLGQQQSQGMQQL     C     QQ QQ  LQQQRQQQQQQQQQ
   213   92 B L  E     - P   0 220C   0  845   83     NQ SGSHSPN    SS Q TAQQQSHQQAQAQNSV     S     SV SV  QQQQVQQQQQQQQQ
   214   93 B W  E     + P   0 219C  21  834   71     DY YYYYAYY    FY Y WWYYDRYSFWHWGDYW     Y     YG AW  YSNYAYYYSSYYWW
   215   94 B Y  E >  S- P   0 218C  33  829   88     YD DDDYRQD    DA G DDNNYDKRRDNDNYDD     T     DY ND  SYYDSGGNKKYYNN
   216   95 B S  T 3  S-     0   0  106  829   66     RG SSSSSTS    FG S SDNDNSSSSSSSSESS     T     YS DS  SSNTTSSNEESRYY
   217   96 B N  T 3  S+     0   0  105  824   81     SF SSytGSS    SS S SSwensySSSnSWGse     S     Sn Sd  FtFLNsSwVVTIpp
   218   97 B H  E <   -P  215   0C  39  647   66     .P ..pps..    .N . ..pppahpP.p.PPrk     .     .h Hs  P.SPNqPpPPPP..
   219   98 B L  E     -P  214   0C   1  382   85     VL A.v.y..    .. . .....wsq.....W..     S     .. .   WiFLI.S.WYYYii
   220   99 B V  E     -P  213   0C  12  489   66     TT GTLSTS.    .T . .....YGC.....G.K     T     .. .   TTTTVTTTTTSTTT
   221  100 B F  E     -P  212   0C  17  540   30     FF YYQFvI.    LF F LL...YLF.L.L.W.F     F     .. .   FFFFFFFFFFFFFF
   222  101 B G        -     0   0    1  481   35     GG A.TGpEG    SH G SN...G.R.....G..     H     .S .   GGGGGGGGGGGGGG
   223  102 B G        -     0   0   51  513   58     SA GAHQGDT    AS Q AG... .P.S...GA.     S     .D N   QQGGGQQQGGQQSA
   224  103 B G        -     0   0    8  528   33     GG GGGGGGG    PG G GP... NA.G...GP.     G     .T P   GGGGGGGGGGGGGG
   225  104 B T  E     - O   0 209C   0  550   33     TT G ETN      TA T TT... KQ. .S.GT.           .G T   TTTTTSTTTTTATT
   226  105 B K  E     -kO 130 208C  82  547   67     KK T KKH      V  K VV... NK. .A.KV.           .R V   KRKKEKKRKKKKKK
   227  106 B L  E     -kO 131 207C   0  546   44     LL V EVL      L  V LL..S LL. .HLVL.           LQ L   VLVVVVVVLLL LL
   228  107 B T  E     -k  132   0C  34  614   65     EE   HES      Q  E QQTTT   . TTTQQT           NT Q   EEDDVEEEEEE EE
   229  108 B V  E     -k  133   0C   3  593   35     IL   VI          I A VVV   . VVVVAV           AF T   VI IVILIIII IL
   230  109 B L              0   0  120  399   31          L             N ILL   L LLL Q            LL H       K         
   231  110 B G              0   0   62  207   39          S             G       P     G               G       G         
## ALIGNMENTS 1541 - 1610
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 A E              0   0  185  771   30    E    EQ    Q    Q            Q Q     QQ QQ E Q          Q      DE   
     2    2 A V        +     0   0   18  834   19    E    VA    V    V            I L     VV VV V V          V      II   
     3    3 A Q  E     -A   25   0A  90  836   34    K    QQ    Q    Q            T Q     QQ QQ K Q          Q      QK   
     4    4 A L  E     -A   24   0A  13  881    3    L    LV    L    L            L L     LL LL L L          L    L LL  L
     5    5 A Q  E     -A   23   0A 107  882   70    V    VV    Q    Q            D L     QQ QQ Q Q          Q    T VE  Q
     6    6 A Q  E     -A   22   0A  14  887   31    E    KE    E    E            Q E     EE EE E Q          E    E EE  E
     7    7 A S        -     0   0   33  892   13    S    SS    S    S            P S     SS SS S W          S    S SS  S
     8    8 A G        -     0   0   52  907   11    G    VG    G    G            G G     GG GG G G          G    E GG  G
     9    9 A A        -     0   0   80 1179   51    G    GG    G    GP           S P     PP PP P T          P    S GG  P
    10   10 A E  E     -d  116   0B  68 1189   46    G    DS    G    RG           A G     GG EG G G          G    V DG  G
    11   11 A L  E     +d  117   0B 130 1195   22    L    LV    L    SL           V V     LL PL L L          L    V VV  T
    12   12 A V  E     -d  118   0B  28 1197   47    V    VV    V    VV           V V     VV VV V V          V    K KR  V
    13   13 A K    >   -     0   0  145 1201   50    Q    KQ    Q    QQ           N K     KK KK K K          K    R RR  K
    14   14 A P  T 3  S+     0   0   70 1203    8    P    PP    A    SP           P P     PP PP P P          P    P PP  P
    15   15 A G  T 3  S+     0   0   59 1209   28    G    GG    G    GS           S S     SS SS S S          S    G AG  S
    16   16 A A    <   -     0   0   36 1213   63    G    GR    G    GQ           G E     QQ QQ Q E          Q    E EE  E
    17   17 A S        -     0   0   66 1210   29    S    SS    S    ST           T T     TT TT T T          T    S ST  S
    18   18 A V  E     - B   0  83A  10 1213   32    L    LL    L    LL           L L     LL LL L L          L    H LV  L
    19   19 A K  E     - B   0  82A 119 1211   53    R    RR    R    RS           K R     SS SS S S          S    R RL  R
    20   20 A L  E     - B   0  81A   0 1214   21    L    AL    L    LL           L L     LL LL L L          L    L LT  L
    21   21 A S  E     - B   0  80A  31 1215   35    S    SS    S    ST           S S     TT TT T T          T    T SS  T
    22   22 A a  E     -AB   6  79A   0 1216    0    C    CC    C    CC           C C     CC CC C C          C    C CC  C
    23   23 A K  E     -AB   5  78A 113 1216   70    V    AI    E    AA           K A     AS TT T A          A    S QK  T
    24   24 A A  E     +A    4   0A   2 1216   49    G    AA    A    AI           V V     VV VA V V          I    A GA  V
    25   25 A S  E     +A    3   0A  49 1216   12    S    SS    S    SS           S S     SS SS T S          S    S SS  S
    26   26 A G  S    S+     0   0   56 1215    3    G    GG    G    GG           V G     GG GG G G          G    G GG  G
    27   27 A Y  S    S-     0   0   39 1216   33    F    FF    N    ID           S G     FF FF Y H          D    F YF  F
    28   28 A T    >   -     0   0   90 1216   52    M    TS    V    DS           V S     SS SS S S          S    T NT  E
    29   29 A F  G >  S+     0   0   13 1216   27    F    FF    D    VV           S V     II LL I I          V    F FF  L
    30   30 A T  G 3  S+     0   0   40 1216   55    S    SS    R    NS           S S     TT TT T T          S    S GS  T
    31   31 A S  G <  S+     0   0   23 1216   57    r    Sg    i    rs           A s     tt ss s s          s    S Ds  S
    32   32 A Y  E <  S-E  100   0B  40 1139   28    .    Y.    .    .a           . y     yy .. y c          a    Y Yy  Y
    33   33 A W  E     -E   99   0B  40 1148   92    d    Na    a    aS           P Y     AY gs C .          T    G H.  Y
    34   34 A M  E     -EF  98  51B   0 1206   49    I    MM    M    MW           W W     WW VV W W          W    M MM  V
    35   35 A H  E     -EF  97  50B   0 1212   72    K    NH    G    GN           G S     DS HH S H          N    N SE  Y
    36   36 A W  E     -EF  96  49B   0 1216    0    W    WW    W    WW           W W     WW WW W W          W    W WW  W
    37   37 A V  E     -EF  95  47B   0 1216   17    V    VL    F    FI           I I     II TI V I          I    V IA  I
    38   38 A K  E     -EF  94  46B   7 1216   22    R    HR    R    RR           W R     RR LR R R          R    R RR  R
    39   39 A Q  E     +EF  93  45B  20 1216    5    Q    KQ    Q    QQ           Q Q     QQ QQ Q Q          Q    Q QQ  Q
    40   40 A R    >   -     0   0   35 1216   71    A    SI    A    AS           A Q     PP AA P A          S    A AA  P
    41   41 A P  T 3  S+     0   0  130 1215   15    P    PP    P    PP           P P     PP PP P L          P    P PP  P
    42   42 A G  T 3  S+     0   0   83 1216   22    G    GG    G    GS           G G     GG GG G G          S    G GG  R
    43   43 A R  S <  S-     0   0  156 1216   43    K    KK    K    TR           K K     KK KK K K          R    K KK  K
    44   44 A G        -     0   0   16 1215   36    G    GG    Q    EX           G G     GG GR G G          G    G GG  T
    45   45 A L  E     -F   39   0B   8 1215   10    L    LL    R    RL           L L     LL LL L L          L    L LL  L
    46   46 A E  E     -F   38   0B  34 1216    6    E    QE    E    EE           V E     EE EE E E          E    E EE  E
    47   47 A W  E     -F   37   0B   3 1216   10    W    WW    F    FW           D W     WW WG W W          W    W WW  W
    48   48 A I  E     -     0   0B   0 1215   31    L    VV    V    VL           M M     MM VV M M          L    I IV  I
    49   49 A G  E     -FG  36  60B   0 1216   35    A    TA    G    AG           G G     GG GG G G          G    A AA  G
    50   50 A R  E     -FG  35  59B  32 1216   94    A    YV    Y    GR           Y Y     IR AV C C          r    Y YR  V
    51   51 A I  E     -FG  34  58B   0 1207   17    I    .I    I    VT           L .     II VM V I          y    I II  V
    52   52 A D     >  -     0   0   26 1212   86    S    .S    S    RY           S W     YS WF N C          Y    C SG  R
    53   53 A P  T  4 S+     0   0    0 1212   83    D    .Y    E    WY           S S     NS TG N S          R    T YT  T
    54   54 A N  T  4 S-     0   0   96 1213   69    S    ID    G    SR           N G     DG DG D D          S    S NS  D
    55   55 A G  T  4 S-     0   0   69 1216   57    V    SG    G    Ds           R S     GG GG G G          K    S GS  G
    56   56 A G     <  +     0   0   25  915   61    T    .N    .    Aw           . .     .. .. . .          W    S NS  .
    57   57 A G        -     0   0   43 1195   77    S    .H    I    YY           G .     SS SS N S          Y    P TY  S
    58   58 A T  E     -G   51   0B  62 1209   46    T    .K    L    TN           S T     TT TT L T          N    I QL  T
    59   59 A K  E     -G   50   0B  89 1212   88    Y    .L    N    DS           Y Y     YY SA Y N          D    Y YA  A
    60   60 A Y  E     -G   49   0B  46 1215    9    Y    YY    Y    YY           P Y     YY YY Y Y          Y    Y YY  I
    61   61 A N    >>  -     0   0   12 1216   63    A    DS    G    AA           A N     SS NN T S          A    S AS  A
    62   62 A E  G >4 S+     0   0  148 1216   64    D    KD    D    DV           P P     PP TP P P          Q    Q DD  D
    63   63 A K  G 34 S+     0   0  109 1216   64    S    SS    F    SS           S A     SS TT S S          S    S VA  S
    64   64 A F  G X> S+     0   0    5 1216   45    V    VV    V    VV           F F     LL LL L L          V    V VV  L
    65   65 A K  T << S+     0   0  156 1216   40    K    KK    K    KK           Q Q     KK KK K K          Q    Q KK  K
    66   66 A S  T 34 S+     0   0  108 1216   35    G    GG    G    GS           S N     SS SS S S          N    G GG  N
    67   67 A K  T <4 S+     0   0   33 1214   21    R    QR    R    RR           R R     RR RR R R          R    R RR  R
    68   68 A A  E  <  -C   83   0A   2 1216   69    F    FF    F    FI           V I     TT LL T T          I    F FF  V
    69   69 A T  E     -C   82   0A  58 1216   37    T    TT    T    TT           T T     SS SS S S          S    S TV  T
    70   70 A L  E     +C   81   0A   7 1216   27    I    NI    I    II           F I     II MI I I          I    I II  I
    71   71 A T  E     -C   80   0A  57 1213   47    S    SS    S    SN           T T     SS TT S S          N    S SS  T
    72   72 A V  E     -C   79   0A  28 1216   71    R    RR    R    RP           G A     RR RR R R          P    R RR  K
    73   73 A D  E   > -C   78   0A  69 1216    7    D    DD    D    DD           D D     DD DD D V          D    D ND  D
    74   74 A K  T > 5S+     0   0  105 1216   62    N    NN    N    NT           T T     TT TT T T          T    D ND  N
    75   75 A P  T 3 5S+     0   0  122 1215   37    S    GS    A    NS           S S     SS SS S S          S    S PS  G
    76   76 A S  T 3 5S-     0   0   37 1216   65    Q    KK    K    KK           K K     KK KK K K          K    S SN  K
    77   77 A S  T < 5 +     0   0   24 1216   48    N    NS    N    NN           N N     NN SS N N          N    S SS  K
    78   78 A T  E   < -BC  23  73A   8 1216   64    T    TL    T    TQ           E Q     QQ QQ Q Q          Q    K ML  Q
    79   79 A A  E     -BC  22  72A   0 1207   67    A    LL    V    VF           I F     FF VV F F          F    L LL  V
    80   80 A Y  E     -BC  21  71A  61 1209   36    Y    YF    Y    YS           Y S     SS YY S S          S    Y YY  Y
    81   81 A M  E     -BC  20  70A   0 1212    9    L    LL    L    LL           L L     LL LL L L          L    L LL  L
    82   82 A Q  E     -BC  19  69A  69 1215   43    Q    QH    Q    QH           E Q     QQ TT Q Q          Q    Q QQ  Q
    83   83 A L  E     -BC  18  68A   0 1215   14    M    MV    M    ML           M L     LL LL L L          L    M MM  M
    84   84 A S        +     0   0   32 1215   56    N    NN    S    GN           T N     SS NN S S          N    N NN  N
    85   85 A S  S    S-     0   0   89 1216   25    S    IS    N    SS           S G     SS SS S S          S    S GN  G
    86   86 A L        +     0   0    2 1216   15    L    LL    L    LV           M V     VM ML V V          V    L LL  M
    87   87 A T    >   -     0   0   61 1215   68    K    RT    K    ET           K T     TT RR T T          T    R KK  E
    88   88 A S  G >  S+     0   0   72 1216   59    T    AS    S    AP           S L     TT AA T T          P    M TT  V
    89   89 A E  G 3  S+     0   0  107 1216   21    E    EA    E    GE           E A     QE DE E E          E    E EE  K
    90   90 A D  G <  S+     0   0    7 1216    3    D    DD    D    DD           D D     DD DD D D          D    D DD  D
    91   91 A S    <   +     0   0   31 1216   34    T    TT    T    TT           S T     TT TT T T          M    T TT  T
    92   92 A A  E    S- H   0 116B  10 1214    5    A    AA    G    AA           G A     AA AA A A          A    A AA  A
    93   93 A V  E     -EH  39 115B  21 1216   48    R    VI    V    LV           T L     VV MV M M          V    V MV  M
    94   94 A Y  E     -EH  38 114B   0 1216    1    Y    YY    Y    YY           Y Y     YY YY Y Y          Y    Y YY  Y
    95   95 A Y  E     -E   37   0B   1 1216    3    Y    YY    F    YY           Y Y     YY YF Y Y          Y    Y YY  Y
    96   96 A a  E     +E   36   0B   0 1216    1    C    GC    C    CC           C C     CC CC C C          C    C CC  C
    97   97 A A  E     -EI  35 110B   0 1215   24    V    AA    A    AA           A A     AA AA T A          A    A AS  T
    98   98 A R  E     -E   34   0B  13 1196   38    R    KR    A    AS           I R     RR RR R R          R    R RR  S
    99   99 A M  E     -EI  33 107B   5 1101   82    G    DD    S    GG           D D     DD DG D D          D    R DD  T
   100  100 A W  E >   -E   32   0B  89 1101   89    D    tf    H    lg           T T     tt tt t t          t    d tt  l
   101  101 A Y  T 3  S+     0   0  112  572   91    I    gs    .    vy           Q .     .. ig . i          .    e ..  .
