Complet list of 1mqk hssp fileClick here to see the 3D structure Complete list of 1mqk.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1MQK
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-08-28
HEADER     antibody, membrane protein, cytochrome  2003-04-01 1MQK
COMPND     antibody 7E2 FV fragment, light chain; antibody 7E2 FV fragment, heavy
SOURCE     Mus musculus; Mus musculus
AUTHOR     Essen, L.-O.; Harrenga, A.; Ostermeier, C.; Michel, H.
SEQLENGTH   231
NCHAIN        2 chain(s) in 1MQK data set
NALIGN     1234
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : HVM54_MOUSE 1MQK    0.93  0.95  110  207   20  117   98    0    0  117  P18525     Ig heavy chain V region 5-84 OS=Mus musculus PE=1 SV=1
    2 : K7THE9_MOUSE        0.90  0.93  124  227    1  105  105    1    1  105  K7THE9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
    3 : A2NMA3_MOUSE        0.89  0.94    1  108    1  107  108    1    1  107  A2NMA3     Anti-carcinoma embryonic antigen light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
    4 : HVM55_MOUSE         0.89  0.95  110  207   20  117   98    0    0  117  P18526     Ig heavy chain V region 345 OS=Mus musculus PE=4 SV=1
    5 : K7TGW3_MOUSE        0.89  0.97  118  227    1  110  110    0    0  110  K7TGW3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
    6 : A2NTS3_MOUSE        0.87  0.95  110  207   20  117   98    0    0  117  A2NTS3     VH283 protein (Precursor) OS=Mus musculus PE=4 SV=1
    7 : HVM53_MOUSE 1CFV    0.87  0.93  110  207   20  117   98    0    0  117  P18524     Ig heavy chain V region RF OS=Mus musculus PE=1 SV=1
    8 : HVM56_MOUSE 2DTM    0.87  0.96  110  207    1   97   98    1    1   97  P18527     Ig heavy chain V region 914 OS=Mus musculus PE=1 SV=1
    9 : K7TQZ1_MOUSE        0.87  0.93  118  227    1  112  112    1    2  112  K7TQZ1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   10 : KV5A4_MOUSE 1MQK    0.87  0.94    1  108    1  107  108    1    1  108  P01636     Ig kappa chain V-V region MOPC 149 OS=Mus musculus PE=1 SV=1
   11 : K7T9J4_MOUSE        0.86  0.93  118  227    1  111  111    1    1  111  K7T9J4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   12 : K7TD70_MOUSE        0.86  0.94  118  227    1  111  111    1    1  111  K7TD70     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   13 : K7U6I0_MOUSE        0.86  0.94  129  227    1   98   99    1    1   98  K7U6I0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   14 : K7T977_MOUSE        0.85  0.93  118  227    1  111  111    1    1  111  K7T977     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   15 : K7T9D0_MOUSE        0.85  0.93  118  227    1  107  110    1    3  107  K7T9D0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   16 : K7TDA3_MOUSE        0.85  0.93  118  227    1  108  110    1    2  108  K7TDA3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   17 : K7TDT0_MOUSE        0.85  0.92  129  227    1   96   99    1    3   96  K7TDT0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   18 : K7TGR2_MOUSE        0.85  0.93  118  227    1  111  111    1    1  111  K7TGR2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   19 : K7TGZ2_MOUSE        0.85  0.90  118  227    1  109  110    1    1  109  K7TGZ2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   20 : K7U6J5_MOUSE        0.85  0.91  125  227    1  102  103    1    1  102  K7U6J5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   21 : K7TD11_MOUSE        0.84  0.91  118  227    1  110  110    0    0  110  K7TD11     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   22 : K7TD77_MOUSE        0.84  0.92  118  227    1  114  114    1    4  114  K7TD77     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   23 : K7THF4_MOUSE        0.84  0.92  124  227    1  107  108    2    5  107  K7THF4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   24 : K7TRQ8_MOUSE        0.84  0.91  118  227    1  111  111    1    1  111  K7TRQ8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   25 : K7U5I4_MOUSE        0.84  0.90  118  227    1  108  110    1    2  108  K7U5I4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   26 : KV5A3_MOUSE 1QBL    0.84  0.94    1   95   21  115   95    0    0  115  P01635     Ig kappa chain V-V region K2 (Fragment) OS=Mus musculus PE=1 SV=1
   27 : A0N7J2_9MURI3VRL    0.83  0.90  110  232    1  121  123    1    2  219  A0N7J2     Mc5 VHCH1 (Fragment) OS=Mus sp. GN=Mc5 VHCH1 PE=1 SV=1
   28 : A2NPL2_MOUSE        0.83  0.92  110  227    3  121  119    1    1  121  A2NPL2     QY1.5 Vh (Fragment) OS=Mus musculus PE=2 SV=1
   29 : K7T9U6_MOUSE        0.83  0.94  116  227    1  112  113    2    2  112  K7T9U6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   30 : K7TD00_MOUSE        0.83  0.87  118  227    1  109  110    1    1  109  K7TD00     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   31 : K7TGW8_MOUSE        0.83  0.92  118  227    1  110  111    2    2  110  K7TGW8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   32 : K7U6I4_MOUSE        0.83  0.94  118  227    1  110  111    2    2  110  K7U6I4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   33 : K7TD38_MOUSE        0.82  0.90  118  227    1  108  110    2    2  108  K7TD38     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   34 : K7TGY7_MOUSE        0.82  0.89  118  227    1  111  112    2    3  111  K7TGY7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   35 : K7TR59_MOUSE        0.82  0.89  118  227    1  110  112    2    4  110  K7TR59     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   36 : K7TRT7_MOUSE        0.82  0.90  118  227    1  106  110    2    4  106  K7TRT7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   37 : K7U5H8_MOUSE        0.82  0.89  118  227    1  109  111    2    3  109  K7U5H8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   38 : K7U634_MOUSE        0.82  0.88  118  227    1  111  111    1    1  111  K7U634     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   39 : Q920E6_MOUSE1JGL    0.82  0.93    1  108    1  107  108    1    1  109  Q920E6     Pterin-mimicking anti-idiotope kappa chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
   40 : Q920E7_MOUSE        0.82  0.91  110  227    1  119  119    1    1  119  Q920E7     Pterin-mimicking anti-idiotope heavy chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
   41 : A2NW56_MOUSE        0.81  0.92    1  108    1  107  108    1    1  107  A2NW56     E8 variable light chain (Fragment) OS=Mus musculus PE=2 SV=1
   42 : B5UB70_MOUSE        0.81  0.91  110  227    1  116  118    2    2  116  B5UB70     EP3-31 heavy chain variable region (Fragment) OS=Mus musculus GN=EP3-31VH PE=2 SV=1
   43 : K7T935_MOUSE        0.81  0.91  118  227    1  108  110    2    2  108  K7T935     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   44 : K7TD05_MOUSE        0.81  0.89  118  227    1  109  111    2    3  109  K7TD05     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   45 : K7TD49_MOUSE        0.81  0.89  118  227    1  111  112    2    3  111  K7TD49     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   46 : K7TH81_MOUSE        0.81  0.93  118  227    1  111  111    1    1  111  K7TH81     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   47 : K7TRF6_MOUSE        0.81  0.88  118  227    1  111  112    2    3  111  K7TRF6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   48 : K7TRJ8_MOUSE        0.81  0.90  118  227    1  113  113    2    3  113  K7TRJ8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   49 : A2NVW0_MOUSE        0.80  0.89  118  216    1  102  102    2    3  102  A2NVW0     Heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   50 : K7T958_MOUSE        0.80  0.89  118  227    1  111  112    2    3  111  K7T958     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   51 : K7T999_MOUSE        0.80  0.87  118  227    1  110  113    2    6  110  K7T999     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   52 : K7TGQ7_MOUSE        0.80  0.88  118  227    1  110  112    2    4  110  K7TGQ7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   53 : K7U5Q9_MOUSE        0.80  0.89  118  227    1  111  112    2    3  111  K7U5Q9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   54 : K7U6F6_MOUSE        0.80  0.88  118  227    1  113  113    2    3  113  K7U6F6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   55 : A2NV20_MOUSE        0.79  0.86  110  227   20  138  121    2    5  138  A2NV20     Precursor polypeptide (AA -19 to 119) (480 is 1st base in codon) (Precursor) OS=Mus musculus GN=Ighv5-9 PE=2 SV=1
   56 : B5UB66_MOUSE        0.79  0.90  110  227    1  121  121    2    3  121  B5UB66     EP3-1 heavy chain variable region (Fragment) OS=Mus musculus GN=EP3-1VH PE=2 SV=1
   57 : K7T918_MOUSE        0.79  0.87  118  227    1  112  114    2    6  112  K7T918     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   58 : K7T9K7_MOUSE        0.79  0.88  119  227    1  110  112    2    5  110  K7T9K7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   59 : K7TDP8_MOUSE        0.79  0.90  118  227    1  111  112    2    3  111  K7TDP8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   60 : K7TDT7_MOUSE        0.79  0.88  118  227    1  112  112    1    2  112  K7TDT7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   61 : K7TRH0_MOUSE        0.79  0.84  118  227    1  114  114    1    4  114  K7TRH0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   62 : K7TRP7_MOUSE        0.79  0.83  125  227    1  106  107    2    5  106  K7TRP7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   63 : K7U5Y3_MOUSE        0.79  0.89  118  227    1  108  111    2    4  108  K7U5Y3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   64 : Q5F2I8_MOUSE        0.79  0.87  110  226    1  119  119    1    2  119  Q5F2I8     Gamma heavy chain variable region (Fragment) OS=Mus musculus GN=IgG1 TS1 VH PE=2 SV=1
   65 : K7TRN5_MOUSE        0.78  0.86  118  227    1  114  114    2    4  114  K7TRN5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   66 : K7T9L3_MOUSE        0.77  0.86  118  227    1  115  115    2    5  115  K7T9L3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   67 : K7TDM9_MOUSE        0.77  0.90  118  227    1  111  111    1    1  111  K7TDM9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   68 : K7TGS1_MOUSE        0.77  0.89  118  227    1  111  111    1    1  111  K7TGS1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   69 : K7TH90_MOUSE        0.77  0.85  118  227    1  115  115    2    5  115  K7TH90     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   70 : K7TRU7_MOUSE        0.77  0.85  118  227    1  114  114    2    4  114  K7TRU7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   71 : K7U686_MOUSE        0.77  0.85  118  227    1  115  115    2    5  115  K7U686     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   72 : D3ZHM9_RAT          0.76  0.89    1   90   21  110   90    0    0  115  D3ZHM9     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=2
   73 : K7TD63_MOUSE        0.76  0.85  118  227    1  110  113    2    6  110  K7TD63     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   74 : K7TDE9_MOUSE        0.76  0.84  118  227    1  112  114    2    6  112  K7TDE9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   75 : K7TDL3_MOUSE        0.76  0.83  118  227    1  115  115    2    5  115  K7TDL3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   76 : A0N7D2_9MURI        0.75  0.86  110  228    1  121  121    1    2  123  A0N7D2     SD6 Fab heavy chain variable region (Fragment) OS=Mus sp. GN=Ig1 PE=4 SV=1
   77 : K7T9R4_MOUSE        0.75  0.86  128  227    1  104  107    2   10  104  K7T9R4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   78 : K7TGX7_MOUSE        0.75  0.86  118  227    1  114  114    2    4  114  K7TGX7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   79 : HVM16_MOUSE 4KVC    0.74  0.87  110  227   17  136  121    2    4  136  P01783     Ig heavy chain V region MOPC 21 (Fragment) OS=Mus musculus PE=1 SV=1
   80 : K7T9L8_MOUSE        0.74  0.81  118  227    1  115  116    2    7  115  K7T9L8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   81 : K7U664_MOUSE        0.74  0.87  118  227    1  107  110    2    3  107  K7U664     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   82 : Q0ZCH4_HUMAN        0.74  0.88  111  227    2  117  117    1    1  117  Q0ZCH4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
   83 : Q6KB05_MOUSE1MVU    0.74  0.86  110  232    1  126  129    2    9  255  Q6KB05     ScFv B8E5 protein (Fragment) OS=Mus musculus GN=scFv B8E5 PE=1 SV=1
   84 : F8SQR6_RAT          0.73  0.84  110  227    2  117  118    1    2  117  F8SQR6     Immunglobulin heavy chain variable region (Fragment) OS=Rattus norvegicus PE=2 SV=1
   85 : K7THD1_MOUSE        0.73  0.88  118  227    1  111  111    1    1  111  K7THD1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   86 : K7TRB1_MOUSE        0.73  0.86  118  227    1  111  112    2    3  111  K7TRB1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   87 : K7U6B4_MOUSE        0.73  0.85  118  227    1  114  114    2    4  114  K7U6B4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   88 : M0R816_RAT          0.73  0.90    1   93   21  113   93    0    0  115  M0R816     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
   89 : K7T9H4_MOUSE        0.72  0.86  118  227    1  111  112    2    3  111  K7T9H4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   90 : K7TDG3_MOUSE        0.72  0.85  118  227    1  111  112    2    3  111  K7TDG3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   91 : K7TH31_MOUSE        0.72  0.84  118  227    1  112  112    1    2  112  K7TH31     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   92 : K7TRG8_MOUSE        0.72  0.84  118  227    1  111  112    2    3  111  K7TRG8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
   93 : Q0ZCG6_HUMAN        0.72  0.86  111  227    3  118  117    1    1  118  Q0ZCG6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
   94 : Q0ZCJ0_HUMAN        0.72  0.85  111  227    3  125  123    1    6  125  Q0ZCJ0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
   95 : Q0ZCJ2_HUMAN        0.72  0.85  111  227    2  124  123    1    6  124  Q0ZCJ2     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
   96 : A2KBB9_HUMAN        0.71  0.87  110  232    1  121  123    1    2  238  A2KBB9     Anti-(ED-B) scFV (Fragment) OS=Homo sapiens PE=2 SV=1
   97 : A2KUC3_HUMAN        0.71  0.86  110  227    1  121  122    2    5  121  A2KUC3     UGa8H (Fragment) OS=Homo sapiens GN=IGHV PE=4 SV=1
   98 : A2NUT3_HUMAN        0.71  0.87  110  229   20  146  127    2    7  161  A2NUT3     Mu-chain (AA -19 to 142) (Precursor) OS=Homo sapiens PE=2 SV=1
   99 : F7A323_MACMU        0.71  0.88    1   90   23  112   90    0    0  112  F7A323     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  100 : F7HD15_MACMU        0.71  0.86    1   96    1   96   96    0    0   97  F7HD15     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  101 : K7T9P9_MOUSE        0.71  0.86  118  227    1  111  112    2    3  111  K7T9P9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  102 : Q0ZCH7_HUMAN        0.71  0.85  111  227    2  117  119    2    5  117  Q0ZCH7     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  103 : Q0ZCI8_HUMAN        0.71  0.85  111  227    2  124  123    1    6  124  Q0ZCI8     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  104 : Q9HCC1_HUMAN1T2J    0.71  0.86  110  223    1  112  114    2    2  112  Q9HCC1     Single chain Fv (Fragment) OS=Homo sapiens PE=1 SV=1
  105 : F1M0H4_RAT          0.70  0.82  110  218    2  109  109    1    1  118  F1M0H4     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  106 : F6SD32_MACMU        0.70  0.88    1   90   10   99   90    0    0   99  F6SD32     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  107 : F7BMY9_MACMU        0.70  0.87    1   91   23  113   91    0    0  117  F7BMY9     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  108 : F7H2U1_MACMU        0.70  0.86    1   90   22  111   90    0    0  116  F7H2U1     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  109 : F7H2U3_MACMU        0.70  0.86    1   90   24  113   90    0    0  113  F7H2U3     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  110 : K7T9F1_MOUSE        0.70  0.82  118  227    1  112  114    2    6  112  K7T9F1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  111 : K7T9F6_MOUSE        0.70  0.84  118  227    1  116  116    1    6  116  K7T9F6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  112 : K7TDL7_MOUSE        0.70  0.87  118  227    1  111  112    2    3  111  K7TDL7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  113 : Q0ZCG7_HUMAN        0.70  0.82  111  227    3  121  120    2    4  121  Q0ZCG7     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  114 : Q0ZCH9_HUMAN        0.70  0.85  110  227    1  121  122    2    5  121  Q0ZCH9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  115 : Q0ZCJ3_HUMAN        0.70  0.84  111  227    2  118  117    0    0  118  Q0ZCJ3     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  116 : Q0ZCJ5_HUMAN        0.70  0.84  111  227    3  121  119    2    2  121  Q0ZCJ5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  117 : Q9UL90_HUMAN        0.70  0.85  110  227    1  113  118    1    5  113  Q9UL90     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  118 : Q9UL91_HUMAN        0.70  0.84  110  226    1  117  118    2    2  118  Q9UL91     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  119 : Q9UL93_HUMAN        0.70  0.85  111  227    1  116  117    1    1  116  Q9UL93     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  120 : A2JA14_HUMAN        0.69  0.81  110  226    1  124  124    2    7  124  A2JA14     Anti-mucin1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  121 : A2KBC1_HUMAN        0.69  0.86  110  232    1  121  124    3    4  236  A2KBC1     Anti-(ED-B) scFV (Fragment) OS=Homo sapiens PE=2 SV=2
  122 : G1QD65_MYOLU        0.69  0.85  110  219    1  106  110    1    4  119  G1QD65     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  123 : G3IMZ2_CRIGR        0.69  0.89    1   89   21  109   89    0    0  109  G3IMZ2     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_025299 PE=4 SV=1
  124 : H2RAG8_PANTR        0.69  0.89    1   94   21  114   94    0    0  115  H2RAG8     Uncharacterized protein OS=Pan troglodytes GN=LOC736872 PE=4 SV=1
  125 : H2RAG9_PANTR        0.69  0.88    2   90    1   89   89    0    0   96  H2RAG9     Uncharacterized protein (Fragment) OS=Pan troglodytes GN=LOC100611549 PE=4 SV=1
  126 : HV02_CANFA          0.69  0.79  110  227    1  117  118    1    1  117  P01785     Ig heavy chain V region MOO OS=Canis familiaris PE=1 SV=1
  127 : HVM38_MOUSE 3U0W    0.69  0.81  110  227    1  118  118    0    0  119  P01808     Ig heavy chain V region T601 OS=Mus musculus PE=1 SV=1
  128 : K7T952_MOUSE        0.69  0.86  118  227    1  112  113    3    4  112  K7T952     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  129 : K7TDP0_MOUSE        0.69  0.82  118  227    1  111  113    2    5  111  K7TDP0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  130 : K7TGZ8_MOUSE        0.69  0.86  118  227    1  110  112    3    4  110  K7TGZ8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  131 : K7THB6_MOUSE        0.69  0.79  118  227    1  111  112    2    3  111  K7THB6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  132 : Q0ZCG4_HUMAN        0.69  0.81  111  227    3  122  121    2    5  122  Q0ZCG4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  133 : Q0ZCJ4_HUMAN        0.69  0.82  111  224    3  120  120    2    8  120  Q0ZCJ4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  134 : Q96SA9_HUMAN        0.69  0.86    1  108    1  106  108    1    2  107  Q96SA9     Anti-streptococcal/anti-myosin immunoglobulin kappa light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  135 : Q9UL70_HUMAN        0.69  0.82    1  108    1  107  108    1    1  108  Q9UL70     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  136 : A2NYV3_HUMAN        0.68  0.86    4  108    2  105  105    1    1  105  A2NYV3     Light chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
  137 : F1LZY6_RAT          0.68  0.82    1  107    1  107  107    0    0  108  F1LZY6     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  138 : F6V876_MACMU        0.68  0.87    1   90   23  112   90    0    0  117  F6V876     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  139 : F7HD13_MACMU        0.68  0.87    1   92    1   92   92    0    0   92  F7HD13     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  140 : G1QD73_MYOLU        0.68  0.81  110  221    1  112  115    2    6  118  G1QD73     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  141 : G3S4V4_GORGO        0.68  0.88    1   94   23  116   94    0    0  116  G3S4V4     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  142 : H2P5I1_PONAB        0.68  0.86    1   96   23  118   96    0    0  118  H2P5I1     Uncharacterized protein OS=Pongo abelii GN=LOC100939563 PE=4 SV=1
  143 : H9KXI1_CALJA        0.68  0.81  110  220   20  136  118    3    8  136  H9KXI1     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  144 : HV320_HUMAN         0.68  0.82  110  227    1  116  118    1    2  116  P01781     Ig heavy chain V-III region GAL OS=Homo sapiens PE=1 SV=1
  145 : HVM37_MOUSE         0.68  0.81  110  227    1  118  118    0    0  119  P01807     Ig heavy chain V region X44 OS=Mus musculus PE=1 SV=1
  146 : HVM39_MOUSE         0.68  0.80  110  227    1  117  118    1    1  118  P01809     Ig heavy chain V region X24 OS=Mus musculus PE=1 SV=1
  147 : K7TH23_MOUSE        0.68  0.81  118  227    1  111  112    2    3  111  K7TH23     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  148 : K7U5W1_MOUSE        0.68  0.82  118  227    1  109  111    2    3  109  K7U5W1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  149 : KV108_HUMAN 1F6L    0.68  0.85    1  108    1  107  108    1    1  108  P01600     Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1
  150 : Q0ZCF9_HUMAN        0.68  0.80  111  227    1  118  121    2    7  118  Q0ZCF9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  151 : Q0ZCG5_HUMAN        0.68  0.81  111  227    3  122  121    2    5  122  Q0ZCG5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  152 : Q0ZCG9_HUMAN        0.68  0.82  111  227    3  121  120    2    4  121  Q0ZCG9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  153 : Q0ZCH8_HUMAN        0.68  0.81  111  224    1  113  116    2    5  113  Q0ZCH8     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  154 : Q2VR03_MOUSE        0.68  0.84  110  227    1  123  123    2    5  123  Q2VR03     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  155 : Q2VT24_MOUSE        0.68  0.84  110  227    1  124  125    3    8  124  Q2VT24     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  156 : Q9UL72_HUMAN        0.68  0.82  110  227    1  118  120    3    4  118  Q9UL72     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  157 : A0N8J1_HUMAN        0.67  0.83    1   90    5   94   90    0    0   99  A0N8J1     V(k)3 sequence of NG9 gene from fetal liver DNA (Precursor) OS=Homo sapiens PE=4 SV=1
  158 : A2IPI4_HUMAN        0.67  0.85    1  108    3  109  108    1    1  113  A2IPI4     HRV Fab 025-VL (Fragment) OS=Homo sapiens PE=2 SV=1
  159 : A2JA16_HUMAN        0.67  0.84    1  108    1  107  108    1    1  107  A2JA16     Anti-mucin1 light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  160 : A2N192_HUMAN        0.67  0.80  110  229   18  143  126    1    6  151  A2N192     Immunglobulin heavy chain (Precursor) OS=Homo sapiens GN=IGH@ PE=2 SV=1
  161 : G1PZF7_MYOLU        0.67  0.81  110  221    1  118  119    3    8  123  G1PZF7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  162 : G1Q8U3_MYOLU        0.67  0.77  110  218   20  133  117    2   11  142  G1Q8U3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  163 : G7PN14_MACFA        0.67  0.86    1   96    1   96   96    0    0   97  G7PN14     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_05145 PE=4 SV=1