   102  102 A Y  T 3  S-     0   0  133  629   92    R    HI    .    QH           H .     .. HA . G          .    T ..  .
   103  103 A G  S <  S+     0   0   38  705   79    f    hF    W    yY           C .     .. fg . G          .    y ..  .
   104  104 A T        -     0   0   32  784   66    g    gg    g    .S           D .     gg gg g g          g    . gs  g
   105  105 A Y        +     0   0   81  679   93    v    .y    i    g.           . .     ha is i r          n    v ..  g
   106  106 A Y        -     0   0   32  842   66    y    .s    k    Y.           Y .     RV RC y Y          W    F ..  Y
   107  107 A F  E     +I   99   0B   0  885   48    m    .m    i    .M           F .     F. .. l .          F    I ..  F
   108  108 A D  E     +     0   0B  25  997   46    N    .D    E    SD           D .     H. .. M .          D    K S.  E
   109  109 A Y  E     -J  168   0C 108 1059   61    L    FT    H    YV           Y V     K. S. I I          V    F F.  H
   110  110 A W  E     -I   97   0B  23 1092    2    W    WW    W    WW           W W     WW WW W W          W    W W.  W
   111  111 A G        -     0   0    3 1067   15    G    TG    G    GG           G G     DN IA S G          G    L K.  G
   112  112 A Q        -     0   0  141 1047   41    P     R    K    QQ           P       PP PQ E R          P    K RE  Q
   113  113 A G        -     0   0   20 1013   12    G     G    G    GG           G       NK TG   T          G    G NG  G
   114  114 A T  E     - H   0  94B   2  996   31    V     T    T    TT           T       DD LF   G          V    I GK  T
   115  115 A T  E     - H   0  93B  60  979   76    E     T    Q    QT           M       LM LP   L          L    I MN  M
   116  116 A L  E     -dH  10  92B   1  972   19    V     V    V    VV           V        V VP   S          V      VI  V
   117  117 A T  E     -d   11   0B  57  953   21    V     I    T    TT           T          TK   A          T       T  T
   118  118 A V  E     +d   12   0B   4  935    8    V     V    V    VV           V           L   I          V       V  V
   119  119 A S              0   0   64  917   10    S     S    S    SS           T           S   S          S          T
   120  120 A S              0   0  122  885   21    S     S    S    SS           S           A   A          S          S
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32  QQ Q     D ED DE D  DDDQDQQEQQQ Q  QQQQ  Q  Q       DDDD   DQQ  E  QQ 
   123    2 B A        -     0   0   19  713   70  SS S     I LI II I  IIIVIVSVPSS I  SVSS  P  P       IIII I ISS  V  GS 
   124    3 B V        -     0   0   84  765   49  VV V V   Q VQ QV V  VVVVVVVVVVA V  GIQT  V  V    VV VTVVAV QVA  V  TV 
   125    4 B V  E     -Q  145   0D  10  820   26  LL L LL  M LM LL L  MLLLMLLFLLL L  ALLL  L  L L  LLMVMLMLV MLLM L  LL 
   126    5 B T  E     +Q  144   0D  69  829   11  TT TTTT  T TT TT T  STTTSTTTTTT T TTTTT  T  T T  TTTTTTTTT TTTT T  TT 
   127    6 B Q  E     -Q  143   0D  18  832    2  QQ QQQQ  Q QQ QQ Q  QQQQQQQQQQQ Q QQQQQ  Q  Q Q  QQQQQQQQQ QQQQ Q  QQ 
   128    7 B E        -     0   0   59  833   63  PP PPPT  S TS SS S  SSSPSPPPPPT S QPSPP  P  P P  TPSSSSPLS SPPS S  PP 
   129    8 B S  S    S+     0   0  101  841   38  ST PPPP  PAPP PP P  PPPKPKPHTPA P PAPHA  P  P P  PSPPTPPVP PPPP P  AP 
   130    9 B A  E     -k  226   0C  59  842   50  SS SSSF  ASPS SASA  SADSSSSSSSS D STASS  S  S S PSSSAAAASD SSSS A  SS 
   131   10 B L  E     -k  227   0C  57  847   76  VV VVVV  SLSS STLS  SSSVFVVVLAM Y AATVV  L  L L VPVSSFSTVF SVMF T  VV 
   132   11 B T  E     +k  228   0C  84  848   77  SS SSAS  LALL LLAL  LLLSLSFSSSS V SSLSS  S  S S SVSLLLLLPL LSSL L  SS 
   133   12 B T  E     -k  229   0C  18  848   68  RG GLVV  SVSS ASVA  ASSTATRGAGG S VGSGG  A  A A ASGSAAAAAS SGGS S  GG 
   134   13 B S    >   -     0   0   55  849   70  AS AANA  aSpa vlSv  vavSvSSSSAS v ASlTA  S  S S AaSakakvNa aAAa l  SN 
   135   14 B P  T 3  S+     0   0   61  848   65  PL PALP  vLvv apLl  vvlLvLLPPPL p LApPL  L  P P VvLtqpqpPp vPPv p  PP 
   136   15 B G  T 3  S+     0   0   46  850    7  GG GGGG  GGGG GGGG  GGGEGEGGGGG G GGGGG  G  G G GGGGGGGGGG GGGG G  GG 
   137   16 B E    <   -     0   0  108  850   56  QQ QQQQ  EQED EEQQ  EEESESQQAQQ E QAEQQ  A  A A SGQDEVEEEE DQQD E  QQ 
   138   17 B T  E     - R   0 199D  88  850   66  SR RTTT  TRTR KRRR  KTRTKTRTSSR T TTRSR  T  T T TTRRTTTRTR TRST R  TR 
   139   18 B V  E     - R   0 198D  14  850   33  VV VAAA  VAVV VAAA  VVVVVVVVVVV A AVAVV  A  A A VVVVVVVVVV VVVV A  VI 
   140   19 B T  E     - R   0 197D  53  849   41  TT TMRT  TTRT TSTT  TTTKTKTTRTT T TTTTT  R  R R TTSTTTTTKT TTTT T  TT 
   141   20 B L  E     - R   0 196D   0  849   25  II IIII  IIII MLII  MIVLMLIILIV L LVLII  L  L L IIIIIIIIIM IIII L  LI 
   142   21 B T  E     - R   0 195D  22  849   52  SS STTT  TSRT SSSS  STNSSSSSTSS T TSSSS  T  T T SSTTNNNNTN TSST S  SS 
   143   22 B b  E     -QR 127 194D   0  850    2  CC CCCC  CCCC CCCY  CCCCCCCCCCC C CCCCC  C  C C CCCCCCCCCC CCCC C  CC 
   144   23 B R  E     -Q  126   0D 133  850   77  SS TEGS  RRLR KRRR  KRKKKKTTTST K SSRTT  T  T T QQSRKKKKSK RTAK R  TS 
   145   24 B S  E >   -QS 125 148D  11  850   68  NG GGGG  AAAA SAAA  SALLSLGRLGG A GGAGG  L  L L ASGAAAAAGT AGGA A  KG 
   146   25 B S  T 3  S+     0   0   81  850   27  IS SNNE  SSSS SSSS  SSSNSNSSRSS S VSSTT  S  R S SSSSSSSSSS SSTS S  DS 
   147   26 B T  T 3  S-     0   0   87  850   71  RT SDNE  GEDQ QQEK  QEQSQSSSSSS S SGQSS  R  S G QKSQQQQRSS QSSQ Q  SS 
   148   27 B G  B <  S+S  145   0D  39  850   55  Sn SIIL  NsFS sSsS  snSGsGSGGSS S SsSSN  D  D G SSsGSSSSGN GSSG S  GS 
   149   28 B A        -     0   0   40  390   77  .g N...  .y.. l.d.  l..NlNNS.NN . Ss.DD  .  . A ..s....... .ND. .  .N 
   150   29 B V        -     0   0    3  620   45  .I I...  .YL. Y.YI  Y.vIYIVIIIV . YYVVI  V  I Y VVY.VvV..V IIV. .  .I 
   151   30 B T    >   -     0   0   56  541   72  .. G...  .GFI S.DS  S.sGS.GDSR. . ADSGG  S  S S YYN..sS..G .GG. .  NG 
   152   31 B T  G >  S+     0   0   94  694   78  .V A.G.  ITNS SVGT  S.NSS.RSVG. V TVSGK  V  V L NSVI.SNV.T .GGI V  WG 
   153   32 B S  G 3  S+     0   0   84  802   62  .G GgSd  HSGS nADs  n.kYngGEgNg S ASSYY  g  g s NNGSSSDS.E SYYN S  GY 
   154   33 B N  G <  S-     0   0   13  673   73  S. NrYg  N... nTSs  nsn.ny..y.s N ...NN  y  y y NN.SS..N.. S.NR N  S. 
   155   34 B Y    <   -     0   0   98  781   50  Y. HSYY  YL.Y YYYY  YYYYYYYYNGY W ...AY  N  T G NC.YY..YS. YYYW Y  YT 
   156   35 B A        -     0   0    0  817   59  VA VVAV  LMVL LLMM  LLLMLIVVIVV L ..LVV  I  I I LL.LL.LVYI LVVL L  VV 
   157   36 B N  E     -L  212   0C   0  827   79  NS KHYQ  AQSN AANH  ALAHAHIQHHG A ..ASS  Y  Y S AS.ASADAGD ASSA A  NQ 
   158   37 B W  E     -LM 211 171C   0  849    0  WW WWWW  WWWW WWWW  WWWWWWWWWWW W WWWWW  W  W W WWWWWWWWWW WWWW W  WW 
   159   38 B V  E     -LM 210 169C   0  849   25  YY YYYY  YYYY YYYN  YYFYYYYYYYY Y YRYYY  Q  Y Y FYYYYYYYFY YYYY Y  YY 
   160   39 B Q  E     -LM 209 168C  10  849   10  QQ QQQQ  QQQQ QQQQ  QQQQQQQQQQQ Q QQQQQ  Q  Q Q QQQQQQQQQQ QQQQ Q  QQ 
   161   40 B E  E     -LM 208 167C  20  849    8  QQ QQQQ  QQQQ QHQQ  QQQQQQQQQQQ Q QQQQQ  Q  Q Q QQQQQQQQQQ QQQQ Q  QQ 
   162   41 B K  E  >  - M   0 166C  68  849   50  LL LKKK  KKKK KKKK  KKNHKHLRKLL K KQKHY  K  K K KKVKKKKKkK KLCK K  KL 
   163   42 B P  T  4 S+     0   0   98  843   23  PP PPSP  QPPP PPPP  PQPEPELPPSP S PVPPP  P  P P PPPPPPPPpP PPPP P  SP 
   164   43 B D  T  4 S-     0   0  148  846   16  EG GGGG  GGEG GGGG  GGGGGGGGGGG G GGGGG  G  G G GGGGGGGGSG GGGG G  GG 
   165   44 B H  T  4 S+     0   0   90  845   66  TK TQQQ  KQKK QQQQ  QKQRQRTSSMT Q RPQSM  S  S S QQSKQQQQSE KTTA Q  EM 
   166   45 B L  E  <  - M   0 162C  92  846   57  AA AAAA  SPPA SAPP  SSPSSSRAPAG A ASAAA  R  P P PPGAAAAAAA ATVS A  GA 
   167   46 B F  E     + M   0 161C   9  847   19  PP PPPP  PPPP PPPP  PPPPPPPPPPP P PAPPP  p  P p PPLPPPPPPP PPMP P  PP 
   168   47 B T  E     -JM 109 160C  56  843   61  KK .VVL  QKTN KRKR  KQKTKTRTRKR K VRRKK  y  R l KKRKKKKKVK KKKK R  RK 
   169   48 B G  E     + M   0 159C   1  848   64  LL .PLM  LLLL LLLL  LLLNLTTTYLT L LTLLT  L  F L LLTLLRLPTL PLLL L  FL 
   170   49 B L  E     +     0   0C   4  848   24  LL .VIV  LLLL LLLL  LLLMLMLVLLI L VLLML  L  L Y LLILLLLLVL LLLL L  IL 
   171   50 B I  E     +NM 177 158C   0  848   19  IV .III  VIII IIII  IVIIIIIILII I ITIII  Y  L Y IIIIIIIIII IIII I  HI 
   172   51 B G  E  >  +N  176   0C   0  849   33  YD .YYY  YYSY YYYY  YYYYYYYYYYY Y YYYYY  Y  Y Y YYYYYYYYYY YYYY Y  CY 
   173   52 B G  T  4 S-     0   0    9  848   87  DS .DSL  NAGA WDAV  WNWRWRGKYNN G QSGEY  Y  F T ARGAGYKKWH YQDG D  SG 
   174   53 B T  T  4 S+     0   0    9  849   68  DD .DDD  AAAA AAAV  AAADADSDyNT A NNAVA  s  s S AASAAAAADS ADVA A  sN 
   175   54 B N  T  4 S+     0   0  102  841   49  SG KASN  KSSS SSSS  SKSDSDSNsNN S DNSSN  g  t T SSSSSSSSDT SNSS S  sN 
   176   55 B N  E  <  -N  172   0C  77  849   69  DD LDNE  TNDS TNNN  TTAKTKNQNQT T KNSNT  E  S S NNSTSTSNEK NKTT N  TQ 
   177   56 B R  E     -N  171   0C 113  850   66  RR LRRR  LVLL RRLL  RLRRRRQRKRR R RRRRR  Q  L L LLRLRRRLRL LRRL R  RR 
   178   57 B A    >   -     0   0    1  849   73  AP IPPA  AEEQ EAEE  EAQPEPPPGPP H PPAPP  G  G G AAPQAAAAPH EPPQ A  GP 
   179   58 B P  T 3  S+     0   0   97  849   39  SS FSSS  DSTS STSS  SESDSDSSQSS T SSTSS  S  S T SSSSSSSSSS SSSS T  PS 
   180   59 B G  T 3  S+     0   0   83  850   18  GG HGGG  GGGG GGGG  GGGGGGGGgGG G GGGGG  G  G G GGGGRGGRNG GGGG G  GG 
   181   60 B V  S <  S-     0   0   13  848   23  VV NVII  VVVV VIIV  VVVVVVVVvVV T IVIVI  V  V V VVVVVVVVIV VVIV I  IV 
   182   61 B P    >   -     0   0   57  850    9  PP NPPP  PPPP PPPP  PPPPPPPPPPP P PPPSP  P  P P PPPPPPPPPP PSPP P  PS 
   183   62 B A  T 3  S+     0   0   77  850   59  DD AADE  SAPS DAAA  DSADDDNDSDD E DEDND  S  S S SSDSDDDDSA SDDS A  DD 