  164 : G7PN21_MACFA        0.67  0.84    2   90   24  112   89    0    0  117  G7PN21     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_05152 PE=4 SV=1
  165 : G8F1B7_MACMU        0.67  0.85    1   89   23  111   89    0    0  111  G8F1B7     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21166 PE=4 SV=1
  166 : H0X5X8_OTOGA        0.67  0.87    1   90    3   92   90    0    0  110  H0X5X8     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  167 : H0XIX5_OTOGA        0.67  0.88    2   90   22  110   89    0    0  115  H0XIX5     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  168 : HVM40_MOUSE 2FBJ    0.67  0.81  110  227    1  118  118    0    0  119  P01810     Ig heavy chain V region J539 OS=Mus musculus PE=1 SV=1
  169 : HVM42_MOUSE         0.67  0.81  110  227    1  117  118    1    1  117  P01812     Ig heavy chain V region MOPC 173 OS=Mus musculus PE=1 SV=1
  170 : Q0ZCG0_HUMAN        0.67  0.80  111  227    1  118  121    2    7  118  Q0ZCG0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  171 : Q0ZCH0_HUMAN        0.67  0.83  111  227    2  119  121    2    7  119  Q0ZCH0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  172 : Q0ZCI1_HUMAN        0.67  0.86  111  227    2  118  118    2    2  118  Q0ZCI1     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  173 : Q0ZCI6_HUMAN        0.67  0.80  111  227    3  122  122    2    7  122  Q0ZCI6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  174 : Q0ZCI9_HUMAN        0.67  0.79  110  227    1  126  126    2    8  126  Q0ZCI9     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  175 : Q2VT26_MOUSE        0.67  0.83  110  227    1  123  124    3    7  123  Q2VT26     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus GN=EG380809 PE=2 SV=1
  176 : Q9UL77_HUMAN2BX5    0.67  0.85    1  108    1  107  108    1    1  108  Q9UL77     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  177 : A0N5T8_9MURI        0.66  0.82  110  227    1  125  125    2    7  125  A0N5T8     Anti-hepatitis B virus core antigen MoAb C1-5 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  178 : A2JA18_HUMAN        0.66  0.80  110  227    1  117  118    1    1  117  A2JA18     Anti-mucin1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  179 : A2NZ55_HUMAN        0.66  0.84  110  228    1  124  124    2    5  131  A2NZ55     Variable immnoglobulin anti-estradiol heavy chain (Fragment) OS=Homo sapiens PE=2 SV=1
  180 : F6RBD0_MACMU        0.66  0.84    1   89   23  111   89    0    0  111  F6RBD0     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  181 : F6VFU7_MACMU        0.66  0.84    1   92   23  114   92    0    0  114  F6VFU7     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  182 : F7A2M2_MACMU        0.66  0.83    1   96    1   96   96    0    0   97  F7A2M2     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  183 : F7C890_MACMU        0.66  0.84    1   90   23  112   90    0    0  117  F7C890     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  184 : G1Q803_MYOLU        0.66  0.82  110  227    1  117  119    2    3  117  G1Q803     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  185 : G1QCV9_MYOLU        0.66  0.83  110  219    1  110  111    2    2  119  G1QCV9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  186 : G1QE02_MYOLU        0.66  0.78  110  217   20  130  114    2    9  139  G1QE02     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  187 : G3S8U8_GORGO        0.66  0.84    1   96   23  118   96    0    0  118  G3S8U8     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  188 : G7NAZ1_MACMU        0.66  0.84    1   96    1   96   96    0    0   97  G7NAZ1     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_05701 PE=4 SV=1
  189 : G7PN17_MACFA        0.66  0.84    1   96   23  118   96    0    0  118  G7PN17     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_05148 PE=4 SV=1
  190 : G8F1J9_MACMU        0.66  0.84    1   90   23  112   90    0    0  112  G8F1J9     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21315 PE=4 SV=1
  191 : H0V8W1_CAVPO        0.66  0.84    1   91    1   91   91    0    0  108  H0V8W1     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
  192 : H2R6N5_PANTR        0.66  0.83    1   90   13  101   90    1    1  106  H2R6N5     Uncharacterized protein (Fragment) OS=Pan troglodytes GN=LOC749742 PE=4 SV=1
  193 : K7TDT3_MOUSE        0.66  0.82  119  227    1  109  110    2    2  109  K7TDT3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  194 : K7TR23_MOUSE        0.66  0.80  118  227    1  111  113    2    5  111  K7TR23     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  195 : K9J494_DESRO        0.66  0.81  110  232   37  162  129    2    9  171  K9J494     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  196 : Q0ZCH1_HUMAN        0.66  0.79  111  227    2  118  121    2    8  118  Q0ZCH1     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  197 : Q0ZCH5_HUMAN        0.66  0.79  111  227    3  119  121    2    8  119  Q0ZCH5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  198 : Q0ZCI3_HUMAN        0.66  0.78  111  227    3  124  123    2    7  124  Q0ZCI3     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  199 : Q0ZCI5_HUMAN        0.66  0.77  111  227    3  121  122    2    8  121  Q0ZCI5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  200 : Q2VT28_MOUSE        0.66  0.83  110  227    1  123  124    3    7  123  Q2VT28     Anti-lipoteichoic acid heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  201 : A0N5G1_HUMAN        0.65  0.85    1  108    1  107  108    1    1  116  A0N5G1     Rheumatoid factor C6 light chain (Fragment) OS=Homo sapiens GN=V1 PE=2 SV=1
  202 : A2IPI6_HUMAN        0.65  0.83    1  108    3  109  108    1    1  113  A2IPI6     HRV Fab 027-VL (Fragment) OS=Homo sapiens PE=2 SV=1
  203 : A2JA19_HUMAN        0.65  0.81    1  108    1  107  108    1    1  107  A2JA19     Anti-mucin1 light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  204 : A2KD66_LAMGL        0.65  0.80  110  227    1  114  118    3    4  114  A2KD66     R9 protein (Fragment) OS=Lama glama GN=r9 PE=4 SV=1
  205 : A2MYE1_HUMAN        0.65  0.83    1   96    1   96   96    0    0   96  A2MYE1     A30 (Fragment) OS=Homo sapiens PE=4 SV=1
  206 : A2NMA2_MOUSE        0.65  0.79  110  227    1  117  120    3    5  117  A2NMA2     Anti-carcinoma embryonic antigen heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  207 : A2NYQ9_HUMAN        0.65  0.87  110  227    1  120  120    1    2  120  A2NYQ9     Anti-folate binding protein (Fragment) OS=Homo sapiens GN=HuVH8B VH PE=2 SV=1
  208 : F7CUV4_MACMU        0.65  0.82    1   96    1   96   96    0    0   97  F7CUV4     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  209 : F7HD11_MACMU        0.65  0.86    1   96    1   96   96    0    0   97  F7HD11     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  210 : G1Q1H9_MYOLU        0.65  0.82  110  219    1  106  110    1    4  114  G1Q1H9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  211 : G1QC73_MYOLU        0.65  0.80  110  218    1  117  118    2   10  127  G1QC73     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  212 : G3QD17_GORGO        0.65  0.83    1   99    1   99   99    0    0  100  G3QD17     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  213 : G3S5I9_GORGO        0.65  0.83    2  104    1  103  103    0    0  108  G3S5I9     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=IGKV1D-43 PE=4 SV=1
  214 : HVM35_MOUSE         0.65  0.83  115  227    1  111  115    3    6  111  P01804     Ig heavy chain V-III region HPC76 (Fragment) OS=Mus musculus PE=4 SV=1
  215 : HVM41_MOUSE 1UZ8    0.65  0.80  110  227    1  117  119    2    3  117  P01811     Ig heavy chain V region UPC10 OS=Mus musculus PE=1 SV=1
  216 : K7T9G9_MOUSE        0.65  0.77  118  227    1  111  113    2    5  111  K7T9G9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  217 : K7TRS8_MOUSE        0.65  0.81  118  227    1  112  113    3    4  112  K7TRS8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  218 : K7U6K0_MOUSE        0.65  0.80  118  227    1  110  113    2    6  110  K7U6K0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  219 : K9J492_DESRO        0.65  0.79  110  232   14  139  126    1    3  148  K9J492     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  220 : KV103_HUMAN         0.65  0.83    1  108    1  107  108    1    1  108  P01595     Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1
  221 : KV110_HUMAN         0.65  0.87    1   93   23  115   93    0    0  117  P01602     Ig kappa chain V-I region HK102 (Fragment) OS=Homo sapiens GN=IGKV1-5 PE=4 SV=1
  222 : KV122_HUMAN         0.65  0.85    1  108    1  107  108    1    1  108  P04430     Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1
  223 : KV123_HUMAN 3UPA    0.65  0.83    1  108   23  129  108    1    1  129  P04431     Ig kappa chain V-I region Walker OS=Homo sapiens PE=1 SV=1
  224 : M0R789_RAT          0.65  0.84    1   96    1   96   96    0    0   97  M0R789     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  225 : Q0ZCF2_HUMAN        0.65  0.80  111  227    3  122  122    3    7  122  Q0ZCF2     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  226 : Q0ZCI4_HUMAN        0.65  0.79  111  227    3  125  126    2   12  125  Q0ZCI4     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  227 : Q0ZCJ6_HUMAN        0.65  0.80  111  227    3  125  123    2    6  125  Q0ZCJ6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  228 : Q9UL71_HUMAN        0.65  0.81  110  227    1  121  124    2    9  121  Q9UL71     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  229 : Q9UL79_HUMAN        0.65  0.81    1  108    1  107  108    1    1  108  Q9UL79     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  230 : A0N5G7_HUMAN        0.64  0.78  117  230    1  117  118    2    5  119  A0N5G7     Rheumatoid factor D5 heavy chain (Fragment) OS=Homo sapiens GN=VH3 PE=2 SV=1
  231 : A2IPI0_HUMAN        0.64  0.85    1  108    3  109  108    1    1  113  A2IPI0     HRV Fab N6-VL (Fragment) OS=Homo sapiens PE=2 SV=1
  232 : A2J1N6_HUMAN        0.64  0.79  113  221    1  114  114    2    5  115  A2J1N6     Rheumatoid factor RF-ET9 (Fragment) OS=Homo sapiens PE=2 SV=1
  233 : A2JA17_HUMAN        0.64  0.78  110  227    1  117  118    1    1  117  A2JA17     Anti-mucin1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  234 : A2KD54_LAMGL        0.64  0.77  110  227    1  120  120    1    2  120  A2KD54     Hi6 protein (Fragment) OS=Lama glama GN=hi6 PE=4 SV=1
  235 : A2KD56_LAMGL        0.64  0.80  110  227    1  118  121    2    6  118  A2KD56     Hi15 protein (Fragment) OS=Lama glama GN=hi15 PE=4 SV=1
  236 : A2MYE2_HUMAN        0.64  0.83    1   96    1   96   96    0    0   96  A2MYE2     A30 protein (Fragment) OS=Homo sapiens GN=A30 PE=4 SV=1
  237 : A2NI60_HUMAN2Q1E    0.64  0.85    1  108    1  107  108    1    1  108  A2NI60     BRE (Fragment) OS=Homo sapiens PE=2 SV=1
  238 : A2NKM6_HUMAN        0.64  0.82  113  228    1  116  119    2    6  121  A2NKM6     NANUC-1 heavy chain (Fragment) OS=Homo sapiens PE=2 SV=1
  239 : B1N7B6_HUMAN        0.64  0.80  110  227    1  120  122    2    6  120  B1N7B6     Cryocrystalglobulin CC1 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  240 : B5UB71_MOUSE        0.64  0.81    1  108    1  107  108    1    1  109  B5UB71     EP3-31 light chain variable region (Fragment) OS=Mus musculus GN=EP3-31VL PE=2 SV=1
  241 : F6UNC0_MACMU        0.64  0.85    1   95   21  115   95    0    0  115  F6UNC0     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  242 : F7A8H2_MACMU        0.64  0.79    2   97    1   96   96    0    0  109  F7A8H2     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=IGKV1-27 PE=4 SV=1
  243 : G1PZY6_MYOLU        0.64  0.77  110  219    1  115  117    2    9  122  G1PZY6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  244 : G1Q0I1_MYOLU        0.64  0.79  110  226    1  117  118    2    2  118  G1Q0I1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  245 : G1Q1S8_MYOLU        0.64  0.79  110  226    1  118  118    1    1  119  G1Q1S8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  246 : G1Q5X1_MYOLU        0.64  0.81  110  223    1  114  117    2    6  118  G1Q5X1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  247 : G1QBP2_MYOLU        0.64  0.77  110  218    1  121  121    1   12  130  G1QBP2     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  248 : H9H4H5_MACMU        0.64  0.84    1   96    1   96   96    0    0   97  H9H4H5     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  249 : H9KYK3_CALJA        0.64  0.80  110  218    1  109  111    3    4  123  H9KYK3     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  250 : HV01_CANFA          0.64  0.81  110  227    1  114  118    2    4  114  P01784     Ig heavy chain V region GOM OS=Canis familiaris PE=1 SV=1
  251 : HV306_HUMAN         0.64  0.82  110  227    1  115  118    2    3  115  P01767     Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1
  252 : HV307_HUMAN         0.64  0.81  110  227    1  122  122    1    4  122  P01768     Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1
  253 : HV310_HUMAN         0.64  0.80  110  227    1  121  122    2    5  121  P01771     Ig heavy chain V-III region HIL OS=Homo sapiens PE=1 SV=1
  254 : HVM30_MOUSE         0.64  0.81  110  225    1  113  118    2    7  113  P01799     Ig heavy chain V-III region ABE-47N OS=Mus musculus PE=1 SV=1
  255 : I3MN52_SPETR        0.64  0.85    1   89   21  109   89    0    0  109  I3MN52     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
  256 : I3MYZ9_SPETR        0.64  0.83    1   90    1   90   90    0    0  108  I3MYZ9     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  257 : I3NCK3_SPETR        0.64  0.78    1   90    1   90   90    0    0  108  I3NCK3     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  258 : I3NEG3_SPETR        0.64  0.80    1   92    1   92   92    0    0  107  I3NEG3     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  259 : K7TD58_MOUSE        0.64  0.80  118  227    1  111  113    3    5  111  K7TD58     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  260 : K7TDR2_MOUSE        0.64  0.82  117  227    1  111  114    3    6  111  K7TDR2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  261 : K7TR54_MOUSE        0.64  0.82  118  227    1  112  112    1    2  112  K7TR54     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  262 : K7U5S0_MOUSE        0.64  0.81  118  227    1  112  112    1    2  112  K7U5S0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  263 : KV104_HUMAN         0.64  0.87    1   90    1   90   90    0    0  107  P01596     Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1
  264 : KV109_HUMAN         0.64  0.81    1   95   23  117   95    0    0  117  P01601     Ig kappa chain V-I region HK101 (Fragment) OS=Homo sapiens PE=4 SV=1
  265 : KV112_HUMAN         0.64  0.83    1  108    1  107  108    1    1  108  P01604     Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1
  266 : KV118_HUMAN         0.64  0.82    1  108    1  107  108    1    1  108  P01610     Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1
  267 : KV119_HUMAN         0.64  0.86    1  108    1  107  108    1    1  108  P01611     Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1
  268 : Q0ZCF5_HUMAN        0.64  0.80  111  227    3  122  122    3    7  122  Q0ZCF5     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  269 : Q9Y509_HUMAN        0.64  0.80  110  229    1  128  128    2    8  147  Q9Y509     VH3 protein (Fragment) OS=Homo sapiens GN=VH3 PE=1 SV=1
  270 : A0N5G2_HUMAN        0.63  0.79  117  230    1  117  117    1    3  119  A0N5G2     Rheumatoid factor C6 heavy chain (Fragment) OS=Homo sapiens GN=VH3 PE=2 SV=1
  271 : A2KD53_LAMGL        0.63  0.80  110  227    1  117  120    2    5  117  A2KD53     H14 protein (Fragment) OS=Lama glama GN=h14 PE=4 SV=1
  272 : A2KD61_LAMGL        0.63  0.78  110  227    1  115  118    2    3  115  A2KD61     R4 protein (Fragment) OS=Lama glama GN=r4 PE=4 SV=1
  273 : A2MY60_MOUSE        0.63  0.81    1  108    1  107  108    1    1  107  A2MY60     Kappa (Fragment) OS=Mus musculus GN=kappa PE=2 SV=1
  274 : A2MYC7_9MURI        0.63  0.81    1  108    1  107  108    1    1  107  A2MYC7     MA-15 light chain (Fragment) OS=Mus sp. PE=2 SV=1
  275 : G1FM85_HUMAN        0.63  0.77  110  227    1  129  131    2   15  129  G1FM85     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  276 : G1Q676_MYOLU        0.63  0.79  113  227    4  122  119    2    4  122  G1Q676     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  277 : G1Q696_MYOLU        0.63  0.83  110  224    1  114  115    1    1  117  G1Q696     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  278 : G1Q6G1_MYOLU        0.63  0.81  110  226    1  117  118    2    2  118  G1Q6G1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  279 : G1SAA2_NOMLE        0.63  0.83    1   89    1   89   89    0    0   89  G1SAA2     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=LOC100586815 PE=4 SV=1
  280 : G1T6G3_RABIT        0.63  0.83    1   92    1   92   92    0    0  100  G1T6G3     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  281 : G1TPF8_RABIT        0.63  0.82    1   91    1   91   91    0    0  108  G1TPF8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  282 : G3RRY1_GORGO        0.63  0.80    2  104    4  106  103    0    0  112  G3RRY1     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  283 : G3U3S5_LOXAF        0.63  0.81    1   95   30  124   95    0    0  124  G3U3S5     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  284 : G7PMP4_MACFA        0.63  0.81    1  108   23  124  108    1    6  125  G7PMP4     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_05004 PE=4 SV=1
  285 : G8F1K1_MACMU        0.63  0.80    1  108   23  124  108    1    6  125  G8F1K1     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_21317 PE=4 SV=1
  286 : G8F1X3_MACMU        0.63  0.83    1   95   23  117   95    0    0  117  G8F1X3     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21523 PE=4 SV=1
  287 : H0XRL1_OTOGA        0.63  0.84    1   90    1   90   90    0    0  103  H0XRL1     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  288 : H0XSM5_OTOGA        0.63  0.82    1   91   21  111   91    0    0  117  H0XSM5     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  289 : H2P5H6_PONAB        0.63  0.83    2   95    2   95   94    0    0   97  H2P5H6     Uncharacterized protein (Fragment) OS=Pongo abelii PE=4 SV=1
  290 : H2R7U4_PANTR        0.63  0.87    1   90   13  102   90    0    0  107  H2R7U4     Uncharacterized protein (Fragment) OS=Pan troglodytes GN=LOC459392 PE=4 SV=1
  291 : H9H465_MACMU        0.63  0.81  110  227    1  120  121    2    4  120  H9H465     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  292 : HV302_HUMAN         0.63  0.83  110  227    1  114  118    2    4  114  P01763     Ig heavy chain V-III region WEA OS=Homo sapiens PE=1 SV=1
  293 : HV305_HUMAN         0.63  0.78  110  222    1  120  121    2    9  120  P01766     Ig heavy chain V-III region BRO OS=Homo sapiens PE=1 SV=1
  294 : HVM27_MOUSE         0.63  0.81  110  225    1  113  118    2    7  113  P01796     Ig heavy chain V-III region A4 OS=Mus musculus PE=1 SV=1
  295 : HVM31_MOUSE         0.63  0.81  110  225    1  113  118    2    7  113  P01800     Ig heavy chain V-III region T957 OS=Mus musculus PE=1 SV=2
  296 : I3N035_SPETR        0.63  0.86    1   90    1   90   90    0    0  107  I3N035     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  297 : K7TQY2_MOUSE        0.63  0.80  118  227    1  110  112    2    4  110  K7TQY2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  298 : K7TRH7_MOUSE        0.63  0.79  118  227    1  112  114    3    6  112  K7TRH7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  299 : KV105_HUMAN         0.63  0.85    2   94    2   94   93    0    0  108  P01597     Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1
  300 : KV125_HUMAN 1WTL    0.63  0.86    1  108    1  107  108    1    1  108  P80362     Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1
  301 : M0R709_RAT          0.63  0.77  110  229    1  115  120    1    5  118  M0R709     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  302 : Q9UL84_HUMAN        0.63  0.79  110  227    1  122  124    2    8  122  Q9UL84     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  303 : A2J1C8_MOUSE        0.62  0.81  110  227    1  117  120    3    5  117  A2J1C8     McAB 0.1C3 mmunoglobulin heavy chain (Fragment) OS=Mus musculus PE=2 SV=1
  304 : A2NYV1_HUMAN        0.62  0.76  110  227    1  128  128    2   10  128  A2NYV1     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
  305 : B6EDE2_HUMAN        0.62  0.79  111  227    2  123  122    2    5  123  B6EDE2     Epididymis luminal protein 180 (Fragment) OS=Homo sapiens GN=HEL180 PE=2 SV=1
  306 : F6SD50_MACMU        0.62  0.82    1  104    1  104  104    0    0  108  F6SD50     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  307 : G1FM92_HUMAN        0.62  0.77  110  227    1  129  131    2   15  129  G1FM92     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  308 : G1FM93_HUMAN        0.62  0.76  110  227    1  129  131    2   15  129  G1FM93     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  309 : G1PYT3_MYOLU        0.62  0.78  110  217    1  108  113    2   10  118  G1PYT3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  310 : G1PZL3_MYOLU        0.62  0.77  110  219    1  110  115    3   10  118  G1PZL3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  311 : G1Q4P7_MYOLU        0.62  0.76  113  221    1  116  118    2   11  121  G1Q4P7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  312 : G1Q914_MYOLU        0.62  0.74  110  217   20  130  116    3   13  139  G1Q914     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  313 : G1TGT2_RABIT        0.62  0.84    3   89    1   87   87    0    0   94  G1TGT2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  314 : G3SGB1_GORGO        0.62  0.84    1   90    1   90   90    0    0  107  G3SGB1     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  315 : G3U7P7_LOXAF        0.62  0.73  110  217    1  110  111    2    4  119  G3U7P7     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  316 : H0V3H6_CAVPO        0.62  0.80    1  104    1  104  104    0    0  108  H0V3H6     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100735274 PE=4 SV=1
  317 : H0X319_OTOGA        0.62  0.85    2   95   22  115   94    0    0  115  H0X319     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  318 : H9H4W4_MACMU        0.62  0.83    1   95   23  117   95    0    0  117  H9H4W4     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  319 : H9KWV4_CALJA        0.62  0.76  110  220    1  116  122    3   17  123  H9KWV4     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  320 : H9KWZ0_CALJA        0.62  0.78  110  220    1  114  117    3    9  121  H9KWZ0     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  321 : HV304_HUMAN         0.62  0.78  110  227    1  115  120    3    7  115  P01765     Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1
  322 : HVM28_MOUSE         0.62  0.81  110  225    1  113  118    2    7  113  P01797     Ig heavy chain V-III region U61 OS=Mus musculus PE=1 SV=1
  323 : HVM32_MOUSE 1PZ5    0.62  0.82  110  227    1  115  120    2    7  115  P01801     Ig heavy chain V-III region J606 OS=Mus musculus PE=1 SV=1
  324 : HVM33_MOUSE         0.62  0.82  110  227    1  115  120    2    7  115  P01802     Ig heavy chain V-III region W3082 OS=Mus musculus PE=1 SV=1