   184   63 B R  T 3  S+     0   0   58  850    5  RR RRRR  RRRR RRRR  RRRRRRQRRRR R RRRRR  R  R R RRRRRRRRRR RRRR R  RR 
   185   64 B F  E <   +T  198   0D   4  850    1  FF FFFF  FFFF FFFF  FFFFFFFFFFF I FFFFF  F  F F FFFFFFFFFF FFFF F  FF 
   186   65 B S  E     -T  197   0D  51  849   17  SS SSSS  SSSS TSSS  TSMSTSSSSSS S SSSSS  S  S S KKSSSSSSSS SSSS S  TS 
   187   66 B G  E     +T  196   0D   9  850    4  GG VGGG  GGGG GGGG  GGGGGGGGGGG G GGGGG  G  G G GGGGGGGGGG GGGG G  AG 
   188   67 B S  E     -T  195   0D  41  850    7  SS SYTS  SSSS SSSS  SSSsSsSssSS S SSSSS  s  s s SSSSSSSSSS SSSS S  TS 
   189   68 B L  E     -T  194   0D  59  835   79  KK KNNK  GGGG GGGG  GGGsGsRsaKI G KRGKK  a  a a GGKGGGGGTG GKKG G  AK 
   190   69 B I  E >   -T  193   0D  86  842   31  SS SSSS  SSSS SSSS  SSSSSSSSSSS S SSSSS  S  S S SSSSSSSSSS SSSS S  SS 
   191   70 B G  T 3  S-     0   0   67  850   18  GG GGGG  GGGG GGGG  GGGSGSGSAGG G GGGGG  A  A A GGGGGGGGGG GGGG G  GG 
   192   71 B N  T 3  S+     0   0  105  828   57  SN SNNN  TTTT TTTT  TTTNTNSNNTS T SSTNN  N  N N TTNTTTTTST TTNT T  NT 
   193   72 B K  E <  S- T   0 190D  68  833   67  SS SSTT  QDDD DDDD  DQESDSTSAST D TEEMT  A  A A QQTEDDDDTD ESTD D  TS 
   194   73 B A  E     -RT 143 189D   0  838   81  AA AAAA  YFYF FFFF  FFFAFADAGAA F AAFAA  G  G G FFAFFFFFSF FAAF F  GA 
   195   74 B A  E     -RT 142 188D   0  849   57  ST TITT  SSTT TTTT  TSSFTFTSIST T TTTSS  L  L L TTTTTTTTTS TSST T  SS 
   196   75 B L  E     -RT 141 187D   0  850    2  LL LLLL  LLLL LLLL  LLLLLLLLLLL L LLLLL  L  L L LLLLFLFPLL LLLL L  LL 
   197   76 B T  E     -RT 140 186D  19  850   33  TT ATTT  KNTT TTND  TKTTTTTALAT T KTTTT  T  T T TTTTTTTTTT TTTT T  TA 
   198   77 B I  E     -RT 139 185D   0  849    5  II IIII  IIII IIII  IIIIIIIIIII I IIIII  I  I I IIIIIIIIII IIII I  II 
   199   78 B T  E    S+R  138   0D  78  850   46  ST TNSS  NHGS SSHH  SNSNSNSSSTA S ASSSS  S  S S NSSSSSSSTS STSR S  TT 
   200   79 B G  S    S-     0   0   15  850   57  GG GRGS  SPGS SSPP  SSSNSNGGGGG R GGSGG  G  G G GESCNNNNGK SGGG S  NG 
   201   80 B A        -     0   0    0  849   51  LL LVAV  LVVL VLVV  VLLVVVFLFLL M ALLLL  L  L L VVLLFFFFVM LLLL L  VL 
   202   81 B Q    >   -     0   0   80  849   32  QQ QERQ  QEQQ QEEE  KQQQKQQKQQQ E QREQQ  Q  Q Q QQQQQQQQQE QQRQ E  QQ 
   203   82 B T  G >  S+     0   0   84  850   59  AA AAAA  PEAP APEE  APATATASSSA A AAPAA  P  P P CCASAAPAAA PTAA P  AS 
   204   83 B E  G 3  S+     0   0   99  850   17  EE EGEE  EDEE EAEE  EEEEEEEEEEE E EEEDE  E  E E DDEEEEEDEE EEEE E  GA 
   205   84 B D  G <   +     0   0    1  850    2  DD DDDD  DDDD DDDD  DDDDDDDDDDD D DADDD  D  D D DDDDDDDDDD DDDD D  DD 
   206   85 B E    <   +     0   0   71  849   74  EE EEEE  FIAF LFAA  LFVELEEEEEE A EEFEE  E  E E AAEFATAAEA FEEF F  EE 
   207   86 B A  E    S- O   0 227C   3  850   14  AA AAAA  GAAA AAAA  AGAAAAAAAAA A AAAAA  A  A A AAAAAAAAAA AAAA A  AA 
   208   87 B I  E     -LO 161 226C  55  850   71  DD DDDD  SMTT VVTT  VSVIVIDDDDD D DDVDE  D  D D TTDTVVVVVV TDDN V  ND 
   209   88 B Y  E     -LO 160 225C   0  850    0  YY YYYY  YYYY YYYY  YYYYYYYYYYY Y YYYYY  Y  Y Y YYYYYYYYYY YYYY Y  YY 
   210   89 B F  E     -L  159   0C   5  848    8  YY YFYF  YFYY YYYY  YFYFYFYYYYY Y YYYYY  Y  Y Y YYFYYYYYYH YYYY Y  YY 
   211   90 B b  E     -L  158   0C   0  849    1  CC CCCC  CCCC CCCC  CCCCCCCCCCC C CCCCC  C  C C CCCCCCCCCC CCCC C  CC 
   212   91 B A  E     -LP 157 221C   0  848   73  SQ QQQQ  QQLQ HQLQ  QQQHQHSQTES Q QAQSA  M  V V AQVQQQMLGQ QLSL Q  AQ 
   213   92 B L  E     - P   0 220C   0  845   83  AS SSVS  HQGQ QHQR  QHQSQSSSTAS H DTKSS  I  I T AGAQQQQQSH QSSQ Q  WS 
   214   93 B W  E     + P   0 219C  21  834   71  WF YWWY  FSGS YRSI  YHYYYYWYWWY T YWYYY  W  W R RYYYYGDHYD YYYR R  WY 
   215   94 B Y  E >  S- P   0 218C  33  829   88  DD DDDD  WRYY LNYR  YFYDYDDDHDD D DESAR  T  T E YYDYYYYYDY NDRN S  YD 
   216   95 B S  T 3  S-     0   0  106  829   66  ST RNSS  SKSS SNEE  SGDSSSSSNNS V SSSGS  S  S N SSSSYNNNSN SSSS N  SS 
   217   96 B N  T 3  S+     0   0  105  824   81  ST sggs  TVgt HwSA  yTssysSynSS t SRssG  s  s n AGSystnTsl aSGW l  tn 
   218   97 B H  E <   -P  215   0C  39  647   66  .. rysn  PPa. .pp.  rP.nph.ps.. r .RptN  h  h h PPSpnpp.pp p.NP p  sn 
   219   98 B L  E     -P  214   0C   1  382   85  .. .vg.  WWlw .fyY  .Wy....v .. . ...s.  t  t . F........T .... .  .t 
   220   99 B V  E     -P  213   0C  12  489   66  .. VVGA  TTTT TTTT  TTTLT..L .. T ...VT  H  H . L.S.T...SV ..T. .  SV 
   221  100 B F  E     -P  212   0C  17  540   30  .L FFSH  FFFF FFFF  FFFFFI.Q LL F YV.FY  r  r . F.I.h...SI ..L. .  YF 
   222  101 B G        -     0   0    1  481   35  .. GGGS  GGGG GGGG  GGG.G..T .K G GE.G.  g  g . ....a...G. ..H. .   . 
   223  102 B G        -     0   0   51  513   58  .. GTVD  GGAE GPSG  GGQSGA.H SA G TA.T.  S  S S .A..S...AQ ..S. .   . 
   224  103 B G        -     0   0    8  528   33  .. GGHT  GGGG GGGG  GGGAGA.G GP G  G.EH  G  G D .G..A...GG ..G. .   Q 
   225  104 B T  E     - O   0 209C   0  550   33  .D TTLT  TTTT TTTT  TTTVTV.E  T T   .TS  T  T T .S..S...ST ..A. .   T 
   226  105 B K  E     -kO 130 208C  82  547   67  .A KMQ   KKNK KRKK  KSKEKD.S  V R   .KG  K  K H . ..N..LTT .. . .   Q 
   227  106 B L  E     -kO 131 207C   0  546   44  .H LVL   LLVV LVLL  LLLPLPLI  L V   . L         . V.K.PLLK .. L .   G 
   228  107 B T  E     -k  132   0C  34  614   65  .T TTT   EEEE EDEE  EEESESSP  Q E   T S         . TTNTTTTT T. T T   E 
   229  108 B V  E     -k  133   0C   3  593   35  .V VVA   IIII IVII  IIISIIAT  A I   V S         . VVLVVVIF V. V V   V 
   230  109 B L              0   0  120  399   31  LL LLL                 L LLL  Y     I L         L LLLLLL M LL L I     
   231  110 B G              0   0   62  207   39  S   GG                 S   G  G       G         G           S   P     
## ALIGNMENTS 1611 - 1680
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 A E              0   0  185  771   30    EE         Q                EEEEK   QE EE     QQ   E   D        Q  Q
     2    2 A V        +     0   0   18  834   19    VV         L                EEEEV   II VV     VI   V   V        V  V
     3    3 A Q  E     -A   25   0A  90  836   34    QQ         Q                KKRKQ   TR QT     RT   K   Q        Q  Q
     4    4 A L  E     -A   24   0A  13  881    3  VVLL LL      L                VLLLL   LL LV     LL   L   L      MLL  L
     5    5 A Q  E     -A   23   0A 107  882   70  EKLV TT      Q                VVVVV   DS QS     QE   L   V      VQQ  Q
     6    6 A Q  E     -A   22   0A  14  887   31  EEEE EQ      E                EEEEE   QQ EL     EE   E   Q      QEE  Q
     7    7 A S        -     0   0   33  892   13  SSSS SS      S                SSSSS   PK SS     SS  SS   Q      QSS  W
     8    8 A G        -     0   0   52  907   11  GEGG EE      G                GGGGG   GA GV     GG  GG   K      KGG  G
     9    9 A A        -     0   0   80 1179   51  GGGG PP      P                GGGGG   SS PP P   PP  SG   S      SPP  T
    10   10 A E  E     -d  116   0B  68 1189   46  RGGA AA      G                GGGGG   AEGGE G   SG  GG   E      KGG  G
    11   11 A L  E     +d  117   0B 130 1195   22  LLLL VI      A                LLLLS   VILIL L   LI  LL   T      TTL  L
    12   12 A V  E     -d  118   0B  28 1197   47  VFVV KK      V                VVVVV   VAVLV V   VL  LV   A      SVV  V
    13   13 A K    >   -     0   0  145 1201   50  TKQQ RR      K                QEQQQ   NNKKK EE  KQ  QQ   K      KRK  K
    14   14 A P  T 3  S+     0   0   70 1203    8  PPPP PP      P                PPPPP   PVPPP PP  PP  PP   Y      YPP  P
    15   15 A G  T 3  S+     0   0   59 1209   28  TTGG GG      G                GGGGK   SGSSS SS  SS  SG   G      GSS  S
    16   16 A A    <   -     0   0   36 1213   63  PDGG EE      E                GGGGG   GAQQE QQ  QQ  QG   G      EEQ  E
    17   17 A S        -     0   0   66 1210   29  GTSS SS      T                SSSSS   TSTTK TT  TT  TS   N      YST  T
    18   18 A V  E     - B   0  83A  10 1213   32  LLLG HH      L                LLLLL   LILLL LL  LL  LL   I      VLL  L
    19   19 A K  E     - B   0  82A 119 1211   53  TTRR RT      T                RRRRK   KLSSK SS  SS  SR   K      KRS  S
    20   20 A L  E     - B   0  81A   0 1214   21  LLLL LL      L                LLLLL   LLLLL LL  RL  LL   L      LLL  L
    21   21 A S  E     - B   0  80A  31 1215   35  TTSS TT      T                SSSAS   SETTV TT  TT  TS   Q      WTT  T
    22   22 A a  E     -AB   6  79A   0 1216    0  CCCC CC      C                CCCCC   CCCCC CC  CC  CC   C      CCC  C
    23   23 A K  E     -AB   5  78A 113 1216   70  TTAA TT      S                VVVVA   KEASK VA  TS  TA   E      ATA  A
    24   24 A A  E     +A    4   0A   2 1216   49  VVAA AA      V                GGGGA   VVIFV II  VF  VA   T      AVI  V
    25   25 A S  E     +A    3   0A  49 1216   12  SSSS SS      T                SSSSS   SSSSS SS  SS  SS   S      SSS  S
    26   26 A G  S    S+     0   0   56 1215    3  GGGG GG      G                GGGGG   VGGGG GG  GG  GG   G      GGG  G
    27   27 A Y  S    S-     0   0   39 1216   33  FFFF FF      G                FFLFL   SYDFA DD  FF  FF   Y      YFD  H
    28   28 A T    >   -     0   0   90 1216   52  SSST TS      T                TRDRT   VNSSL SS  SS  ST   T      KES  S
    29   29 A F  G >  S+     0   0   13 1216   27  LLFF FF      V                FFFNF   SIVLI VV  LL  LF   F      FLV  I
    30   30 A T  G 3  S+     0   0   40 1216   55  SSSS SS      T                SSSIT   SNSST SS  TS  TA   T      TTS  T
    31   31 A S  G <  S+     0   0   23 1216   57  SStt SG      g                tGdNT   Qdstd tt  ss  SD   G      DSs  s
    32   32 A Y  E <  S-E  100   0B  40 1139   28  YYyf YY      y                yYf.Y   Hyami st  .m  .F   Y      YYa  c
    33   33 A W  E     -E   99   0B  40 1148   92  DT.. YW      Y                .P.VD   ...Ga aa  aS  .Y   L      NHT  .