  325 : I6U3W1_STRCA        0.62  0.80  111  227    2  122  123    2    8  122  I6U3W1     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  326 : I6U3W7_STRCA        0.62  0.80  111  227    2  123  123    2    7  123  I6U3W7     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  327 : K7T942_MOUSE        0.62  0.78  118  227    1  110  112    3    4  110  K7T942     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  328 : K7U5K6_MOUSE        0.62  0.79  118  227    1  110  112    2    4  110  K7U5K6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  329 : K7U672_MOUSE        0.62  0.79  118  227    1  112  114    3    6  112  K7U672     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  330 : KV101_HUMAN         0.62  0.82    1  108    1  107  108    1    1  108  P01593     Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1
  331 : KV102_HUMAN 1QP1    0.62  0.84    1  108    1  107  108    1    1  108  P01594     Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1
  332 : KV115_HUMAN 1REI    0.62  0.83    1  107    1  106  107    1    1  108  P01607     Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1
  333 : KV117_HUMAN         0.62  0.83    1  108    1  107  108    1    1  108  P01609     Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1
  334 : KV124_HUMAN         0.62  0.83    1  108   23  129  108    1    1  129  P04432     Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1
  335 : Q0ZCI2_HUMAN        0.62  0.75  111  227    3  122  123    2    9  122  Q0ZCI2     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  336 : A2NWX5_HUMAN        0.61  0.76  127  225   10  118  112    2   16  118  A2NWX5     VH-7 family (N54P3)D/J protein (Fragment) OS=Homo sapiens GN=VH-7 family (N54P3)D/J PE=4 SV=1
  337 : F1STC3_PIG          0.61  0.86    2   95   22  115   94    0    0  115  F1STC3     Uncharacterized protein OS=Sus scrofa GN=LOC100736924 PE=4 SV=2
  338 : F6XC02_ORNAN        0.61  0.78  110  218    1  115  116    3    8  124  F6XC02     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  339 : F7GWP3_MACMU        0.61  0.79    1  107   23  122  107    1    7  142  F7GWP3     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  340 : G1PYQ8_MYOLU        0.61  0.81  110  226    1  117  120    2    6  118  G1PYQ8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  341 : G1Q4Z9_MYOLU        0.61  0.75  111  219    1  117  119    2   12  125  G1Q4Z9     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  342 : G1Q6A7_MYOLU        0.61  0.79  110  219   20  131  117    2   12  161  G1Q6A7     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  343 : G1QE90_MYOLU        0.61  0.81  110  226    1  118  119    3    3  119  G1QE90     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  344 : G1TUF3_RABIT        0.61  0.84    2   89    6   93   88    0    0  103  G1TUF3     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  345 : G1TW85_RABIT        0.61  0.86    4   93    7   96   90    0    0   96  G1TW85     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  346 : G3IKK1_CRIGR        0.61  0.83    1  107   21  121  107    1    6  123  G3IKK1     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024404 PE=4 SV=1
  347 : G3RMG7_GORGO        0.61  0.81    2  102    4  104  101    0    0  113  G3RMG7     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  348 : G3VAS4_SARHA        0.61  0.82    2   90    2   90   89    0    0  110  G3VAS4     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
  349 : G7NAZ4_MACMU        0.61  0.82    1  104    1  104  104    0    0  108  G7NAZ4     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_05707 PE=4 SV=1
  350 : G7PMP5_MACFA        0.61  0.80    1  108   23  124  108    1    6  125  G7PMP5     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_05005 PE=4 SV=1
  351 : G7PN12_MACFA        0.61  0.83    1   95   23  117   95    0    0  117  G7PN12     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_05143 PE=4 SV=1
  352 : G8F1B6_MACMU        0.61  0.80    1  108   23  124  108    1    6  125  G8F1B6     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_21164 PE=4 SV=1
  353 : H0VZM4_CAVPO        0.61  0.84    1   98   23  119   98    1    1  119  H0VZM4     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100733785 PE=4 SV=1
  354 : H2P5I2_PONAB        0.61  0.80    1  108   23  124  108    1    6  125  H2P5I2     Uncharacterized protein OS=Pongo abelii GN=IGKV1D-17 PE=4 SV=2
  355 : H2P756_PONAB        0.61  0.80    1   96   23  118   96    0    0  118  H2P756     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
  356 : H9H4B2_MACMU        0.61  0.78    1  106   20  119  106    1    6  120  H9H4B2     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  357 : H9KXI7_CALJA        0.61  0.76  110  220    1  116  122    3   17  123  H9KXI7     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  358 : HV321_HUMAN         0.61  0.74  110  227    1  120  122    2    6  120  P01782     Ig heavy chain V-III region DOB OS=Homo sapiens PE=1 SV=1
  359 : HVM20_MOUSE 1MCP    0.61  0.75  110  227    1  122  124    3    8  122  P01789     Ig heavy chain V region M603 OS=Mus musculus PE=1 SV=1
  360 : HVM21_MOUSE         0.61  0.76  110  227    1  122  123    3    6  122  P01790     Ig heavy chain V region M511 OS=Mus musculus PE=1 SV=1
  361 : HVM24_MOUSE         0.61  0.76  110  227    1  123  123    2    5  123  P01793     Ig heavy chain V region HPCG13 OS=Mus musculus PE=1 SV=1
  362 : K7ETL4_PONAB        0.61  0.81    1  108   23  124  108    1    6  133  K7ETL4     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
  363 : K7ETN1_PONAB        0.61  0.80    1  108   23  124  108    1    6  125  K7ETN1     Uncharacterized protein OS=Pongo abelii GN=IGKV1-27 PE=4 SV=1
  364 : K7EVP5_PONAB        0.61  0.81    1  108   23  124  108    1    6  133  K7EVP5     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
  365 : K7U669_MOUSE        0.61  0.79  118  227    1  114  116    3    8  114  K7U669     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  366 : K9IQU5_DESRO        0.61  0.82  110  232   36  158  127    2    8  166  K9IQU5     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  367 : KV07_RABIT          0.61  0.84    2   89    2   89   88    0    0  108  P01688     Ig kappa chain V region K-25 OS=Oryctolagus cuniculus PE=1 SV=1
  368 : KV106_HUMAN         0.61  0.84    1  108    1  107  108    1    1  108  P01598     Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1
  369 : KV107_HUMAN         0.61  0.81    1  108    1  107  108    1    1  108  P01599     Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1
  370 : KV113_HUMAN         0.61  0.81    1  108    1  107  108    1    1  108  P01605     Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1
  371 : KV116_HUMAN         0.61  0.86    1  108    1  107  108    1    1  108  P01608     Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1
  372 : KV5A5_MOUSE         0.61  0.79    1  108   21  127  108    1    1  128  P01637     Ig kappa chain V-V region T1 OS=Mus musculus PE=4 SV=1
  373 : L7N0K2_CANFA        0.61  0.76  110  222    1  116  119    2    9  121  L7N0K2     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=1
  374 : Q0ZCF6_HUMAN        0.61  0.76  111  227    3  129  127    2   10  129  Q0ZCF6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  375 : Q8K1F1_MOUSE        0.61  0.79    1  108    1  108  109    2    2  114  Q8K1F1     Anti-VIPase light chain variable region (Fragment) OS=Mus musculus GN=Gm1418 PE=4 SV=1
  376 : A0N6R0_9MURI        0.60  0.82    1  107    1  106  107    1    1  106  A0N6R0     Rheumatoid factor RF3-2C (Fragment) OS=Mus sp. GN=Ig V PE=2 SV=1
  377 : A2NXP8_HUMAN        0.60  0.81  110  227    1  123  124    2    7  123  A2NXP8     Heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  378 : B1N7B7_HUMAN        0.60  0.78  110  227    1  121  124    2    9  121  B1N7B7     Cryocrystalglobulin CC2 heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  379 : F6ZVQ0_ORNAN        0.60  0.76  110  218    1  113  116    4   10  122  F6ZVQ0     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  380 : G1FM90_HUMAN        0.60  0.76  110  227    1  129  131    2   15  129  G1FM90     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  381 : G1Q274_MYOLU        0.60  0.76  110  220    1  113  117    3   10  120  G1Q274     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  382 : G1QCW0_MYOLU        0.60  0.73  110  231   23  151  132    3   13  157  G1QCW0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  383 : G1TVN7_RABIT        0.60  0.82    1   99   24  122   99    0    0  122  G1TVN7     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
  384 : G3IKD7_CRIGR        0.60  0.81    1  106   23  122  106    1    6  125  G3IKD7     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024338 PE=4 SV=1
  385 : G3RT85_GORGO        0.60  0.81    1  104    1  104  104    0    0  108  G3RT85     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  386 : G3RYF4_GORGO        0.60  0.78    1  106   23  122  106    1    6  123  G3RYF4     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  387 : G8F154_MACMU        0.60  0.72  110  221   20  138  119    2    7  139  G8F154     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21347 PE=4 SV=1
  388 : G8F210_MACMU        0.60  0.78  110  227    1  121  122    3    5  121  G8F210     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21588 PE=4 SV=1
  389 : H0W3C0_CAVPO        0.60  0.84    1  104    1  104  104    0    0  109  H0W3C0     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100730177 PE=4 SV=1
  390 : H0XL64_OTOGA        0.60  0.77    1  108   21  127  108    1    1  127  H0XL64     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  391 : H9H2S9_MACMU        0.60  0.73  110  223   20  140  121    2    7  144  H9H2S9     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
  392 : H9KVQ0_CALJA        0.60  0.72  110  218    1  120  122    2   15  125  H9KVQ0     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  393 : HV309_HUMAN         0.60  0.80  110  227    1  119  121    2    5  119  P01770     Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1
  394 : HV311_HUMAN 2RCJ    0.60  0.78  110  227    1  126  127    2   10  126  P01772     Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1
  395 : HV313_HUMAN         0.60  0.74  110  224    1  119  121    2    8  119  P01774     Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1
  396 : HVM18_MOUSE         0.60  0.75  110  227    1  123  124    3    7  123  P01787     Ig heavy chain V regions TEPC 15/S107/HPCM1/HPCM2/HPCM3 OS=Mus musculus PE=1 SV=1
  397 : HVM19_MOUSE         0.60  0.75  110  227    1  123  124    3    7  123  P01788     Ig heavy chain V region H8 OS=Mus musculus PE=1 SV=1
  398 : HVM22_MOUSE         0.60  0.74  110  227    1  123  124    3    7  123  P01791     Ig heavy chain V region HPCM6 OS=Mus musculus PE=1 SV=1
  399 : HVM23_MOUSE         0.60  0.75  110  227    1  123  124    3    7  123  P01792     Ig heavy chain V region HPCG8 OS=Mus musculus PE=1 SV=1
  400 : HVM25_MOUSE         0.60  0.76  110  227    1  123  125    3    9  123  P01794     Ig heavy chain V region HPCG14 OS=Mus musculus PE=1 SV=1
  401 : HVM26_MOUSE         0.60  0.77  110  227   20  144  125    2    7  144  P01795     Ig heavy chain V region M167 OS=Mus musculus PE=1 SV=1
  402 : HVM29_MOUSE         0.60  0.81  110  225    1  113  118    2    7  113  P01798     Ig heavy chain V-III region E109 OS=Mus musculus PE=1 SV=1
  403 : HVR01_RAT           0.60  0.76  110  227   20  142  125    3    9  142  P01805     Ig heavy chain V region IR2 OS=Rattus norvegicus PE=4 SV=1
  404 : I6UXR8_STRCA        0.60  0.77  111  227    2  123  126    3   13  123  I6UXR8     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  405 : KV114_HUMAN         0.60  0.81    1  108    1  107  108    1    1  108  P01606     Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1
  406 : KV5A6_MOUSE         0.60  0.78    1   95   21  115   95    0    0  115  P01638     Ig kappa chain V-V region L6 (Fragment) OS=Mus musculus PE=4 SV=1
  407 : M0R4B9_RAT          0.60  0.80    1  103   21  117  103    1    6  117  M0R4B9     Uncharacterized protein OS=Rattus norvegicus GN=RGD1565252 PE=4 SV=1
  408 : M3X8N0_FELCA        0.60  0.77    1  103   23  119  103    1    6  119  M3X8N0     Uncharacterized protein OS=Felis catus PE=4 SV=1
  409 : Q9UL78_HUMAN        0.60  0.82    1  108    1  108  109    2    2  109  Q9UL78     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  410 : A0N6Y3_9MURI        0.59  0.84    1  108    1  107  108    1    1  107  A0N6Y3     F30C7 light chain variable region (Fragment) OS=Mus sp. GN=Ig VL PE=2 SV=1
  411 : A2IPH7_HUMAN        0.59  0.80  113  227    1  121  123    2   10  121  A2IPH7     HRV Fab 025-VH (Fragment) OS=Homo sapiens PE=2 SV=1
  412 : A2KD59_LAMGL1QD0    0.59  0.71  110  227    1  128  131    3   16  128  A2KD59     R2 protein (Fragment) OS=Lama glama GN=r2 PE=1 SV=1
  413 : A2KD67_LAMGL        0.59  0.72  110  227    1  128  131    3   16  128  A2KD67     R10 protein (Fragment) OS=Lama glama GN=r10 PE=4 SV=1
  414 : A2NKM7_HUMAN        0.59  0.74  114  229    1  133  133    1   17  133  A2NKM7     NANUC-2 heavy chain (Fragment) OS=Homo sapiens PE=2 SV=1
  415 : A2NVF0_MOUSE        0.59  0.81    1  108    1  107  108    1    1  108  A2NVF0     Immnuoglobulin kappa light chain (Fragment) OS=Mus musculus PE=4 SV=1
  416 : D2HUP7_AILME        0.59  0.78    1   96   23  118   96    0    0  118  D2HUP7     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_016015 PE=4 SV=1
  417 : D3ZXH4_RAT          0.59  0.82    1   98   21  117   98    1    1  117  D3ZXH4     Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1
  418 : F6S1K7_MACMU        0.59  0.83    1   90    4   93   90    0    0   98  F6S1K7     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  419 : F7ASQ3_MONDO        0.59  0.76  110  217   20  137  118    1   10  158  F7ASQ3     Uncharacterized protein OS=Monodelphis domestica GN=LOC100619427 PE=4 SV=2
  420 : F7B7J7_ORNAN        0.59  0.76  110  226    1  121  122    2    6  122  F7B7J7     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  421 : F7DQ70_MONDO        0.59  0.76  110  217   20  136  118    2   11  139  F7DQ70     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
  422 : F7E8Z5_MONDO        0.59  0.76  110  217   20  137  118    1   10  138  F7E8Z5     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
  423 : F7EQ27_ORNAN        0.59  0.76  110  220    1  110  112    2    3  122  F7EQ27     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100681637 PE=4 SV=1
  424 : G1Q9D5_MYOLU        0.59  0.73  112  220    1  123  124    2   16  130  G1Q9D5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  425 : G3IL03_CRIGR        0.59  0.81    1  107   21  121  107    1    6  123  G3IL03     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024561 PE=4 SV=1
  426 : G3VM20_SARHA        0.59  0.75    2  105    1  103  104    1    1  107  G3VM20     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
  427 : G7P8Z5_MACFA        0.59  0.73  110  223   20  140  121    2    7  144  G7P8Z5     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_17028 PE=4 SV=1
  428 : H2P764_PONAB        0.59  0.80    1  105   23  121  105    1    6  125  H2P764     Uncharacterized protein OS=Pongo abelii PE=4 SV=2
  429 : HVM17_MOUSE         0.59  0.75  110  227    1  117  120    3    5  117  P01786     Ig heavy chain V region MOPC 47A OS=Mus musculus PE=1 SV=1
  430 : HVM34_MOUSE         0.59  0.78  110  225    1  113  118    2    7  113  P01803     Ig heavy chain V region AMPC1 OS=Mus musculus PE=1 SV=1
  431 : I3N3H0_SPETR        0.59  0.81    1  104    1  104  104    0    0  109  I3N3H0     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  432 : I3N746_SPETR        0.59  0.74    1  104   21  124  104    0    0  129  I3N746     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
  433 : I6TTA4_STRCA        0.59  0.75  111  227    2  121  121    2    5  121  I6TTA4     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  434 : I6ULB2_STRCA        0.59  0.77  111  227    2  119  119    2    3  119  I6ULB2     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  435 : I6UVJ4_STRCA        0.59  0.77  111  227    2  124  124    3    8  124  I6UVJ4     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  436 : K7ETY1_PONAB        0.59  0.80    1  108   23  124  108    1    6  125  K7ETY1     Uncharacterized protein OS=Pongo abelii GN=LOC100939465 PE=4 SV=1
  437 : K7EVX7_PONAB        0.59  0.76    1  106   23  122  106    1    6  123  K7EVX7     Uncharacterized protein OS=Pongo abelii GN=LOC100939951 PE=4 SV=1
  438 : KV03_RABIT          0.59  0.77    1   93    2   94   93    0    0  109  P01684     Ig kappa chain V region 3374 OS=Oryctolagus cuniculus PE=1 SV=1
  439 : KV306_HUMAN         0.59  0.80    1  108    1  108  109    2    2  109  P01624     Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1
  440 : KV5AE_MOUSE 2VWE    0.59  0.81    1  108    1  107  108    1    1  108  P01647     Ig kappa chain V-V region HP 124E1 OS=Mus musculus PE=1 SV=1
  441 : M0R628_RAT          0.59  0.81    1  108    1  108  108    0    0  109  M0R628     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  442 : Q0ZCI0_HUMAN        0.59  0.77  111  227    2  122  124    3   10  122  Q0ZCI0     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  443 : Q9UL88_HUMAN        0.59  0.73  110  227    1  131  131    2   13  131  Q9UL88     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  444 : A0N586_9MURI        0.58  0.79    1  108   21  127  108    1    1  127  A0N586     Anti-CD4 mAb M-T151 variable region light chain (Fragment) OS=Mus sp. GN=Ig VL PE=2 SV=1
  445 : A2KD57_LAMGL2P49    0.58  0.75  110  227    1  132  132    2   14  132  A2KD57     Hi113 protein (Fragment) OS=Lama glama GN=hi113 PE=1 SV=1
  446 : A2KD65_LAMGL        0.58  0.73  110  227    1  128  131    3   16  128  A2KD65     R8 protein (Fragment) OS=Lama glama GN=r8 PE=4 SV=1
  447 : A2NVE9_MOUSE        0.58  0.81    1  108    1  107  108    1    1  108  A2NVE9     Immnuoglobulin kappa light chain (Fragment) OS=Mus musculus PE=4 SV=1
  448 : B1N7B8_HUMAN        0.58  0.83    1   90    1   90   90    0    0  107  B1N7B8     Cryocrystalglobulin CC1 kappa light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  449 : F7ASP4_MONDO        0.58  0.75  110  217   20  136  118    2   11  161  F7ASP4     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
  450 : F7DQ52_MONDO        0.58  0.76  110  217   20  137  118    1   10  158  F7DQ52     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
  451 : F7GBH6_MONDO        0.58  0.75    2   95   22  123  102    1    8  123  F7GBH6     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618001 PE=4 SV=2
  452 : G1FM91_HUMAN        0.58  0.74  110  227    1  129  131    2   15  129  G1FM91     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  453 : G1QAG0_MYOLU        0.58  0.72  110  221    1  127  127    2   15  133  G1QAG0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  454 : G3IL53_CRIGR        0.58  0.77   14  106   33  118   93    1    7  122  G3IL53     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024615 PE=4 SV=1
  455 : G3SBG7_GORGO        0.58  0.78    1  106   21  120  106    1    6  127  G3SBG7     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  456 : H0X621_OTOGA        0.58  0.76    2  106    1   99  105    1    6  100  H0X621     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  457 : H0XNP9_OTOGA        0.58  0.78    1  106    1  106  106    0    0  108  H0XNP9     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  458 : H9H6T6_MONDO        0.58  0.75  110  217   20  137  118    1   10  145  H9H6T6     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618709 PE=4 SV=2
  459 : H9H6T9_MONDO        0.58  0.75  110  217   20  137  118    1   10  156  H9H6T9     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618912 PE=4 SV=2
  460 : HV314_HUMAN         0.58  0.76  111  224    2  119  120    2    8  119  P01775     Ig heavy chain V-III region LAY OS=Homo sapiens PE=1 SV=1
  461 : HV315_HUMAN         0.58  0.76  110  224    1  117  119    2    6  117  P01776     Ig heavy chain V-III region WAS OS=Homo sapiens PE=1 SV=1
  462 : HV316_HUMAN         0.58  0.75  110  224    1  119  121    2    8  119  P01777     Ig heavy chain V-III region TEI OS=Homo sapiens PE=1 SV=1
  463 : HV319_HUMAN         0.58  0.76  110  224    1  115  116    2    2  115  P01780     Ig heavy chain V-III region JON OS=Homo sapiens PE=1 SV=1
  464 : I6UXQ7_STRCA        0.58  0.81  111  227    2  124  124    2    8  124  I6UXQ7     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  465 : K7DYQ1_MONDO        0.58  0.75  110  217   20  137  118    1   10  141  K7DYQ1     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=1
  466 : K7DYQ2_MONDO        0.58  0.75  110  217   20  137  118    1   10  153  K7DYQ2     Uncharacterized protein OS=Monodelphis domestica GN=LOC100618872 PE=4 SV=1
  467 : K7ET87_PONAB        0.58  0.77    1  108   23  124  108    1    6  125  K7ET87     Uncharacterized protein OS=Pongo abelii GN=IGKV1-5 PE=4 SV=1
  468 : K7EU93_PONAB        0.58  0.81    1  108   23  124  108    1    6  125  K7EU93     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
  469 : K7EUX4_PONAB        0.58  0.79    1  108   23  124  108    1    6  131  K7EUX4     Uncharacterized protein OS=Pongo abelii GN=LOC100939897 PE=4 SV=1
  470 : KV120_HUMAN         0.58  0.81    1  108    1  108  108    0    0  109  P01612     Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1
  471 : KV5AA_MOUSE         0.58  0.81    1  108    1  107  108    1    1  108  P01643     Ig kappa chain V-V region MOPC 173 OS=Mus musculus PE=1 SV=1
  472 : KV5AB_MOUSE 2ZJS    0.58  0.81    1  108    1  107  108    1    1  108  P01644     Ig kappa chain V-V region HP R16.7 OS=Mus musculus PE=1 SV=1
  473 : KV5AC_MOUSE 1A14    0.58  0.80    1  108    1  107  108    1    1  108  P01645     Ig kappa chain V-V region HP 93G7 OS=Mus musculus PE=1 SV=1
  474 : KV5AD_MOUSE 1DVF    0.58  0.81    1  108    1  107  108    1    1  108  P01646     Ig kappa chain V-V region HP 123E6 OS=Mus musculus PE=1 SV=1
  475 : KV5AF_MOUSE 1JFQ    0.58  0.81    1  108    1  107  108    1    1  108  P01648     Ig kappa chain V-V region HP 91A3 OS=Mus musculus PE=1 SV=1
  476 : L7N0L4_CANFA        0.58  0.72  110  224    1  131  132    2   18  134  L7N0L4     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=1
  477 : L9JM07_TUPCH        0.58  0.76    1  108   23  124  108    1    6  125  L9JM07     Ig kappa chain V-I region HK102 OS=Tupaia chinensis GN=TREES_T100021706 PE=4 SV=1
  478 : Q9UL81_HUMAN        0.58  0.81    1  105    1  105  105    0    0  107  Q9UL81     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  479 : Q9UL85_HUMAN        0.58  0.81    1  108    1  108  108    0    0  109  Q9UL85     Myosin-reactive immunoglobulin kappa chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  480 : A0N7I9_HUMAN        0.57  0.76  113  229    5  121  119    4    4  123  A0N7I9     F5-20 (Fragment) OS=Homo sapiens GN=F5-20 PE=1 SV=1
  481 : A2IPW9_MOUSE        0.57  0.78    1  108   21  127  108    1    1  127  A2IPW9     Immnogloblin light chain variable region (Precursor) OS=Mus musculus GN=Igkv9-124 PE=2 SV=1
  482 : A2KD62_LAMGL        0.57  0.69  110  227    1  128  131    3   16  128  A2KD62     R5 protein (Fragment) OS=Lama glama GN=r5 PE=4 SV=1
  483 : A2KD63_LAMGL        0.57  0.69  110  227    1  128  131    3   16  128  A2KD63     R6 protein (Fragment) OS=Lama glama GN=r6 PE=4 SV=1
  484 : A2N2G5_HUMAN        0.57  0.71  110  227    1  135  135    3   17  135  A2N2G5     VH87-2 protein (Fragment) OS=Homo sapiens GN=VH87-2 PE=2 SV=1
  485 : F1D882_MACMU        0.57  0.69  110  232   12  150  140    3   18  164  F1D882     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
  486 : F1M5X4_RAT          0.57  0.75  110  220    1  116  118    3    9  124  F1M5X4     Uncharacterized protein (Fragment) OS=Rattus norvegicus GN=LOC100362687 PE=4 SV=1