    34   34 A M  E     -EF  98  51B   0 1206   49  MV.. MM      W                II.II   W..VV WW  VV  .M   L      LMW  W
    35   35 A H  E     -EF  97  50B   0 1212   72  GA.. AA      H                NGSNS   A.AGN SN  NG  NS   A      AHN  H
    36   36 A W  E     -EF  96  49B   0 1216    0  WWWW WW      W                WWWWW   WWWWY WW  WW  SW   W      WWW  W
    37   37 A V  E     -EF  95  47B   0 1216   17  VVVV VV      I                VVVIL   IVnII IF  VI  vI   L      LII  I
    38   38 A K  E     -EF  94  46B   7 1216   22  RRRR RR      R                RRRRQ   WRrRR RR  RR  cR   K      KRR  R
    39   39 A Q  E     +EF  93  45B  20 1216    5  QQQQ QQ      Q                QQQQQ   QQPQQ QQ  QQ  QQ   H      HQQ  Q
    40   40 A R    >   -     0   0   35 1216   71  AAAA AA      A                ASAAS   AAVPF SS  AP  PS   V      VPS  A
    41   41 A P  T 3  S+     0   0  130 1215   15  PPPP PA      P                PPPPP   PPPSS PP  PS  PP   P      PPP  L
    42   42 A G  T 3  S+     0   0   83 1216   22  GGGG GG      G                GGGGG   GGSGG SS  GG  GG   G      GGS  G
    43   43 A R  S <  S-     0   0  156 1216   43  KZKK KK      Q                KRKKK   KARKS RR  KK  KK   K      KKR  K
    44   44 A G        -     0   0   16 1215   36  GGGG AT      G                GGGGG   GgGGT GG  AG  GA   E      DGG  G
    45   45 A L  E     -F   39   0B   8 1215   10  LLLL LL      L                LPLLL   LlLLF LL  LL  LP   I      ILL  L
    46   46 A E  E     -F   38   0B  34 1216    6  EEEE EE      E                EEEEE   EEEEE EE  EE  EE   L      LEE  E
    47   47 A W  E     -F   37   0B   3 1216   10  WWWW WW      W                WWWWW   YWWWF WW  WW  WW   Y      YWW  W
    48   48 A I  E     -     0   0B   0 1215   31  IIVV IV      M                LLLLV   ILLLL LL  VL  ML   I      IIL  M
    49   49 A G  E     -FG  36  60B   0 1216   35  GGAE AA      G                AAAAA   GAGAA GG  GA  GS   G      GGG  G
    50   50 A R  E     -FG  35  59B  32 1216   94  IIWf RT      L                AMSTA   YArHH rr  AH  VF   Y      YVr  C
    51   51 A I  E     -FG  34  58B   0 1207   17  ILKv IL      .                IIMFV   LFtII ly  VI  II   I      IAy  I
    52   52 A D     >  -     0   0   26 1212   86  YKYQ TD      W                SQGNR   HRYWN YY  HW  WR   N      NYY  C
    53   53 A P  T  4 S+     0   0    0 1212   83  ASQG NS      S                TSRSR   STRWY RR  TW  GN   P      PAR  S
    54   54 A N  T  4 S-     0   0   96 1213   69  SSES SG      D                SSSGK   DGSDE SS  DN  GK   D      HGS  D
    55   55 A G  T  4 S-     0   0   69 1216   57  GGAA Gs      Y                AgGGS   MYKDA KK  GD  Ga   S      SGK  G
    56   56 A G     <  +     0   0   25  915   61  ..S. Ss      .                Dq.G.   ..W.. WW  ..  .y   .      G.W  .
    57   57 A G        -     0   0   43 1195   77  SSNI SS      .                SEGG.   RTYDG YY  TD  ST   G      SGY  S
    58   58 A T  E     -G   51   0B  62 1209   46  TTSS TK      T                ATTT.   STNKT YN  TK  TT   G      TAN  T
    59   59 A K  E     -G   50   0B  89 1212   88  YYHH WY      S                DKYF.   FYDYA ED  RY  DE   T      WDD  N
    60   60 A Y  E     -G   49   0B  46 1215    9  YYFY YY      Y                YYYYY   PIYYL YY  YY  YY   W      YIY  Y
    61   61 A N    >>  -     0   0   12 1216   63  AAAA SS      N                ASAAN   AAANN AA  NN  NN   Y      PAA  S
    62   62 A E  G >4 S+     0   0  148 1216   64  SSDD QQ      P                ADDDY   PEVPP EV  PP  SP   S      VDQ  P
    63   63 A K  G 34 S+     0   0  109 1216   64  WWTS SS      S                DSSSV   SGSSD SS  AA  AS   F      SSS  S
    64   64 A F  G X> S+     0   0    5 1216   45  AAVV VV      L                FVVVT   FFVLL VV  LL  LV   R      LLV  L
    65   65 A K  T << S+     0   0  156 1216   40  KKNQ QQ      Q                VRKKY   QKKKK KR  KK  KK   G      RKQ  K
    66   66 A S  T 34 S+     0   0  108 1216   35  GSGA GG      G                rGGGY   SDSSS SS  SS  SG   G      gNN  S
    67   67 A K  T <4 S+     0   0   33 1214   21  RRRR RR      R                rRRRA   RRRQR RR  RR  RR   K      kRR  R
    68   68 A A  E  <  -C   83   0A   2 1216   69  FSFF FF      I                FFFFF   VVILL II  LL  LF   F      FVI  T
    69   69 A T  E     -C   82   0A  58 1216   37  TTTT TT      A                TTTTT   TTTTT TT  ST  ST   T      TTS  S
    70   70 A L  E     +C   81   0A   7 1216   27  IIII II      I                FIIIT   FPIIW FI  IV  II   I      III  I
    71   71 A T  E     -C   80   0A  57 1213   47  STSS SS      T                SSSSS   TSNSS NN  TS  SS   T      TTN  S
    72   72 A V  E     -C   79   0A  28 1216   71  KRRR RR      V                KRSKR   RTPKR PP  RK  RR   V      AKP  R
    73   73 A D  E   > -C   78   0A  69 1216    7  TTNN DD      D                DDDVD   DSDDD DD  DD  DD   N      NDD  V
    74   74 A K  T > 5S+     0   0  105 1216   62  SQDD NN      S                DNDDD   AGTTT TT  TS  TD   A      NNT  T
    75   75 A P  T 3 5S+     0   0  122 1215   37  TNSS NS      S                SSSSS   SSSSA SS  SS  ST   R      AGS  S
    76   76 A S  T 3 5S-     0   0   37 1216   65  TTKK RK      S                QQQQQ   KTKRK KK  KD  KQ   S      EKK  K
    77   77 A S  T < 5 +     0   0   24 1216   48  VVNN QQ      T                NGNNS   NANNN NN  SN  SN   T      SKN  N
    78   78 A T  E   < -BC  23  73A   8 1216   64  DNTT QQ      K                TTTTI   EQQQE QQ  QQ  LV   G      TQQ  Q
    79   79 A A  E     -BC  22  72A   0 1207   67  ..LL LL      Y                ASVAV   I.FVA FF  LV  VL   .      GVF  F
    80   80 A Y  E     -BC  21  71A  61 1209   36  ..YY YY      Y                YYFYY   H.SFY SS  SF  FY   Y      YYS  S
    81   81 A M  E     -BC  20  70A   0 1212    9  ..LL LL      L                LLLLL   LLLLL LL  LL  LL   L      LLL  L
    82   82 A Q  E     -BC  19  69A  69 1215   43  LLQQ QQ      R                QQQQQ   QRQKE QQ  SK  KQ   Q      YQQ  Q
    83   83 A L  E     -BC  18  68A   0 1215   14  KMMM MM      L                MMMMM   IILII LL  VI  MM   I      IML  L
    84   84 A S        +     0   0   32 1215   56  TBNN NN      S                DNNNN   TNNTS NN  SA  NN   N      DNN  S
    85   85 A S  S    S-     0   0   89 1216   25  SSRT SS      S                SNSSN   SRSSG SS  TS  ST   N      NGS  S
    86   86 A L        +     0   0    2 1216   15  LLLG LL      L                LLLLL   MLVVM VV  VV  LL   V      AMV  V
    87   87 A T    >   -     0   0   61 1215   68  PTEE KR      T                RRRRK   KSTDT TI  RV  QR   D      DET  T
    88   88 A S  G >  S+     0   0   72 1216   59  TAAA TT      A                TSTTT   SSPTA PP  TT  TA   F      FVP  T
    89   89 A E  G 3  S+     0   0  107 1216   21  EZZZ EE      A                EEEEE   ASEAG EE  DA  EE   E      EKE  E
    90   90 A D  G <  S+     0   0    7 1216    3  DDBB DD      D                DEDDE   DDDDD DD  DD  DD   D      DDD  D
    91   91 A S    <   +     0   0   31 1216   34  TTTT SS      T                TSTTT   STTTT TT  TT  TT   S      STM  T
    92   92 A A  E    S- H   0 116B  10 1214    5  AAAA AA      A                AAAAA   GAAAA XA  AA  AA   A      AAA  A
    93   93 A V  E     -EH  39 115B  21 1216   48  TTVV VV      T                RRRHM   TTVTM VV  TT  II   V      VMV  M
    94   94 A Y  E     -EH  38 114B   0 1216    1  YYYY YY      Y                YYYYY   YYYYY YY  YY  YY   F      YYY  Y
    95   95 A Y  E     -E   37   0B   1 1216    3  FFYY YY      F                FYYYY   YYYYY YY  YY  YY   Y      YYY  Y
    96   96 A a  E     +E   36   0B   0 1216    1  CCCC CC      C                CCCCC   CCCCC CC  CY  CC   C      CCC  C
    97   97 A A  E     -EI  35 110B   0 1215   24  AAAA AA      A                TVATA   AAAAA VA  TA  TA   A      AAA  A
    98   98 A R  E     -E   34   0B  13 1196   38  RRRR RR      R                RRRKS   RRSRS RR  MR  RK   R      RRR  R
    99   99 A M  E     -EI  33 107B   5 1101   82  QIFT EE      H                GGGKA   GSTRG GD  SI  DH   E      EYD  D
   100  100 A W  E >   -E   32   0B  89 1101   89  gTrr lL      t                PlVSH   vRtGY aM  AP  Te   A      Att  t
   101  101 A Y  T 3  S+     0   0  112  572   91  .H.. m.      e                .l..C   ..w.. ..  C.  ..   .      .ts  g
   102  102 A Y  T 3  S-     0   0  133  629   92  .G.. T.      A                .S..I   ..G.. ..  G.  ..   .      .NQ  V
   103  103 A G  S <  S+     0   0   38  705   79  .y.. F.      g                .syww   ..Y.. ..  y.  ..   .      hfw  G
   104  104 A T        -     0   0   32  784   66  ggpg g.      g                psgg.   gGeg. .g  gG  .s   H      g..  g
   105  105 A Y        +     0   0   81  679   93  a.qy a.      d                pyv.h   .Sdg. ps  ..  .t   .      tfa  r
   106  106 A Y        -     0   0   32  842   66  FLFF ff      T                fecgL   YYAA. Ty  Cf  .A   .      AyF  Y
   107  107 A F  E     +I   99   0B   0  885   48  VMFS lf      .                lmvmM   FFFMF Ff  If  LV   .      .w.  .
   108  108 A D  E     +     0   0B  25  997   46  DDDD SL      .                DSDDS   DDDDA DH  VD  RK   F      LTD  .
   109  109 A Y  E     -J  168   0C 108 1059   61  VVVV TG      .                LFLLF   YYIYY FY  NY  YM   H      VFF  I
   110  110 A W  E     -I   97   0B  23 1092    2  WWFW WW      W                WWWWW   WWWWW WW  WW  NW   W      FWW  W
   111  111 A G        -     0   0    3 1067   15  GGGG AN      E                GGGG    GGGGG GG  GG  GG   S      GSG  G
   112  112 A Q        -     0   0  141 1047   41  PPQQ GD      Q                PPPP    PPQQQ QQ  PQ  HL   D      N Q  R
   113  113 A G        -     0   0   20 1013   12  GGGG SR      A                GGGG    GGGGG GG  GG  NG   A      G G  T
   114  114 A T  E     - H   0  94B   2  996   31  TTTT ST      S                VVVI    TTTTT TT  LT  TK   L      T L  G
   115  115 A T  E     - H   0  93B  60  979   76  LLLL  L                       EEEE    MMMSM LL  LT  LI   T      K R  L
   116  116 A L  E     -dH  10  92B   1  972   19  VVVV                          VVVV    VVVVV VV  LL  LI   F      L V  S
   117  117 A T  E     -d   11   0B  57  953   21  TTTS                          VFVV    TTTTT TT  TT       G      I T  A
   118  118 A V  E     +d   12   0B   4  935    8  VV                            VVVV    VVVVV VV  VV       T      V V  I
   119  119 A S              0   0   64  917   10  SS                            SSSS    TTSST SS  SS       G      E S  S
   120  120 A S              0   0  122  885   21                                SS P    SSSSS SS  SS       T      P S  A
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32      Q  QD Q E DD  DDDEDDDDDEQQ     QQE     D  DD  DD  DDQ EQQQDE    Q 
   123    2 B A        -     0   0   19  713   70      V  II SAI II  IVIIIIIIVISP     SPI     I  II  VI  IIS ISPIII    A 
   124    3 B V        -     0   0   84  765   49      T  TTVVVV VV  QQVVVVVQQVVV     GVV     Q  QV  VQ  VVV VVVVVV    A 
   125    4 B V  E     -Q  145   0D  10  820   26      V  VMLLLL MMM MMMLLLMMMLLL     PLL     M  LM  MM  LML MLLLMM    L 
   126    5 B T  E     +Q  144   0D  69  829   11      T  TTTTTT TTTTTTTTTTTTITTT     NTT     T  TT  ST  TTT TTTTTT    T 
   127    6 B Q  E     -Q  143   0D  18  832    2      Q  QQQQPQ QQQQQQQQQQQQQQQQ     QQQ     Q  QQ  QQ  QQQ QQQQQQ   DQ 
   128    7 B E        -     0   0   59  833   63      P  PSPPLS TTSTSSSSSSSTSSPP     PPS     S  SS  SS  SSP SPPSSS   SL 
   129    8 B S  S    S+     0   0  101  841   38      P  GPSTPP PPPPPPPPPPPPPPAP     SPP     P  PP  PP  PPP PPTPPP   AV 
   130    9 B A  E     -k  226   0C  59  842   50      V  ATSSSA AASASSTGAADSSASS     SSA     S  SL  SS  VSS ASSDDA   SS 
   131   10 B L  E     -k  227   0C  57  847   76      L  VSVVVT SSSSSSFTSSSSSIVL     VLT     F  SS  FL  LSA TALYST   FV 
   132   11 B T  E     +k  228   0C  84  848   77      T  SLSSSL VVLVVLLLLLLLLTSS     SSL     L  LL  LL  ALS LSSVLL   SP 
   133   12 B T  E     -k  229   0C  18  848   68      S  SSVGAS SSSESSASAAASSAGA     GAS     S  AP  AS  VAG SGASAS   VA 
   134   13 B S    >   -     0   0   55  849   70      T  AkTSAl aeavaavlvvvaaaSS     ASl     a  mv  va  SvA lASvvl   rN 
   135   14 B P  T 3  S+     0   0   61  848   65      P  VqPLLp vvvvvvapllllllLP     LPp     v  vp  vv  LaP pPPplp   lP 
   136   15 B G  T 3  S+     0   0   46  850    7      G  GGGGGG GGGGGGSGGGGGGGGG     GGG     G  GG  GG  GGG GGGGGG   GG 
   137   16 B E    <   -     0   0  108  850   56      S  GEQQQE GGDGDDKEQQEDDQQA     QTE     D  QE  ED  QEQ EQAEQE   QE 
   138   17 B T  E     - R   0 199D  88  850   66      T  TTTRTR TTRTRRKRRRRRIKRT     RTR     R  KP  KR  RTS RSSTRR   TT 
   139   18 B V  E     - R   0 198D  14  850   33      V  VVAVVA VVVVVVVAAAAVVVVA     VAA     V  VA  VV  AVV AVAAVA   VV 
   140   19 B T  E     - R   0 197D  53  849   41      T  NTRTTT TTTTTITTTTTTTTTR     TRT     T  TS  TT  TTT TTRTET   TK 
   141   20 B L  E     - R   0 196D   0  849   25      L  IIIIIV IIIIIIILIIIIMIIF     ILL     I  MI  ML  III LILLML   II 
   142   21 B T  E     - R   0 195D  22  849   52      T  KRTSSS NKTKTTSSSSNSTTST     STS     T  SS  SS  SNS SSTTKS   ST 
   143   22 B b  E     -QR 127 194D   0  850    2      C  CCCCCC CCCCCCCCCCCCCCCC     CCC     C  CC  CC  CCC CCCCCC   CC 
   144   23 B R  E     -Q  126   0D 133  850   77      R  RQESTR QQRQRRTRRRKRQSTT     TTR     R  KR  KK  RKS RSTKKR   TS 
   145   24 B S  E >   -QS 125 148D  11  850   68      T  TAGGGA ATAAAAAAAASAAARL     GLA     A  SS  SA  ASG AGLAAA   GG 
   146   25 B S  T 3  S+     0   0   81  850   27      S  SSNSNS SSGSSSSASSSSSSSS     VSS     S  SS  SS  SSS SSRSSS   TS 
   147   26 B T  T 3  S-     0   0   87  850   71      P  QQSTSQ QQQQQQELEEQQQSSS     GRQ     Q  QQ  QQ  QQS QSSSQQ   SS 
   148   27 B G  B <  S+S  145   0D  39  850   55      A  DGinTS NSSSDSsLssSDGsSG     SDS     G  Ss  sN  sSS SSGSSS   NG 
   149   28 B A        -     0   0   40  390   77      .  ..sgQ. ......s.nn....N.     ...     .  .l  l.  s.N .N....   D. 