  487 : F6QNX1_ORNAN        0.57  0.75  112  218   21  126  111    2    9  139  F6QNX1     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=2
  488 : F7DSH4_MONDO        0.57  0.76  110  217   20  137  120    2   14  158  F7DSH4     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=2
  489 : G1R7H1_NOMLE        0.57  0.77    1  108   23  124  108    1    6  125  G1R7H1     Uncharacterized protein OS=Nomascus leucogenys GN=IGKV1-27 PE=4 SV=2
  490 : G3IKK2_CRIGR        0.57  0.79    1  107   34  133  107    2    7  135  G3IKK2     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024405 PE=4 SV=1
  491 : H0VN43_CAVPO        0.57  0.79    1   98    1   97   98    1    1   97  H0VN43     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100715793 PE=4 SV=1
  492 : H0XHT9_OTOGA        0.57  0.79    2  108    4  109  107    1    1  113  H0XHT9     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  493 : H0XU06_OTOGA        0.57  0.78    2  107    2  106  106    1    1  108  H0XU06     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  494 : H0Y1Y6_OTOGA        0.57  0.76    2  108    1  107  107    0    0  107  H0Y1Y6     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  495 : H2PUB0_PONAB        0.57  0.77    1  108   23  128  108    2    2  128  H2PUB0     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
  496 : HV317_HUMAN         0.57  0.76  110  224    1  116  117    2    3  116  P01778     Ig heavy chain V-III region ZAP OS=Homo sapiens PE=1 SV=1
  497 : HV318_HUMAN         0.57  0.76  110  224    1  116  119    2    7  116  P01779     Ig heavy chain V-III region TUR OS=Homo sapiens PE=1 SV=1
  498 : I3MTL7_SPETR        0.57  0.77    1  104    1  104  104    0    0  109  I3MTL7     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  499 : I3N872_SPETR        0.57  0.78    1  104    1  104  104    0    0  108  I3N872     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  500 : I6UXR3_STRCA        0.57  0.78  111  227    2  120  121    3    6  120  I6UXR3     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  501 : K7EEU0_ORNAN        0.57  0.74  110  218   20  127  113    2    9  155  K7EEU0     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=1
  502 : KV111_HUMAN         0.57  0.79    1  108    1  107  108    1    1  108  P01603     Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1
  503 : KV302_HUMAN         0.57  0.81    1  108    1  108  109    2    2  109  P01620     Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1
  504 : KV304_HUMAN         0.57  0.81    1  108    1  108  109    2    2  109  P01622     Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1
  505 : KV311_HUMAN         0.57  0.81    1  108   21  127  108    1    1  128  P06311     Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1
  506 : KV312_HUMAN         0.57  0.78    1  108   21  128  109    2    2  129  P18135     Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1
  507 : KV313_HUMAN         0.57  0.79    1  108   21  128  109    2    2  129  P18136     Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=2
  508 : KV5AM_MOUSE         0.57  0.76    1  108    1  107  108    1    1  108  P04946     Ig kappa chain V-V region NQ5-89.4 OS=Mus musculus PE=4 SV=1
  509 : L9JML7_TUPCH        0.57  0.77    1  108   23  124  108    1    6  125  L9JML7     Ig kappa chain V-I region Walker OS=Tupaia chinensis GN=TREES_T100021705 PE=4 SV=1
  510 : Q0ZCH6_HUMAN        0.57  0.71  111  227    2  131  132    3   17  131  Q0ZCH6     Immunglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=4 SV=1
  511 : Q2VT27_MOUSE        0.57  0.76    1  108    1  106  108    2    2  106  Q2VT27     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  512 : Q811C3_MOUSE        0.57  0.80    1  108   23  131  109    1    1  131  Q811C3     Imunoglobulin gamma-3 kappa chain (Precursor) OS=Mus musculus PE=2 SV=1
  513 : Q9JL76_MOUSE        0.57  0.74   11  108    1   97   98    1    1   97  Q9JL76     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  514 : Q9UL83_HUMAN        0.57  0.80    1  108    1  107  108    1    1  108  Q9UL83     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  515 : A0N275_MOUSE        0.56  0.78    1  108   20  125  108    2    2  127  A0N275     Antigen, B-cell receptor (Precursor) OS=Mus musculus PE=4 SV=1
  516 : A2IPI2_HUMAN        0.56  0.78    1  108    3  111  109    1    1  115  A2IPI2     HRV Fab N27-VL (Fragment) OS=Homo sapiens PE=2 SV=1
  517 : A2IPI3_HUMAN        0.56  0.79    1  108    3  110  109    2    2  114  A2IPI3     HRV Fab N28-VL (Fragment) OS=Homo sapiens PE=2 SV=1
  518 : A2IPI5_HUMAN        0.56  0.80    1  108    3  109  108    1    1  113  A2IPI5     HRV Fab 026-VL (Fragment) OS=Homo sapiens PE=2 SV=1
  519 : A2KD58_LAMGL        0.56  0.69  110  227    1  128  131    3   16  128  A2KD58     R1 protein (Fragment) OS=Lama glama GN=r1 PE=4 SV=1
  520 : A2KD60_LAMGL        0.56  0.69  110  227    1  128  131    3   16  128  A2KD60     R3 protein (Fragment) OS=Lama glama GN=r3 PE=4 SV=1
  521 : A2KD64_LAMGL        0.56  0.69  110  227    1  128  131    3   16  128  A2KD64     R7 protein (Fragment) OS=Lama glama GN=r7 PE=4 SV=1
  522 : A2N1N1_MOUSE        0.56  0.78    1  108   20  132  114    2    7  134  A2N1N1     B cell antigen receptor (Precursor) OS=Mus musculus PE=4 SV=1
  523 : A2NB46_HUMAN        0.56  0.80    1  108    1  108  109    2    2  109  A2NB46     Cold agglutinin FS-2 L-chain (Fragment) OS=Homo sapiens PE=2 SV=1
  524 : A2NXP9_HUMAN        0.56  0.79    1  108    1  109  109    1    1  110  A2NXP9     K light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  525 : F1D883_MACMU        0.56  0.69  110  232   12  150  140    3   18  164  F1D883     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
  526 : G1FM86_HUMAN        0.56  0.75  110  227    1  129  131    2   15  129  G1FM86     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  527 : G1LVU5_AILME        0.56  0.74    1  106   21  120  106    1    6  128  G1LVU5     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
  528 : G1THU7_RABIT        0.56  0.80    1   92    1   94   94    1    2  102  G1THU7     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  529 : G1TJE1_RABIT        0.56  0.77    2  106    1   98  105    1    7   99  G1TJE1     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=LOC100356529 PE=4 SV=1
  530 : G3U533_LOXAF        0.56  0.70  110  225    1  117  121    2    9  124  G3U533     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=LOC100668942 PE=4 SV=1
  531 : G3UBV3_LOXAF        0.56  0.74    1   98    1   97   98    1    1   97  G3UBV3     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  532 : G3UKA6_LOXAF        0.56  0.68  110  225    1  116  120    2    8  118  G3UKA6     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=LOC100670927 PE=4 SV=1
  533 : G3VBJ5_SARHA        0.56  0.79    2  105   22  128  108    2    5  132  G3VBJ5     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  534 : H0XHX3_OTOGA        0.56  0.78    1  108    1  107  108    1    1  116  H0XHX3     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  535 : H0XX49_OTOGA        0.56  0.79    1  107    1  101  107    1    6  102  H0XX49     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  536 : H9KXD8_CALJA        0.56  0.77    1  107    1  107  107    0    0  109  H9KXD8     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  537 : I3LW75_SPETR        0.56  0.80    1  108    3  109  108    1    1  113  I3LW75     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  538 : I3MVU9_SPETR        0.56  0.77    1  104   21  124  104    0    0  129  I3MVU9     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
  539 : I3N7Z4_SPETR        0.56  0.74    1   98    1   99   99    1    1  105  I3N7Z4     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  540 : I3NAP6_SPETR        0.56  0.73    1  108    1  102  108    1    6  106  I3NAP6     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  541 : I3NC61_SPETR        0.56  0.78    1  108    1  102  108    1    6  110  I3NC61     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  542 : I6U3W4_STRCA        0.56  0.74  111  227    2  122  124    2   10  122  I6U3W4     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  543 : K7T9S3_MOUSE        0.56  0.73  118  227    1  109  111    2    3  109  K7T9S3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  544 : K7U5Z8_MOUSE        0.56  0.79  118  227    1  109  111    2    3  109  K7U5Z8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  545 : K7U657_MOUSE        0.56  0.75  118  227    1  109  110    1    1  109  K7U657     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  546 : KV305_HUMAN         0.56  0.79    1  108    1  108  109    2    2  109  P01623     Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1
  547 : KV307_HUMAN         0.56  0.78    1  108    1  108  109    2    2  109  P04206     Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1
  548 : KV3AI_MOUSE         0.56  0.76    1  108    1  111  112    2    5  111  P01670     Ig kappa chain V-III region PC 6684 OS=Mus musculus PE=1 SV=1
  549 : KV3AK_MOUSE         0.56  0.75    1  108    1  111  112    2    5  111  P01672     Ig kappa chain V-III region PC 7940 OS=Mus musculus PE=1 SV=1
  550 : KV5A7_MOUSE         0.56  0.77    1  108   23  129  108    1    1  130  P01639     Ig kappa chain V-V region MOPC 41 OS=Mus musculus GN=Gm5571 PE=1 SV=1
  551 : KV5AG_MOUSE         0.56  0.80    1  108    1  107  108    1    1  108  P01649     Ig kappa chain V-V regions OS=Mus musculus PE=1 SV=1
  552 : KV5AH_MOUSE         0.56  0.76    1  108    1  107  108    1    1  108  P01650     Ig kappa chain V-V region UPC 61 OS=Mus musculus PE=1 SV=1
  553 : KV5AK_MOUSE         0.56  0.76    1  108    1  107  108    1    1  108  P01652     Ig kappa chain V-V region J606 OS=Mus musculus PE=1 SV=1
  554 : L9JML0_TUPCH        0.56  0.73    1  108   23  124  108    1    6  125  L9JML0     Ig kappa chain V-I region HK102 OS=Tupaia chinensis GN=TREES_T100021695 PE=4 SV=1
  555 : M0R8G6_RAT          0.56  0.76    1  103    1   97  103    1    6   97  M0R8G6     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  556 : Q2VR04_MOUSE        0.56  0.76    1  108    1  106  108    2    2  106  Q2VR04     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  557 : Q2VT29_MOUSE        0.56  0.74    1  108    1  106  108    2    2  106  Q2VT29     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-72 PE=2 SV=1
  558 : Q8K1F0_MOUSE        0.56  0.73    1  108    1  106  108    2    2  112  Q8K1F0     Anti-VIPase light chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
  559 : Q8VDD0_MOUSE        0.56  0.77    1  108   23  128  108    2    2  134  Q8VDD0     Anti-MOG Z12 variable light chain (Fragment) OS=Mus musculus GN=Igkv4-70 PE=2 SV=1
  560 : Q920E9_MOUSE        0.56  0.76    1  108    1  111  112    2    5  111  Q920E9     Pterin-mimicking anti-idiotope kappa chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
  561 : Q96PF6_HUMAN        0.56  0.81    1  108    1  107  108    1    1  116  Q96PF6     Kappa 1 light chain variable region (Fragment) OS=Homo sapiens GN=SDNK1 PE=4 SV=1
  562 : Q9JL78_MOUSE        0.56  0.76    9  108    1  101  101    1    1  101  Q9JL78     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus GN=Igkv4-91 PE=2 SV=1
  563 : Q9QXE9_MOUSE        0.56  0.79  110  227    1  117  118    1    1  117  Q9QXE9     Immunoglobulin heavy chain V-D-J region (Fragment) OS=Mus musculus GN=Igh PE=2 SV=1
  564 : A0N7G6_9MURI        0.55  0.74    9  108    1   99  100    1    1  100  A0N7G6     H2 (Fragment) OS=Mus sp. GN=Ig VL PE=2 SV=1
  565 : A2N494_MOUSE        0.55  0.78    1  108    1  113  114    2    7  114  A2N494     Aberrantly recombined kappa chain Vk8/J1 region (Fragment) OS=Mus musculus PE=4 SV=1
  566 : B5UB65_MOUSE        0.55  0.78    1  108    1  113  114    2    7  115  B5UB65     CP3-10 light chain variable region (Fragment) OS=Mus musculus GN=CP3-10VL PE=2 SV=1