   150   29 B V        -     0   0    3  620   45      v  V.VII. ......S.YYv...vL     .I.     .  lH  Yi  IlI VII...   I. 
   151   30 B T    >   -     0   0   56  541   72      d  Y...G. ......K.GGs...dN     .S.     .  sS  S.  SgG SGS...   G. 
   152   31 B T  G >  S+     0   0   94  694   78      D  SI.VSV IIVII.HSIINIT.VV     .VV     I  NN  S.  SNS SSVTVV   S. 
   153   32 B S  G 3  S+     0   0   84  802   62      g  SS.GGS DDNSSsksSSnNN.Gg     .gS     S  qg  n.  IqN SNgSSS   Y. 
   154   33 B N  G <  S-     0   0   13  673   73      d  NN..YN SDKTHdhg..nNIs.y     .kN     S  nn  nk  Nn. ..y.NS   N. 
   155   34 B Y    <   -     0   0   98  781   50      A  CY..AY WYYYWYYYFFYYNS.R     YYY     N  YY  YY  LYY .YRYYS   AS 
   156   35 B A        -     0   0    0  817   59      M  LL.AVL LLLLLLLLMMLLLL.I     MML     F  LL  LL  MLV LVIILL   VY 
   157   36 B N  E     -L  212   0C   0  827   79      Y  ANYSQA ASNSANAANNANNH.N     DHA     A  AH  AN  HAY AYFADA   SG 
   158   37 B W  E     -LM 211 171C   0  849    0      W  WWWWWW WWWWWWWWWWWWWWWW     WWW     W  WW  WW  WWW WWWWWW   WW 
   159   38 B V  E     -LM 210 169C   0  849   25      Y  YYYYYY YYYYYYYYFFYYFYYH     YYY     Y  YY  YY  YYY YYYYYY   HF 
   160   39 B Q  E     -LM 209 168C  10  849   10      Q  QQQQQQ QQQQQQQQQQQRQQQQ     QQQ     Q  QL  QQ  QQQ QQQQQQ   QQ 
   161   40 B E  E     -LM 208 167C  20  849    8      Q  QQQQQQ QQQQQQKQQQQQQQQQ     QQQ     Q  QQ  QQ  QQQ QQQQQQ   QQ 
   162   41 B K  E  >  - M   0 166C  68  849   50      K  KKKLLK KKKKKKKKKKKKKKLK     IKK     K  KK  KK  KKL KLKKKK   Yk 
   163   42 B P  T  4 S+     0   0   98  843   23      S  DPPPPP PPPPSPPPPPPPPSPP     PPP     P  PP  PL  PPS PPPSPP   Pp 
   164   43 B D  T  4 S-     0   0  148  846   16      G  GGAGGG GGGGGGEGGGGDGGGG     GGG     G  GG  GG  GGG GGGGVG   GS 
   165   44 B H  T  4 S+     0   0   90  845   66      Q  GQQKKQ QQKQKKQQQQQGKTTS     MTQ     K  QQ  QE  QQK QTSQKQ   MS 
   166   45 B L  E  <  - M   0 162C  92  846   57      A  VAAASS PPARAASAPPPTASGP     APV     A  SS  SA  QSA AAPAAA   AA 
   167   46 B F  E     + M   0 161C   9  847   19      P  PPPPPP PPPPPPPPPPPVPPPl     PpP     P  PP  PP  PPP PPpPPP   PP 
   168   47 B T  E     -JM 109 160C  56  843   61      K  KKVKER KKKKKKKRKKKKKKRn     KyR     K  KR  KK  KKK KKyKKR   KV 
   169   48 B G  E     + M   0 159C   1  848   64      L  LLLLTL VGVLLLLLLLLLLPTY     TLL     L  LL  LL  LLL LLLLLL   TT 
   170   49 B L  E     +     0   0C   4  848   24      L  LLVLIL LLLLLLLLLLLLLWIH     ILL     L  LL  LL  LLL LLLLLL   LV 
   171   50 B I  E     +NM 177 158C   0  848   19      I  IIIVII IIIIIIIMIIIIIIIT     IYI     I  LI  II  III IINIII   II 
   172   51 B G  E  >  +N  176   0C   0  849   33      K  YYYYYY YYFYYFYYYYYYYYYD     YYY     Y  YY  YY  YYY YYYYYY   YY 
   173   52 B G  T  4 S-     0   0    9  848   87      W  YYRSGD RRARSDGGAAWYGENS     GYR     A  FL  WN  RLN GYHWAG   RW 
   174   53 B T  T  4 S+     0   0    9  849   68      A  ATDDDA TAAAATAAAAATAITD     NsA     A  AG  AT  AAN AStVAA   VD 
   175   54 B N  T  4 S+     0   0  102  841   49      K  SNSGSS SSSSSSSSSSSSSSNK     StS     S  SS  SN  SSN SNsSSS   ND 
   176   55 B N  E  <  -N  172   0C  77  849   69      T  SSNDNN TTSTSNNSNNTRIKTG     NQN     T  TN  TN  NTQ SQDTSS   NE 
   177   56 B R  E     -N  171   0C 113  850   66      L  RLRRRR LLLLLLRRQQRLLLRQ     RLR     L  RR  RL  LRR RRKRRR   RR 
   178   57 B A    >   -     0   0    1  849   73      E  VQPPPA AAKAEQYAGGEHEAPG     HGT     Q  EA  EQ  AEP APHHAA   PP 
   179   58 B P  T 3  S+     0   0   97  849   39      S  SSSSST SSSSNSITSSSSASSS     SPT     S  SS  ST  SSS TSQTST   SS 
   180   59 B G  T 3  S+     0   0   83  850   18      G  GGGGGG GGGGGGGGGGGGGGGG     GGG     G  GG  GG  GGG GGgGGG   GN 
   181   60 B V  S <  S-     0   0   13  848   23      T  IVIVVI VVVVVVVIVVVVVVVV     VII     V  VV  VI  IVV IVvTVI   II 
   182   61 B P    >   -     0   0   57  850    9      P  PPSPPP PPPSPPPPPPPPPPPP     PPP     P  PP  PP  PPP PPPPPP   PP 
   183   62 B A  T 3  S+     0   0   77  850   59      S  ASDDDA SSSSSSDDAADSSADS     DSD     S  DD  DS  ADD DDSEDD   DS 
   184   63 B R  T 3  S+     0   0   58  850    5      R  RRRRRR RRRRRRRRRRRRRRRR     RRR     R  RR  RR  RRR GRRRRR   RR 
   185   64 B F  E <   +T  198   0D   4  850    1      F  FFFFFF FFFFFFFFFFFFFFFF     FFF     F  FF  FF  FFF FFFIFF   FF 
   186   65 B S  E     -T  197   0D  51  849   17      S  TSSSSS KRSKSSTSSSSSSSSS     SSS     S  IS  TS  SIS SSSSSS   SS 
   187   66 B G  E     +T  196   0D   9  850    4      G  GGGGGG GGGGGGGGGGGGGGGG     GGG     G  GG  GG  GGG GGGGGG   GG 
   188   67 B S  E     -T  195   0D  41  850    7      S  SSSSFS SSSSSGSSSSSSRSSs     SsS     S  SS  SS  SSS SSsSSS   SS 
   189   68 B L  E     -T  194   0D  59  835   79      G  GGNNSG RGGGGRGGGGGGRGKa     KtG     G  GG  GG  GGK GKaGGG   KT 
   190   69 B I  E >   -T  193   0D  86  842   31      S  SSSSFS SSSSSSSSSSSSYSSS     SSS     F  SS  SS  SSS SSSSSS   SS 
   191   70 B G  T 3  S-     0   0   67  850   18      S  NGGGGG GGGGGGGGGGGGGGGA     GAG     G  GG  GG  GGG GGAGGG   GG 
   192   71 B N  T 3  S+     0   0  105  828   57      S  STNNNT TTTTTTTTTTTTTTSN     SNT     T  TT  TT  TTT TTNTTT   NS 
   193   72 B K  E <  S- T   0 190D  68  833   67      D  DDTSSD EDDEEDDDDDDDDSTA     SAD     E  DD  DD  DDS ESADDE   TT 
   194   73 B A  E     -RT 143 189D   0  838   81      F  FYADAF FFFFFFFFFFFYFYAG     GGF     F  FF  FY  FFA FAGFFF   AS 
   195   74 B A  E     -RT 142 188D   0  849   57      S  TSTTTT TTTTTTTTSSTSTSTL     TIT     T  AT  TT  TTS TSITTT   ST 
   196   75 B L  E     -RT 141 187D   0  850    2      M  LLLLLL LLLLLLLLLLLLLLLL     LLL     L  LL  LL  LLL LLLLLL   LL 
   197   76 B T  E     -RT 140 186D  19  850   33      T  TTTTAT TTTTTTTTNNTTTTTL     TLT     T  TK  TT  TTA TALTTT   TT 
   198   77 B I  E     -RT 139 185D   0  849    5      I  IIIIII IIIIIIIIIIIIIIII     III     I  II  II  III IIIIII   II 
   199   78 B T  E    S+R  138   0D  78  850   46      N  SSSTTS SSSSSSSSHHSSSNSS     TSS     S  RS  SS  DSS STSSSS   ST 
   200   79 B G  S    S-     0   0   15  850   57      G  GSGGGS DDGGSSSRPPSNSTGG     GGR     S  SR  SS  PSG SGGRSS   GG 
   201   80 B A        -     0   0    0  849   51      V  VLALLL LLLVLLVLMMLLLMLL     LLL     L  VV  VL  VVL LLLMLL   LV 
   202   81 B Q    >   -     0   0   80  849   32      Q  QEQQQE EELEQQQEEEQEEEQQ     QQD     Q  QE  KQ  QQQ ERQEQE   QQ 
   203   82 B T  G >  S+     0   0   84  850   59      A  APAADP CCPCPPVPEEAQDAAP     APP     P  AA  AP  AAS PSSAAP   AA 
   204   83 B E  G 3  S+     0   0   99  850   17      E  EEGEEE AAEAEDEEDDEEEEEE     EEE     E  ED  EE  DEE EEEEEE   EE 
   205   84 B D  G <   +     0   0    1  850    2      D  DDDDDD DDDDDDDDDDDDDDDD     DDD     D  DD  DD  DDD DDDDDD   DD 
   206   85 B E    <   +     0   0   71  849   74      A  AFEEEF AAFAFFLFTTVIMAEE     EEF     F  LV  LV  ILE VEEAVF   EE 
   207   86 B A  E    S- O   0 227C   3  850   14      A  AAAAAA AAAAAATAAAASAAAA     AAA     A  AG  AA  AAA GAAGAA   AA 
   208   87 B I  E     -LO 161 226C  55  850   71      V  VTDDDV TTTTTTHVMMVTTIDD     DDV     T  DI  VT  ADD VDDDVV   EV 
   209   88 B Y  E     -LO 160 225C   0  850    0      Y  YYYYYY YYYYYYYYYYYYYYYY     YYY     Y  YY  YY  YYY YYYYYY   YY 
   210   89 B F  E     -L  159   0C   5  848    8      Y  YYYYYY YYYYFYYYFFYFFYYY     YYY     Y  FY  YF  YYY YYYYSY   YY 
   211   90 B b  E     -L  158   0C   0  849    1      C  CCCCCC CCCCCCCCCCCCCCCC     CCC     C  CC  CC  CCC CCCCCC   CC 
   212   91 B A  E     -LP 157 221C   0  848   73      Q  QQQQQQ QQQQQQAQQQQQLQSL     SAQ     Q  QM  QL  QQA QAMQQQ   AG 
   213   92 B L  E     - P   0 220C   0  845   83      S  SQVSSQ SSQQQQQQQQQQQQSI     SVQ     Q  QQ  QQ  QQA QAIYQQ   SS 
   214   93 B W  E     + P   0 219C  21  834   71      Y  FGWFLY YTSGASFYSSYGHWYW     WWY     L  HA  YH  SHW DWWHRY   YY 
   215   94 B Y  E >  S- P   0 218C  33  829   88      H  HIDDDN YYYWHYYGKKDNSTDY     YHG     N  YL  YS  RYD YDHGYS   RD 
   216   95 B S  T 3  S-     0   0  106  829   66      E  YSNTDN SGTSSTSSEETAYYSN     SSS     S  TQ  SS  ESS SNNGSN   SS 
   217   96 B N  T 3  S+     0   0  105  824   81      i  pfpTNq iVTsVNYsVvIlLpSn     sgs     f  TS  yr  syS wSnTsw   GR 
   218   97 B H  E <   -P  215   0C  39  647   66      s  qph..p ..PnPpPrPpPrP..p     shp     r  PP  ph  pp. p.sPph   N. 
   219   98 B L  E     -P  214   0C   1  382   85      w  D.t... s.YnLvL.WY..Yi.      .tT     .  WY  ..  ... .. L..   .. 
   220   99 B V  E     -P  213   0C  12  489   66      V  VTG... AGTVTTTSTTTTTT.      AQV     T  TT  T.  T.. .. T..   T. 
   221  100 B F  E     -P  212   0C  17  540   30      F  FMrLL. FFFFFFFFFFFFFFL      YiI     F  FF  F.  V.. .. H..   Y. 
   222  101 B G        -     0   0    1  481   35      T   Tg.D. GGGGGGGGGGGGGG.      .g.     G  DG  G.  G.. .. R..   .. 
   223  102 B G        -     0   0   51  513   58      H   QS.G. GGPGGGAQGGGGGA.      .S.     Q  GQ  SG  T.. .. G..   .. 
   224  103 B G        -     0   0    8  528   33      H   GE.H. GGGGGGGGGGGGGG.      .G.     G  GG  GD  G.. .. G..   H. 
   225  104 B T  E     - O   0 209C   0  550   33      T   STDT. TTTTTTTTTTTTTTN      .T.     T  TT  TT  N.. .. T..   S. 
   226  105 B K  E     -kO 130 208C  82  547   67      K   RKAV. EEKETTKKKKKKKKA      .NQ     K  KK  KN  K.. .. G..   GS 
   227  106 B L  E     -kO 131 207C   0  546   44          IIHL. VVVVVVLVLLVLLLH      . L     V  LL  LH  L.. .. V..   LV 
   228  107 B T  E     -k  132   0C  34  614   65          G T T VVEVDDEEEEEEEET      T E     E  EE  EN   T. T. STT   SG 
   229  108 B V  E     -k  133   0C   3  593   35          V V V VVMVIILIIIII LV      V I     I  II  II   V. V. QVV   SV 
   230  109 B L              0   0  120  399   31            L I KK K          L      L                   LL IL LLI   L  
   231  110 B G              0   0   62  207   39                GG G                                      S  S          
## ALIGNMENTS 1681 - 1750
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    1 A E              0   0  185  771   30     Q   Q              Q                       Q QE           EQE  Q   
     2    2 A V        +     0   0   18  834   19     V   V              I                       V VE           IVI  I   
     3    3 A Q  E     -A   25   0A  90  836   34     Q   Q              T                       Q TK           LRL  T   
     4    4 A L  E     -A   24   0A  13  881    3     L   L              LL                      L VL           LLL  L   
     5    5 A Q  E     -A   23   0A 107  882   70     Q   R              TI                      Q SV           SVS  K   
     6    6 A Q  E     -A   22   0A  14  887   31     E   E              EQ                      E LE           QEQ  E   
     7    7 A S        -     0   0   33  892   13     S   S              TS                      S SS           KSK  S   
     8    8 A G        -     0   0   52  907   11     G   G              GE                      G VG           AGA  G   
     9    9 A A        -     0   0   80 1179   51     P   P              GS                      P PG           SGS  P   
    10   10 A E  E     -d  116   0B  68 1189   46     G   S              GV                      G EG           ENE  T   
    11   11 A L  E     +d  117   0B 130 1195   22     L   L              AI                      L LL           IVI  L   
    12   12 A V  E     -d  118   0B  28 1197   47     V   V              KK                      V VV           AVA  V   
    13   13 A K    >   -     0   0  145 1201   50     K   K              KR                      K KQ           NQN  K   
    14   14 A P  T 3  S+     0   0   70 1203    8     P   P              PP                      P PP           VSV  P   
    15   15 A G  T 3  S+     0   0   59 1209   28     S   S              GG                      S SG           GGG  T   
    16   16 A A    <   -     0   0   36 1213   63     Q   Q              EE                      Q EG           TMT  Q   
    17   17 A S        -     0   0   66 1210   29     T   T              TS                      T TS           SSS  T   
    18   18 A V  E     - B   0  83A  10 1213   32     L   L              LH                      L LL           ILI  L   
    19   19 A K  E     - B   0  82A 119 1211   53     S   S              DR                      S RR           LRL  T   
    20   20 A L  E     - B   0  81A   0 1214   21     L   L              ML                      L LL           LLL  L   
    21   21 A S  E     - B   0  80A  31 1215   35     T   T              TT                      T AS           ESQ  T   
    22   22 A a  E     -AB   6  79A   0 1216    0     C   C              CC                      C CC           CCC  C   
    23   23 A K  E     -AB   5  78A 113 1216   70     S   T              IT                      T KV           ETE  T   
    24   24 A A  E     +A    4   0A   2 1216   49     V   V              VY                      V VG           VGV  F   
    25   25 A S  E     +A    3   0A  49 1216   12     S   S              SS                      S SS           SSS  S   
    26   26 A G  S    S+     0   0   56 1215    3     G   G              GG                      G GG           GGG  G   
    27   27 A Y  S    S-     0   0   39 1216   33     Y   F              FF                      G AF           YFY  F   
    28   28 A T    >   -     0   0   90 1216   52     S   S              SS                      S LD           NSN  S   
    29   29 A F  G >  S+     0   0   13 1216   27     I   L              LS                      V IF           IFI  L   
    30   30 A T  G 3  S+     0   0   40 1216   55     T   S              TD                      T TS           NEN  T   
    31   31 A S  G <  S+     0   0   23 1216   57     s   d              DY                      t dD           DTD  t   
    32   32 A Y  E <  S-E  100   0B  40 1139   28     y   .              Y.                      y iY           HYH  m   
    33   33 A W  E     -E   99   0B  40 1148   92     .   s              GE                      Y aA           HAH  D   
    34   34 A M  E     -EF  98  51B   0 1206   49     W   V              VT                      W VF           MMM  V   
    35   35 A H  E     -EF  97  50B   0 1212   72     S   G              QA                      S DS           NHH  G   
    36   36 A W  E     -EF  96  49B   0 1216    0     W   W              WW                      W FW           WWW  W   
    37   37 A V  E     -EF  95  47B   0 1216   17     I   V              II                      I IV           VVV  I   
    38   38 A K  E     -EF  94  46B   7 1216   22     C   R              RR                      R RR           RRR  R   
    39   39 A Q  E     +EF  93  45B  20 1216    5     Q   Q              QQ                      Q QQ           QQQ  Q   
    40   40 A R    >   -     0   0   35 1216   71     P   A              AA                      P FA           AAA  P   
    41   41 A P  T 3  S+     0   0  130 1215   15     P   P              PA                      P SP           PSP  P   
    42   42 A G  T 3  S+     0   0   83 1216   22     G   G              GG                      G GG           GGG  G   
    43   43 A R  S <  S-     0   0  156 1216   43     K   K              KK                      K SK           AKP  K   
    44   44 A G        -     0   0   16 1215   36     G   A              GG                      G RG           gGg  A   
    45   45 A L  E     -F   39   0B   8 1215   10     L   L              LL                      L FL           iLi  L   
    46   46 A E  E     -F   38   0B  34 1216    6     E   E              EE                      Q EE           EEE  E   
    47   47 A W  E     -F   37   0B   3 1216   10     W   W              WW                      W FW           WWW  W   
    48   48 A I  E     -     0   0B   0 1215   31     I   L              VI                      M LV           LLL  L   
    49   49 A G  E     -FG  36  60B   0 1216   35     G   G              GA                      G AA           AAA  A   
    50   50 A R  E     -FG  35  59B  32 1216   94     I   V              GY                      Y HA           ATA  L   
    51   51 A I  E     -FG  34  58B   0 1207   17     .   I              II                      W II           FIY  I   
    52   52 A D     >  -     0   0   26 1212   86     .   Y              WS                      T NA           RSR  Y   
    53   53 A P  T  4 S+     0   0    0 1212   83     .   S              SS                      G YT           TFS  W   
    54   54 A N  T  4 S-     0   0   96 1213   69     .   G              GG                      S AS           GDD  D   
    55   55 A G  T  4 S-     0   0   69 1216   57     t   G              GS                      T Qe           YGT  D   
    56   56 A G     <  +     0   0   25  915   61     g   .              .G                      . .g           .G.  .   
    57   57 A G        -     0   0   43 1195   77     R   S              SS                      . GS           TS.  D   
    58   58 A T  E     -G   51   0B  62 1209   46     T   T              TI                      . TT           TKT  K   
    59   59 A K  E     -G   50   0B  89 1212   88     Y   G              YY                      R AY           HIY  R   
    60   60 A Y  E     -G   49   0B  46 1215    9     Y   Y              YY                      Y LY           IYI  Y   
    61   61 A N    >>  -     0   0   12 1216   63     S   N              NS                      N NA           SAS  S   
    62   62 A E  G >4 S+     0   0  148 1216   64     P   P              SE                      P SD           ERE  P   
    63   63 A K  G 34 S+     0   0  109 1216   64     S   A              AS                      A AS           SSS  S   
    64   64 A F  G X> S+     0   0    5 1216   45     L   L              LF                      F LV           FVF  L   
    65   65 A K  T << S+     0   0  156 1216   40     K   K              QR                      Q KK           KKK  K   
    66   66 A S  T 34 S+     0   0  108 1216   35     S   S              NG                      G SG           DGE  S   
    67   67 A K  T <4 S+     0   0   33 1214   21     R   R              RR                      R RR           RRR  R   
    68   68 A A  E  <  -C   83   0A   2 1216   69     T   L              IF                      I LF           VFL  L   
    69   69 A T  E     -C   82   0A  58 1216   37     S   S              RT                      S TT           TVT  T   
    70   70 A L  E     +C   81   0A   7 1216   27     I   I              IT                      I LI           PVP  I   
    71   71 A T  E     -C   80   0A  57 1213   47     S   T              TT                      T SS           SSS  T   
    72   72 A V  E     -C   79   0A  28 1216   71     R   K              RR                      A RS           TRT  K   
    73   73 A D  E   > -C   78   0A  69 1216    7     D   D              DD                      D DD           SDS  D   
    74   74 A K  T > 5S+     0   0  105 1216   62     T   N              TN                      T TD           GNG  T   
    75   75 A P  T 3 5S+     0   0  122 1215   37     S   S              SS                      S AS           STS  S   
    76   76 A S  T 3 5S-     0   0   37 1216   65     K   K              KR                      K RQ           TNT  K   
    77   77 A S  T < 5 +     0   0   24 1216   48     N   S              KK                      N NN           ASA  N   
    78   78 A T  E   < -BC  23  73A   8 1216   64     Q   Q              QQ                      Q EM           QTQ  Q   
    79   79 A A  E     -BC  22  72A   0 1207   67     F   V              VV                      F AV           .L.  V   
    80   80 A Y  E     -BC  21  71A  61 1209   36     S   S              FY                      S YY           .F.  D   
    81   81 A M  E     -BC  20  70A   0 1212    9     L   L              ML                      L LL           LLL  L   
    82   82 A Q  E     -BC  19  69A  69 1215   43     Q   S              QQ                      Q EQ           RQR  T   
    83   83 A L  E     -BC  18  68A   0 1215   14     L   L              LM                      L FM           IMI  M   
    84   84 A S        +     0   0   32 1215   56     S   S              SN                      S RN           NNS  T   
    85   85 A S  S    S-     0   0   89 1216   25     S   S              SS                      S GS           KSK  F   
    86   86 A L        +     0   0    2 1216   15     V   V              LL                      M ML           LLL  M   
    87   87 A T    >   -     0   0   61 1215   68     T   T              KT                      T TR           SRS  D   
    88   88 A S  G >  S+     0   0   72 1216   59     T   T              PT                      T AT           STS  P   
    89   89 A E  G 3  S+     0   0  107 1216   21     E   E              EE                      E EE           SNS  W   
    90   90 A D  G <  S+     0   0    7 1216    3     N   D              DD                      D DD           DDD  D   
    91   91 A S    <   +     0   0   31 1216   34     M   T              TS                      T TT           ITT  T   
    92   92 A A  E    S- H   0 116B  10 1214    5     A   A              AA                      A AA           AAA  A   
    93   93 A V  E     -EH  39 115B  21 1216   48     M   T              VV                      M MR           TTT  T   
    94   94 A Y  E     -EH  38 114B   0 1216    1     Y   Y              YY                      Y YY           YYY  Y   
    95   95 A Y  E     -E   37   0B   1 1216    3     Y   Y              YY                      Y YW           YYY  Y   
    96   96 A a  E     +E   36   0B   0 1216    1     C   C              CC                      C CC           CCC  C   
    97   97 A A  E     -EI  35 110B   0 1215   24     A   A              AA                      G AT           AAT  A   
    98   98 A R  E     -E   34   0B  13 1196   38     R   R              RR                      R KI           RKR  H   
    99   99 A M  E     -EI  33 107B   5 1101   82     D   D              YE                      D DG           GEG  R   
   100  100 A W  E >   -E   32   0B  89 1101   89     t   t              tP                      t Tg           YnY  k   
   101  101 A Y  T 3  S+     0   0  112  572   91     s   .              s.                      . V.           .l.  .   
   102  102 A Y  T 3  S-     0   0  133  629   92     T   .              Q.                      . H.           .D.  .   
   103  103 A G  S <  S+     0   0   38  705   79     Q   .              w.                      . C.           .i.  .   
   104  104 A T        -     0   0   32  784   66     g   g              s.                      . Da           .gg  g   
   105  105 A Y        +     0   0   81  679   93     v   v              ..                      t .d           .td  y   
   106  106 A Y        -     0   0   32  842   66     H   w              ..                      R YA           .VF  Y   
   107  107 A F  E     +I   99   0B   0  885   48     L   t              M.                      . FM           FF.  F   
   108  108 A D  E     +     0   0B  25  997   46     E   R              V.                      . DD           DAD  D   
   109  109 A Y  E     -J  168   0C 108 1059   61     V   F              KH                      . YL           YFY  Y   
   110  110 A W  E     -I   97   0B  23 1092    2     W   W              WW                      W WW           WWW  W   
   111  111 A G        -     0   0    3 1067   15     A   G              GT                      Q GG           GGG  G   
   112  112 A Q        -     0   0  141 1047   41     G   P               T                      G PP           QQQ  Q   
   113  113 A G        -     0   0   20 1013   12     S                   T                      V GG           GGG  G   
   114  114 A T  E     - H   0  94B   2  996   31     C                   A                      G TV           TTT  T   
   115  115 A T  E     - H   0  93B  60  979   76     V                   W                      T ME           MDM  L   
   116  116 A L  E     -dH  10  92B   1  972   19     V                   V                      L VV           VVV  V   
   117  117 A T  E     -d   11   0B  57  953   21     S                                            TV           TST  T   
   118  118 A V  E     +d   12   0B   4  935    8     S                                            VV           VVV  V   
   119  119 A S              0   0   64  917   10     S                                            TS           T T  S   
   120  120 A S              0   0  122  885   21                                                  SS           S S  S   
   121      ! !              0   0    0   0     0  
   122    1 B Q              0   0  114  678   32    Q DQE D DEDDEDDQQ QQ  EEQ DQ DQDQDDDDDDDDD   Q  QQQDD QQQQD   DD DDQ
   123    2 B A        -     0   0   19  713   70    P PFL IPIIIIVIFSAIVT  IIS IF IFILIIIIIIIII   I  ASSII ISAVI   II IIP
   124    3 B V        -     0   0   84  765   49    V MVV VVVVVVVVAVGQTT  VTV TEVTEMVQQQQVVVVL   V  MASTV VVVSV   VV VQV
   125    4 B V  E     -Q  145   0D  10  820   26  LVV LLL MLLLLLFMLLLMVL  LMLLMLLMLMVMMMMLLLMMLL L  LLLMMMLLLLL   ML LML
   126    5 B T  E     +Q  144   0D  69  829   11  TTT TTT TTTTTTTTTTTTTD  TITITTTTTTTTTTTTTTTTTT T  TNTTTTTTTTT   TT TTT
   127    6 B Q  E     -Q  143   0D  18  832    2  QQQ QQQ QQQQQQQQQQQQQQ  QQQQQQQQQQQQQQQQQQQQQQ Q  QQQQQQQQQQQ   QQ QQQ
   128    7 B E        -     0   0   59  833   63  EPP TPT SSSSSSPSPPPSPS  SSPPSPPSPSPSSSSSSSSSEE S  PPESSTTPPPS   SS SSP
   129    8 B S  S    S+     0   0  101  841   38  APP AQP PSPPPPHPRPPPAP  PSPPPHSLHPPPPPPPPPPQAA P  PPAPPPPPSVP   QP PPT
   130    9 B A  E     -k  226   0C  59  842   50  SAS SSS ESAAAASASSSSVA  GSSSSSSTSSSSSSSAAADKSS D  SSSGAEDSSSA   TA ASS
   131   10 B L  E     -k  227   0C  57  847   76  LVL PVP SASLSSVTVMVSIS  SSVVSVVSVTLSPSSSSSSFLL Y  VLLSSSSVLES   FS STL
   132   11 B T  E     +k  228   0C  84  848   77  SSS VSV LSLLLLSMSSSLTK  LLSSLSSLSLSVLLLLLLLLSS V  FSSLLLLSSSL   ML LLS
   133   12 B T  E     -k  229   0C  18  848   68  GVA SGS AAASAAGAGGKSSS  ASGVSAVSAPASSSSAAAASGG S  GGAANASGAVA   SA PSA
   134   13 B S    >   -     0   0   55  849   70  SAS aSa vSkgkaSvSSGaTv  avTAkSTkSvSaaavvvvvtSS v  TDSvgvvASKv   tv maS
   135   14 B P  T 3  S+     0   0   61  848   65  PLP vPv lLqsqpPpPPLvPp  qrPPqPPqPrLvvvvllllvLL p  LLVppppPPLl   vl lvP
   136   15 B G  T 3  S+     0   0   46  850    7  GGG GGG GGGGGGGGGRRGGG  GGGGGGGGGGGGGGGGGGGGGG G  GGGGGGGGGGG   GG GGG
   137   16 B E    <   -     0   0  108  850   56  QQA SQG ESEQEGQEQEQDSE  EDAQEKQEKDSDDDDQQQEDQQ E  QRQQEDEQAEQ   DQ QDA
   138   17 B T  E     - R   0 199D  88  850   66  KTT TTT RSTSTTMRKTTRTS  RRTTTTTTTRSRSRRRRRRRKK T  RTERRRRRSTR   RR RRS
   139   18 B V  E     - R   0 198D  14  850   33  VSA VVV VVVVVVVVVVAVVV  VVVAVVAVVVAVVVVAAAAVVV V  VVVVIVVVAVA   VA AVA
   140   19 B T  E     - R   0 197D  53  849   41  TRR TST TKTTTTTTTTTTAT  TKTTTTRTTTRTTTTTTTTSTT T  TTTTATTTSRT   ST TTR
   141   20 B L  E     - R   0 196D   0  849   25  LIL III ILIIIIIIIILILI  MIIIIIIIILLIIIIIIIIVLL F  LILIMIIILII   VI IIL
   142   21 B T  E     - R   0 195D  22  849   52  STT SSN NTNTNNSHSSTTTT  TTSTRSTRSTTTTTTSSSNTST T  SSNNNNNSTSS   TS STT
   143   22 B b  E     -QR 127 194D   0  850    2  CCC CCC CCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCC C  FCCCCCCCCCC   CC CCC
   144   23 B R  E     -Q  126   0D 133  850   77  KQT QKK KTKRKKTKTLTRKK  TRKSQAGQARTRQRQRRRKKTT K  TAARKKKTTTR   KR KRT
   145   24 B S  E >   -QS 125 148D  11  850   68  GGL ACT SLAAAARSRGGATA  TSGGARGARALAAAAAAASAGG A  GGGASAAGLLA   AA AAL
   146   25 B S  T 3  S+     0   0   81  850   27  NES SDS SSSSSSSSSSNSNS  SSSDSSNSSSSSSSSSSSSSNN S  RSNSSSSSRSS   SS SSR
   147   26 B T  T 3  S-     0   0   87  850   71  SLS QSQ QSQQQQSQSSSQPS  SESAQSNQSQSQQQQEKKQQSS S  SSDQQSTSSGK   QK QQS
   148   27 B G  B <  S+S  145   0D  39  850   55  Nig SGS SGSGSSGsGSNGAS  SDNLGGIGGGGGDSNssSSNNN G  sNNSSSSSGYs   Ns sSG
   149   28 B A        -     0   0   40  390   77  Nks .N. ......SfNNN...  ..N..N..N......vs...NN .  gDN....N.Ss   .s d..
   150   29 B V        -     0   0    3  620   45  VVV VIV v.VIVlIYIIvIvV  VII.II..I.FII..NTViVvv I  LIVVl..IIIT   .T Y.I
   151   30 B T    >   -     0   0   56  541   72  GN. YEY s....s.SGGgSsS  S.G..G..G.S.R..YSSsGtg S  YG..s..GN.S   .S D.N
   152   31 B T  G >  S+     0   0   94  694   78  AP. NEN NH...N.GSRANNS  T.S..D.ISIV.NIVGGADTVV N  VR..NTIAVSS   VG GIL
   153   32 B S  G 3  S+     0   0   84  802   62  RLg NKN nsgSSkdnYGAESS  SSNpSYgSNSgSSSNVYfnNGG E  SYgSqGSGgDY   GY DSg
   154   33 B N  G <  S-     0   0   13  673   73  ..y N.N nyyNSdsh.Y..D.  .S.iN.kN.NyN.SASSsn... .  .SyNnNNYyRN   TS SSy
   155   34 B Y    <   -     0   0   98  781   50  T.W NYF YIYYFYYLYN..CY  NYYYVYNYYYSY.YYLYYY... .  .DYYYHYDRAY   NY YWR
   156   35 B A        -     0   0    0  817   59  V.I LVL LILLLLVLVV.LLF  LLVALVVLVLVLLLLMMMLV.. L  .VVVLLLVIVM   VM MLI
   157   36 B N  E     -L  212   0C   0  827   79  G.S AHS AASHNDYSHH.SGH  HNHYSHYSHHTAISNHHHAA.. A  CSGAANGHYHH   AH NAF
   158   37 B W  E     -LM 211 171C   0  849    0  WWW WWW WWWWWWWWWWWWWW  WWWWWWWWWWWWWWWWWWWWWW W  WWWWWWWWWWW   WW WWW
   159   38 B V  E     -LM 210 169C   0  849   25  YLY FYY YQYYYYYYYYLYYY  YYYFYYYYYYFYYYYFYYYYYY Y  YYYYYYYYYFY   YY YYY
   160   39 B Q  E     -LM 209 168C  10  849   10  QQQ QQQ QQQQQQQQQQQQQQ  QQQQQQQQQQQQQQQQQQQQQQ Q  QQQQQQQQQQQ   QQ QQQ
   161   40 B E  E     -LM 208 167C  20  849    8  QQQ QQQ QQQQQQQQQQQQQQ  QQQQQQQQQQQQQQQQQQQKQQ Q  QQQQQQQQQQQ   QQ QQQ
   162   41 B K  E  >  - M   0 166C  68  849   50  VKK KHK KQKKKKRKQPHKKK  KKLkKRKKRKKKKKKKKKKKVV K  TLVKKKKLKKK   KK KKK
   163   42 B P  T  4 S+     0   0   98  843   23  TPP PPP PPPPPPPPPQQPPP  PPQpPRPPQPPPPPPPPPPPTT S  PESPPSPPPAP   PP PPP
   164   43 B D  T  4 S-     0   0  148  846   16  GGG GGG GGGGGGGGGGGGGG  GGEGGGAGGGGGGGGGGGGGGG G  GGGGGGGGGGG   GG GGE
   165   44 B H  T  4 S+     0   0   90  845   66  SQS QGQ QKQQQQSQRMHQQQ  AQKQQSQQNQSKKKLQQQQQAS Q  QTGQQQQTSNQ   QQ QKS
   166   45 B L  E  <  - M   0 162C  92  846   57  AAR PAP AAAAAAASAAPAPA  SAASAASAAAPAAAAPPPPSTA A  TSASAAAAPRP   SP PAP
   167   46 B F  E     + M   0 161C   9  847   19  PPp PPP PpPPPPPPPPPPPP  PPPPPPPPPPlPPPPPPPPPPP P  PPPPPPPPppP   PP PPp
   168   47 B T  E     -JM 109 160C  56  843   61  .Vy KTK KrKKKKTKTKKTQN  RKQLKSLKSKyKKQKKKKKKKK K  RKKRKKKKryK   KK KKy
   169   48 B G  E     + M   0 159C   1  848   64  KLL LML LLLLLLTLTLLLLL  LLLRPTLLTLYLFVLLLLLPPT L  LLTLLLLLYLL   AL LLL
   170   49 B L  E     +     0   0C   4  848   24  TVL LVL LELLLLVLVILLLL  LLLLLVILVLHLLLLLLLLLVV L  LLVLLLLLKLL   LL LLL
   171   50 B I  E     +NM 177 158C   0  848   19  VIA III IGIIIIIIIISIVL  IIIIIIIIIISIIIIIIIIMMM I  IIMIIIIISWI   II IIS
   172   51 B G  E  >  +N  176   0C   0  849   33  MYY YYY YSYKYYYYYYYYKY  YYYYYYYYYNDYYYYYYYYYLL Y  YHLYIYYYDFK   YY YYY
   173   52 B G  T  4 S-     0   0    9  848   87  FGY ANK WGDYYWKWNGRAHS  RGDKYAGDAGSYDAGGLLWSGG W  SNGYWHDGSNY   SL AKY
   174   53 B T  T  4 S+     0   0    9  849   68  GDs ADA ASAEAADADNNAIT  TTNDTDDTDADAAAAAAAAATT A  TVTAAGSNDsA   AA AAs
   175   54 B N  T  4 S+     0   0  102  841   49  SKs SDS SYSSSSDSNSNS.S  SNSSNDSNDSKSESSSSSSS.. S  SN.SSSTSKsS   SS SSs
   176   55 B N  E  <  -N  172   0C  77  849   69  SNN NQT TNSQNSQTQNNSIS  TSDERQYCQSHSNSTNNNTYSS T  SSTSTTNNQSY   YN NSS
   177   56 B R  E     -N  171   0C 113  850   66  RRK LRL RKRSRRRRRRRLNR  PLRRLRRLRLQLLLRRLLRRRR R  QRRRRLHRQKL   PL LLK
   178   57 B A    >   -     0   0    1  849   73  PTL APE QGAIVAPAPPPQHA  AEPPHPPQPQGQEPEGEEEYPP H  YPPAAAYPGHE   YE EEH
   179   58 B P  T 3  S+     0   0   97  849   39  SSQ SSS SNSSSSSSSSSSSS  SSSSSSSSSPSSISASSSSSSS T  SSSTSSSSSQS   SS SSQ
   180   59 B G  T 3  S+     0   0   83  850   18  GTg GGG GGGGGGGGGGGGGG  GGGGGGGGGGRGGGGGGGGGGG G  GGGGGGGGGgG   GG GGg
   181   60 B V  S <  S-     0   0   13  848   23  IIv VVV VIVVVVVVVVIVTV  VVVIVVIVVVVVVVVVVVVVII T  VIIIVVTVVvV   VV IVv
   182   61 B P    >   -     0   0   57  850    9  PPP PPP PPPPPPPPPPSPAP  SPPPPPPPPPPPPPPPPPPPPP P  PPPPPPPPPPP   PP PPP
   183   62 B A  T 3  S+     0   0   77  850   59  EES SDS DDDSDDDDDDESAN  ASDESDDSDSSSSSSAAADDDD E  ADDDDAADSDA   HA ASS
   184   63 B R  T 3  S+     0   0   58  850    5  RRR RRR RRRRRRRRRTRRRR  RRRRRRRRRRRRRRRRRRRRRR R  HRRRRRWRRRR   RR RRR
   185   64 B F  E <   +T  198   0D   4  850    1  FFF FFF FFFFFFFFFFFFFF  FFFFFFFFFLFFFFFFFFFFFF I  FFFFFFFFFFF   FF FFF
   186   65 B S  E     -T  197   0D  51  849   17  SSS KSK SSSSSSSSSSSSST  SSSSSSSSSSSSRSSSSSSTSS S  SSSSSSSSSSS   TS SSS
   187   66 B G  E     +T  196   0D   9  850    4  GSg GGG GGGGGGGGGGAGGG  GGGGGGGGGGGGGGGGGGGGGG G  GGGGGGGGGgG   GG GGG
   188   67 B S  E     -T  195   0D  41  850    7  SSs SsS SSSSSSsSsSSSSS  SSSSSsSSsSsSSSSSSSSSSS S  SSSSSsSSspS   SS SSs
   189   68 B L  E     -T  194   0D  59  835   79  QWn GdG GSGGGGsGsKRGGG  GGKSGsNGsGtGGGGGGGGGKK G  IKHGGgGKanG   GG GGa
   190   69 B I  E >   -T  193   0D  86  842   31  SSA SSS SSSSSSSSSSSSSS  SSSSSSSSSSSSSSSSSSSSSS S  SSSSSSSSSVS   SS SSS
   191   70 B G  T 3  S-     0   0   67  850   18  GGG GaG GGGGGGSGSGGGSG  GGGGGSGGSGAGGGGGGGGGGG G  GGGGGgGGAGG   GG GGS
   192   71 B N  T 3  S+     0   0  105  828   57  ND. TnT TATTTTNTNSNTTT  TTNTTNNTNTNTTTTTTTTTNN T  NNNTTtTTN.T   TT TTN
   193   72 B K  E <  S- T   0 190D  68  833   67  TT. QSQ DDADDDSDSSTDDD  SDSTDTTDTDADDDDDDDDDTT D  KTKDDDDSA.D   DD DEA
   194   73 B A  E     -RT 143 189D   0  838   81  AE. FAF FRFFFFAFAGAFFY  YYAAYAAYAFGYFFFFFFFFAA F  SAAFFYFAG.F   FF FFG
   195   74 B A  E     -RT 142 188D   0  849   57  STL TST TYTTTTSTSSSTTS  STSTSSTSSTLTATTSTTTTSS T  TSSTTTTSIYT   TT TTI
   196   75 B L  E     -RT 141 187D   0  850    2  LLL LLL LLLLLLLLLLLLLL  LLLLLLLLLLLLLLFLLLLLLL L  LLLLLLLLLLL   LL LLL
   197   76 B T  E     -RT 140 186D  19  850   33  VTT TTT TTTTTTATTTTTTT  TTTTTSATSTLTSTTINNTTVV T  TTISTTTALTN   TN NTV
   198   77 B I  E     -RT 139 185D   0  849    5  III III IIITIIIIIIIIII  IIIIIIIIIIIIIIIIIIIIII I  IIIIIIIIIII   II III
   199   78 B T  E    S+R  138   0D  78  850   46  TTS NTS SSSSNSSSSRTSSS  SSTTRSSSSSSSSSSHHHSSTT S  TSSSSSSTSKH   SH HSS
   200   79 B G  S    S-     0   0   15  850   57  GGG GGG SNNSNNGSAGGSGN  SSGRSGGSDSGSSSSPPPSNGG R  GGNNNSNGGGP   NP PSG
   201   80 B A        -     0   0    0  849   51  LAL VLV LLFLFFLLLLLLVV  ILLTLLALLLLLLLLMVVLVRR M  ALLLLAFLLAV   VV VLL
   202   81 B Q    >   -     0   0   80  849   32  QQQ QLQ QQQEQQKQQQQQQQ  EEQQEQQEQEQQQQQEEEQQQQ E  QQWQQEEQQLE   QE EQQ
   203   82 B T  G >  S+     0   0   84  850   59  PAP CAC ASAAAASAASPPTV  APPTPIAPIPPPPPPEEEASPP A  SAPAATTASLE   SE EPS
   204   83 B E  G 3  S+     0   0   99  850   17  EQE DED EEDEDEEEEEEEQE  EEDEEEGEEEEEEEEDEEEEEE E  EEEEEEEEEEE   EE EDE
   205   84 B D  G <   +     0   0    1  850    2  DDD DDD DDDEDDDDDDDDDD  DDDDDDDDDDDDDDDDDDDDDD D  VDDDDDDDDDD   DD DDD
   206   85 B E    <   +     0   0   71  849   74  EEE AEA VEAAAAEVEEEVEA  AVEEVEEIEVEFFFISAAVLEE A  EEEVVAAEEDA   LA AFE
   207   86 B A  E    S- O   0 227C   3  850   14  AAA ASA AAAAAAAAAAAAAG  TAAAAAAAAAAAAAAAAVAAAA A  AAAGGGGAAAA   AA AAA
   208   87 B I  E     -LO 161 226C  55  850   71  VND TVT VDVVAVDDDDDTVD  TTIVTDDDDNDTTTTMTTVEDD D  DDDDDDNDDDT   ET TTD
   209   88 B Y  E     -LO 160 225C   0  850    0  YYY YYY YYYYYYYYYYYYYY  YYYYYYYYYYYYYYYYYYYYYY Y  YYYYYYYYYYY   YY YYY
   210   89 B F  E     -L  159   0C   5  848    8  YYY YFY YYYYYYYFYFYYYY  YFHYFFYYYDYYYYYFYYYFYY Y  YYYYYYYYYYY   FY YYY
   211   90 B b  E     -L  158   0C   0  849    1  CCC CCC CCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCC C  CCCCCCCCCCC   CC CCC
   212   91 B A  E     -LP 157 221C   0  848   73  SSN AQA QQQQQLQQQQSLLQ  QQQLVQQLQQAQQQQHQQQQSS Q  GCSQMQHQMAQ   QQ QQM
   213   92 B L  E     - P   0 220C   0  845   83  TMT ASG QTQRQQSQSSAQGY  QQSSQSVQSQ QQQQQHHQQTT Q  LSTHQQQSIIH   QH QQI
   214   93 B W  E     + P   0 219C  21  834   71  WWY RFE YWYSFGYFYYWDGY  WEYSSYWSYY YYNYTSSYFWW G  GYWHYSRYWWS   YS SYW
   215   94 B Y  E >  S- P   0 218C  33  829   88  DDE YDY YDNSNYDIDDDYYP  DPDYYDDYGS NYYNKRRYNDD Y  TADYYYLDHYG   NR SNH
   216   95 B S  T 3  S-     0   0  106  829   66  TNG SSS SSNSKKSSNSSTST  SQDDSGGNSS SNINEEENRTY S  GSKSSSSSSSE   SE ESS
   217   96 B N  T 3  S+     0   0  105  824   81  Snn Gds tnetasSasSsTDv  sgSDsnsyNy yLTwVllLYsg g  SSgyfFYSssf   YL dIs
   218   97 B H  E <   -P  215   0C  39  647   66  .kd Ppt phpppp.ph.sP.p  ph..phhp.p pPPpPrpPPss h  .NnppPP.shp   PP pEs
   219   98 B L  E     -P  214   0C   1  382   85  .h. ..t ............Ge  .....l.... .YT.W..WLhh .  ........ .W   YY .G 
   220   99 B V  E     -P  213   0C  12  489   66  .SI ..T ......G...A.TT  .....Q.... .TSTTTTTTTT .  .TN..... IT   TT TT 
   221  100 B F  E     -P  212   0C  17  540   30  IlY ..V ......Y...YFFF  .l...t..Y. .FFFFFFFFLL .  YLY..... FF   FF FF 
   222  101 B G        -     0   0    1  481   35  Se. ..G ............T.  .g...g.... .GGGGGGGG.. .  .H...... GG   GG GG 
   223  102 B G        -     0   0   51  513   58  NP. A.S ............H.  .P.S.ES... .QQQGGGQS.. S  .S...... GG   GG GQ 
   224  103 B G        -     0   0    8  528   33  HG. G.G ............G.  .S.G.ED... .GGGGGGGG.. D  .G...... GG   GG GG 
   225  104 B T  E     - O   0 209C   0  550   33  T . S.T ...........TTY  TS.NTAT... .TTTTTTTT.. T  .S...... TT   TT TT 
   226  105 B K  E     -kO 130 208C  82  547   67  L .  .E ........... KK  RN.AVN .N. .KRKDKKKK.. E  NS...... QK   KK KK 
   227  106 B L  E     -kO 131 207C   0  546   44  L .  .Y ......H.... TL   G.LIV .H. .LVVLLLVLLL L  AL...LV. LL   LL LV 
   228  107 B T  E     -k  132   0C  34  614   65  P T  TT TTTTTTTTT.T S    S.SQA TTT TEEEEEEEEHH N  T TTTTT. TE   EE EE 
   229  108 B V  E     -k  133   0C   3  593   35  T V  VL VVVVVVVVV.V L    I.TAL VVV VIIVIIIILTT    V VVVVV. VI   II II 
   230  109 B L              0   0  120  399   31  H V  I  LILLILLILL       LLVMI IL  L        HH    M LLLIIL L          
   231  110 B G              0   0   62  207   39  G                        DSTTG              GG         P S T          
## ALIGNMENTS 1751 - 1820
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    1 A E              0   0  185  771   30   QQ       D        Q Q                  N                           Q 
     2    2 A V        +     0   0   18  834   19   VV       V        V V                  I                           I 
     3    3 A Q  E     -A   25   0A  90  836   34   TT       Q        Q Q                  V                           S 
     4    4 A L  E     -A   24   0A  13  881    3   VL       L  V     L L               L  L                           L 
     5    5 A Q  E     -A   23   0A 107  882   70   SK       Q  E     K K               T  T                           T 
     6    6 A Q  E     -A   22   0A  14  887   31   LE       E  EE    E E              EQ  Q                           Q 
     7    7 A S        -     0   0   33  892   13   SS       S  SS    S S              SS  P                           P 
     8    8 A G        -     0   0   52  907   11   VG       G  RE    G G              EE  E                           G 
     9    9 A A        -     0   0   80 1179   51   PP       P  GG    P P              GP  S                           T 
    10   10 A E  E     -d  116   0B  68 1189   46   EG       G  GG    G G              GV  A                           V 
    11   11 A L  E     +d  117   0B 130 1195   22   LI       L  LL    V V              LV  V                           T 
    12   12 A V  E     -d  118   0B  28 1197   47   VL       V  IF    V V              FK  K                           V 
    13   13 A K    >   -     0   0  145 1201   50   KK       K  KK    K K              KR  K                           K 
    14   14 A P  T 3  S+     0   0   70 1203    8   PP       P  PP    P P              PP  P                           P 
    15   15 A G  T 3  S+     0   0   59 1209   28   SS       S  TT    S S              MG  G                           S 
    16   16 A A    <   -     0   0   36 1213   63   EQ       K  DD    Q Q              DE  E                           E 
    17   17 A S        -     0   0   66 1210   29   TT       T  TT    T T              TS  S                           V 
    18   18 A V  E     - B   0  83A  10 1213   32   LL       L  LL    L L              LH  H                           L 
    19   19 A K  E     - B   0  82A 119 1211   53   RS       S  TT    S S              TT  K                           Q 
    20   20 A L  E     - B   0  81A   0 1214   21   LL       L  LL    L L              LL  L                           L 
    21   21 A S  E     - B   0  80A  31 1215   35   AT       T  TT    T T              TT  S                           T 
    22   22 A a  E     -AB   6  79A   0 1216    0   CC       C  CC    C C              CC  C                           C 
    23   23 A K  E     -AB   5  78A 113 1216   70   KS       T  TT    S S              TT  T                           K 
    24   24 A A  E     +A    4   0A   2 1216   49   VF       V  VV    V V              VA  V                           V 
    25   25 A S  E     +A    3   0A  49 1216   12   SS       S  SS    S S              SS  S                           T 
    26   26 A G  S    S+     0   0   56 1215    3   GG       G  GG    G G              GG  G                           G 
    27   27 A Y  S    S-     0   0   39 1216   33   AF       F  FF    S S              FF  F                           A 
    28   28 A T    >   -     0   0   90 1216   52   LS       S  SS    S S              SS  D                           S 
    29   29 A F  G >  S+     0   0   13 1216   27   IL       I  LL    I I              LF  V                           L 
    30   30 A T  G 3  S+     0   0   40 1216   55   TS       T  SS    T T              SI  N                           T 
    31   31 A S  G <  S+     0   0   23 1216   57   dt       t  Ss    t t              SS  G                           d 
    32   32 A Y  E <  S-E  100   0B  40 1139   28   iv       c  Y.    y y              YY  H                           i 
    33   33 A W  E     -E   99   0B  40 1148   92   aG       C  Ga    y y              GY  H                           s 
    34   34 A M  E     -EF  98  51B   0 1206   49   VV       W  VI    W W              VM  M                           V 
    35   35 A H  E     -EF  97  50B   0 1212   72   DG       T  IS    S S              NN  N                           E 
    36   36 A W  E     -EF  96  49B   0 1216    0   FW       W  WW    W W              WW  W                           W 
    37   37 A V  E     -EF  95  47B   0 1216   17   II       I  VV    I I              VV  V                           V 
    38   38 A K  E     -EF  94  46B   7 1216   22   RR       R  RR    R R              RR  K                           R 
    39   39 A Q  E     +EF  93  45B  20 1216    5   QQ       Q  QQ    Q Q              QQ  Q                           D 
    40   40 A R    >   -     0   0   35 1216   71   FP       P  AA    S S              AA  V                           P 
    41   41 A P  T 3  S+     0   0  130 1215   15   SS       P  PP    T T              PP  P                           A 
    42   42 A G  T 3  S+     0   0   83 1216   22   GG       G  GG    E E              GG  G                           G 
    43   43 A R  S <  S-     0   0  156 1216   43   SK       K  NN    K K              KK  E                           K 
    44   44 A G        -     0   0   16 1215   36   RG       G  GG    G G              GG  G                           G 
    45   45 A L  E     -F   39   0B   8 1215   10   FL       L  LL    L L              LL  L                           L 
    46   46 A E  E     -F   38   0B  34 1216    6   EE       E  EE    Q Q              EE  E                           E 
    47   47 A W  E     -F   37   0B   3 1216   10   FW       W  YW    W W              WW  W                           W 
    48   48 A I  E     -     0   0B   0 1215   31   LL       M  II    I I              II  L                           L 
    49   49 A G  E     -FG  36  60B   0 1216   35   AA       G  GG    G G              GA  L                           G 
    50   50 A R  E     -FG  35  59B  32 1216   94   HH       C  TA    Y Y              YT  S                           r 
    51   51 A I  E     -FG  34  58B   0 1207   17   II       I  II    I I              IL  .                           i 
    52   52 A D     >  -     0   0   26 1212   86   NW       G  GG    N N              GD  Y                           H 
    53   53 A P  T  4 S+     0   0    0 1212   83   YW       Y  SS    Y Y              TN  R                           N 
    54   54 A N  T  4 S-     0   0   96 1213   69   QN       D  SS    S S              GG  K                           S 
    55   55 A G  T  4 S-     0   0   69 1216   57   QD       G  GG    G G              Ts  T                           D 
    56   56 A G     <  +     0   0   25  915   61   ..       .  ..    . .              .s  Y                           . 
    57   57 A G        -     0   0   43 1195   77   GN       N  SS    G G              .S  N                           . 
    58   58 A T  E     -G   51   0B  62 1209   46   TK       I  AA    T T              .K  T                           T 
    59   59 A K  E     -G   50   0B  89 1212   88   AY       Y  YY    G G              YS  Y                           Y 
    60   60 A Y  E     -G   49   0B  46 1215    9   LY       Y  YY    Y Y              LY  Y                           Y 
    61   61 A N    >>  -     0   0   12 1216   63   NN       T  AA    N N              AS  A                           A 
    62   62 A E  G >4 S+     0   0  148 1216   64   SP       P  SS    L L              NQ  S                           Q 
    63   63 A K  G 34 S+     0   0  109 1216   64   AS       S  WW    S S              WS  G                           S 
    64   64 A F  G X> S+     0   0    5 1216   45   LL       L  AA    L L              AV  I                           L 
    65   65 A K  T << S+     0   0  156 1216   40   KK       K  KK    K K              KQ  Q                           K 
    66   66 A S  T 34 S+     0   0  108 1216   35   SS       S  SS    S S              SG  G                           G 
    67   67 A K  T <4 S+     0   0   33 1214   21   RQ       R  RR    R R              RR  R                           R 
    68   68 A A  E  <  -C   83   0A   2 1216   69   LL       T  SS    S S              SF  I                           I 
    69   69 A T  E     -C   82   0A  58 1216   37   TT       S  TT    S S              TT  T                           T 
    70   70 A L  E     +C   81   0A   7 1216   27   LI       I  II    I I              II  F                           V 
    71   71 A T  E     -C   80   0A  57 1213   47   SS       S  TT    S S              TS  S                           S 
    72   72 A V  E     -C   79   0A  28 1216   71   RK       R  RR    R R              SR  T                           R 
    73   73 A D  E   > -C   78   0A  69 1216    7   DD       D  NN    D D              ND  E                           D 
    74   74 A K  T > 5S+     0   0  105 1216   62   TT       T  TT    T T              TN  S                           T 
    75   75 A P  T 3 5S+     0   0  122 1215   37   AS       S  NN    S S              NS  S                           N 
    76   76 A S  T 3 5S-     0   0   37 1216   65   RR       K  LL    K K              EK  T                           K 
    77   77 A S  T < 5 +     0   0   24 1216   48   NN       N  NN    N N              NQ  T                           G 
    78   78 A T  E   < -BC  23  73A   8 1216   64   EQ       Q  TT    E E              TQ  F                           E 
    79   79 A A  E     -BC  22  72A   0 1207   67   AV       F  VV    F F              VL  .                           V 
    80   80 A Y  E     -BC  21  71A  61 1209   36   YF       S  TT    S S              TY  .                           Y 
    81   81 A M  E     -BC  20  70A   0 1212    9   LL       L  LL    L L              LL  I                           L 
    82   82 A Q  E     -BC  19  69A  69 1215   43   EQ       Q  KK    Q Q              KK  E                           K 
    83   83 A L  E     -BC  18  68A   0 1215   14   FI       L  MM    L L              MM  I                           L 
    84   84 A S        +     0   0   32 1215   56   RT       S  TT    T T              TN  P                           T 
    85   85 A S  S    S-     0   0   89 1216   25   GS       S  SS    S S              SS  N                           G 
    86   86 A L        +     0   0    2 1216   15   MV       V  LL    V V              LL  L                           M 
    87   87 A T    >   -     0   0   61 1215   68   TD       T  TT    T T              TK  R                           K 
    88   88 A S  G >  S+     0   0   72 1216   59   AT       T  AA    A A              GT  V                           P 
    89   89 A E  G 3  S+     0   0  107 1216   21   EA       E  AA    D D              AE  E                           V 
    90   90 A D  G <  S+     0   0    7 1216    3   DD       D  DD    D D              DD  D                           E 
    91   91 A S    <   +     0   0   31 1216   34   TT       T  TT    T T              TS  T                           T 
    92   92 A A  E    S- H   0 116B  10 1214    5   AA       A  AA    A A              AA  A                           A 
    93   93 A V  E     -EH  39 115B  21 1216   48   MT       L  TT    V V              TV  M                           V 
    94   94 A Y  E     -EH  38 114B   0 1216    1   YY       Y  YY    Y Y              YY  Y                           Y 
    95   95 A Y  E     -E   37   0B   1 1216    3   YY       Y  FF    Y Y              FY  Y                           Y 
    96   96 A a  E     +E   36   0B   0 1216    1   CC       C  CC    C C              CC  C                           C 
    97   97 A A  E     -EI  35 110B   0 1215   24   AA       V  AA    A A              GA  A                           A 
    98   98 A R  E     -E   34   0B  13 1196   38   KA       R  RR    R R              SR  R                           T 
    99   99 A M  E     -EI  33 107B   5 1101   82   DF       D  DD    G G              GH  G                           D 
   100  100 A W  E >   -E   32   0B  89 1101   89   yS       t  tt    t t              as  T                           G 
   101  101 A Y  T 3  S+     0   0  112  572   91   ..       .  ..    . .              n.  .                           . 
   102  102 A Y  T 3  S-     0   0  133  629   92   ..       .  ..    . .              E.  .                           . 
   103  103 A G  S <  S+     0   0   38  705   79   ..       .  ..    . .              F.  .                           . 
   104  104 A T        -     0   0   32  784   66   g.       g  ..    g g