  567 : F7GBG0_MONDO        0.55  0.73    2   95   22  123  102    1    8  123  F7GBG0     Uncharacterized protein OS=Monodelphis domestica GN=LOC100617959 PE=4 SV=1
  568 : F8SQR5_RAT          0.55  0.78    1  108    2  107  108    2    2  107  F8SQR5     Immunglobulin light chain variable region (Fragment) OS=Rattus norvegicus PE=2 SV=1
  569 : G1FM94_HUMAN        0.55  0.75  110  227    1  129  131    2   15  129  G1FM94     Anti-Influenza A hemagglutinin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  570 : G1TI63_RABIT        0.55  0.77    1  106    1  103  106    1    3  106  G1TI63     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  571 : G1TLA0_RABIT        0.55  0.77    4  105    4  102  102    1    3  104  G1TLA0     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  572 : G1TNC5_RABIT        0.55  0.78    2  106    2  103  105    1    3  108  G1TNC5     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  573 : G3U7C1_LOXAF        0.55  0.74    1   98    1   97   98    1    1   97  G3U7C1     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  574 : G3VA63_SARHA        0.55  0.76    2  108   22  131  110    1    3  132  G3VA63     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  575 : G3VGN7_SARHA        0.55  0.75    2  102   22  127  106    2    5  138  G3VGN7     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  576 : G7NAL4_MACMU        0.55  0.73    1  108   23  124  108    1    6  125  G7NAL4     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_05552 PE=4 SV=1
  577 : H0W6K0_CAVPO        0.55  0.81    1   98    3  105  104    2    7  105  H0W6K0     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
  578 : H0XRM7_OTOGA        0.55  0.76    2  107    1  104  106    1    2  106  H0XRM7     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  579 : H9KW43_CALJA        0.55  0.74  110  232   20  150  132    2   10  165  H9KW43     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  580 : HV308_HUMAN         0.55  0.80  110  227    1  122  122    1    4  122  P01769     Ig heavy chain V-III region GA OS=Homo sapiens PE=1 SV=1
  581 : HV312_HUMAN         0.55  0.77  110  226    1  118  123    2   11  119  P01773     Ig heavy chain V-III region BUR OS=Homo sapiens PE=1 SV=1
  582 : HV322_HUMAN 2FL5    0.55  0.74  110  227    1  118  121    3    6  118  P80419     Ig heavy chain V-III region GAR OS=Homo sapiens PE=1 SV=1
  583 : I3JA41_ORENI        0.55  0.76  116  224    1  109  110    2    2  112  I3JA41     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=IGHD (4 of 4) PE=4 SV=1
  584 : I3MVD1_SPETR        0.55  0.73    1  108    1  104  108    1    4  109  I3MVD1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  585 : I3MZS9_SPETR        0.55  0.72    1  108    1  104  108    1    4  108  I3MZS9     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  586 : I3NGY9_SPETR        0.55  0.74    1  104    1  104  104    0    0  108  I3NGY9     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  587 : I6UVI9_STRCA        0.55  0.74  111  227    2  123  125    2   11  123  I6UVI9     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  588 : K7FV56_PELSI        0.55  0.74    1   95   21  119   99    1    4  121  K7FV56     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  589 : K7TGS5_MOUSE        0.55  0.75  118  227    1  112  112    1    2  112  K7TGS5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  590 : K7THE2_MOUSE        0.55  0.73  118  227    1  113  113    2    3  113  K7THE2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  591 : K7U5S6_MOUSE        0.55  0.75  118  227    1  108  110    1    2  108  K7U5S6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  592 : KV04_RABIT          0.55  0.73    1  108    2  106  108    1    3  107  P01685     Ig kappa chain V region 4135 OS=Oryctolagus cuniculus PE=1 SV=1
  593 : KV06_RABIT          0.55  0.76    1  108    1  107  108    1    1  108  P01687     Ig kappa chain V region BS-5 OS=Oryctolagus cuniculus PE=1 SV=1
  594 : KV308_HUMAN         0.55  0.79    1  108   21  128  108    0    0  129  P04207     Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2
  595 : KV3AJ_MOUSE         0.55  0.77    1  108    1  111  112    2    5  111  P01671     Ig kappa chain V-III region PC 7175 OS=Mus musculus PE=1 SV=1
  596 : KV3AL_MOUSE         0.55  0.77    1  108    1  111  112    2    5  111  P01673     Ig kappa chain V-III region PC 2485/PC 4039 OS=Mus musculus PE=1 SV=1
  597 : KV404_HUMAN         0.55  0.74    1  108   21  133  114    2    7  134  P06314     Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1
  598 : KV5AL_MOUSE         0.55  0.75    1  108    1  107  108    1    1  108  P01653     Ig kappa chain V-V region W3082 OS=Mus musculus PE=1 SV=1
  599 : M3YD93_MUSPF        0.55  0.76    1  106   21  120  106    1    6  121  M3YD93     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
  600 : Q2VT25_MOUSE        0.55  0.74    1  108    1  106  108    2    2  106  Q2VT25     Anti-lipoteichoic acid light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  601 : Q65ZN3_MOUSE        0.55  0.76    1  107    1  111  111    1    4  111  Q65ZN3     Rheumatoid factor RF10-2 (Fragment) OS=Mus musculus GN=Ig Vkappa PE=2 SV=1
  602 : Q65ZR6_MOUSE        0.55  0.76  110  227   18  134  119    2    3  134  Q65ZR6     Ab 126.33 heavy chain variable and joining regions (Fragment) OS=Mus musculus GN=Igh PE=2 SV=1
  603 : Q8K1F2_MOUSE1QOK    0.55  0.77    1  108    1  106  108    2    2  112  Q8K1F2     Anti-VIPase light chain variable region (Fragment) OS=Mus musculus GN=Gm189 PE=1 SV=1
  604 : Q925S9_MOUSE        0.55  0.77    1  108   21  127  108    1    1  127  Q925S9     Immunoglobulin light chain (Fragment) OS=Mus musculus GN=Igkv9-120 PE=2 SV=1
  605 : A0N588_9MURI        0.54  0.78    1  108   21  131  112    2    5  131  A0N588     Anti-CD4 mAb M-T310 variable region light chain (Fragment) OS=Mus sp. GN=Ig VL PE=2 SV=1
  606 : A0N7H8_9MURI        0.54  0.79  110  227    1  117  119    2    3  117  A0N7H8     Anti-anti-Id Ab3-2C4 (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  607 : A0N7J6_HUMAN        0.54  0.79    1  108   21  128  108    0    0  134  A0N7J6     REV25-2 (Fragment) OS=Homo sapiens PE=2 SV=1
  608 : A2KD55_LAMGL        0.54  0.70  110  227    1  125  128    2   13  125  A2KD55     H13 protein (Fragment) OS=Lama glama GN=h13 PE=4 SV=1
  609 : A2NV19_MOUSE        0.54  0.73    1  108   20  131  113    2    6  131  A2NV19     Precursor polypeptide (AA -10 to 121) (413 is 1st base in codon) (Precursor) OS=Mus musculus GN=Igkv1-117 PE=2 SV=1
  610 : B5UB63_MOUSE        0.54  0.78    1  108    1  113  114    2    7  115  B5UB63     CP1-10 light chain variable region (Fragment) OS=Mus musculus GN=CP1-10VL PE=2 SV=1
  611 : F1LWD0_RAT          0.54  0.70  110  224    1  119  122    3   10  123  F1LWD0     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  612 : F6QU61_ORNAN        0.54  0.68  110  227    1  124  126    2   10  124  F6QU61     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  613 : F7B5N2_XENTR        0.54  0.74    1  108   22  129  108    0    0  130  F7B5N2     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=LOC734128 PE=4 SV=1
  614 : G1TYZ5_RABIT        0.54  0.82    1  101    1  101  101    0    0  109  G1TYZ5     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  615 : G1U177_RABIT        0.54  0.82    2  101    2   99  100    1    2  107  G1U177     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  616 : G3VAP0_SARHA        0.54  0.74    2  105    1  109  109    2    5  112  G3VAP0     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
  617 : G3VQ74_SARHA        0.54  0.74    1   96   19  119  101    1    5  120  G3VQ74     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  618 : HV301_HUMAN         0.54  0.77  110  227    1  122  123    2    6  122  P01762     Ig heavy chain V-III region TRO OS=Homo sapiens PE=1 SV=1
  619 : I0ITL1_MOUSE        0.54  0.80  110  223    1  113  115    2    3  113  I0ITL1     I (Fragment) OS=Mus musculus GN=IgVH PE=2 SV=1
  620 : I3NCF9_SPETR        0.54  0.76    1  108    1  104  108    1    4  107  I3NCF9     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  621 : I3NHT7_SPETR        0.54  0.71    1  108    1  104  108    1    4  108  I3NHT7     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  622 : I6TTD2_STRCA        0.54  0.72  111  227    2  128  129    2   14  128  I6TTD2     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  623 : I6ULA6_STRCA        0.54  0.74  111  227    2  128  129    2   14  128  I6ULA6     Immunonoglobulin heavy chain variable region (Fragment) OS=Struthio camelus PE=2 SV=1
  624 : K7FLP7_PELSI        0.54  0.76    1   95   21  119   99    1    4  121  K7FLP7     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  625 : K7FSU8_PELSI        0.54  0.75    1   95   21  119   99    1    4  121  K7FSU8     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  626 : K7T9I5_MOUSE        0.54  0.76  118  227    1  112  113    2    4  112  K7T9I5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  627 : K7TDB3_MOUSE        0.54  0.77  118  227    1  112  113    2    4  112  K7TDB3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  628 : K7TDF9_MOUSE        0.54  0.71  118  227    1  110  112    2    4  110  K7TDF9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  629 : K7TDJ2_MOUSE        0.54  0.73  118  227    1  110  111    2    2  110  K7TDJ2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  630 : K7TGP7_MOUSE        0.54  0.80  120  227    1  109  110    2    3  109  K7TGP7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  631 : K7TGX3_MOUSE        0.54  0.77  118  227    1  108  111    2    4  108  K7TGX3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  632 : K7TH06_MOUSE        0.54  0.76  118  227    1  113  114    2    5  113  K7TH06     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  633 : K7TH46_MOUSE        0.54  0.73  118  227    1  109  111    2    3  109  K7TH46     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  634 : K7TR29_MOUSE        0.54  0.73  118  227    1  112  112    2    2  112  K7TR29     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  635 : K7TR86_MOUSE        0.54  0.72  118  227    1  106  110    2    4  106  K7TR86     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  636 : K7TRI7_MOUSE        0.54  0.73  118  227    1  109  110    1    1  109  K7TRI7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  637 : K7TRQ3_MOUSE        0.54  0.74  118  227    1  113  114    2    5  113  K7TRQ3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  638 : K7TRS2_MOUSE        0.54  0.78  118  227    1  112  112    1    2  112  K7TRS2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  639 : K7TRU2_MOUSE        0.54  0.70  118  227    1  115  115    1    5  115  K7TRU2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  640 : K7U5N1_MOUSE        0.54  0.81  118  227    1  109  110    1    1  109  K7U5N1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  641 : K7U661_MOUSE        0.54  0.79  118  227    1  112  112    2    2  112  K7U661     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  642 : K7U6K6_MOUSE        0.54  0.80  118  227    1  108  110    2    2  108  K7U6K6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  643 : KV12_RABIT          0.54  0.75    1  108    2  111  110    1    2  111  P01693     Ig kappa chain V region 3368 OS=Oryctolagus cuniculus PE=1 SV=1
  644 : KV13_RABIT          0.54  0.77    4  108    4  109  106    1    1  110  P01694     Ig kappa chain V region 3547 OS=Oryctolagus cuniculus PE=1 SV=1
  645 : KV3A1_MOUSE 2OR9    0.54  0.76    1  108    1  111  112    2    5  111  P01654     Ig kappa chain V-III region PC 2880/PC 1229 OS=Mus musculus PE=1 SV=1
  646 : KV3A2_MOUSE         0.54  0.77    1  108    1  112  112    1    4  112  P01655     Ig kappa chain V-III region PC 7132 OS=Mus musculus PE=1 SV=1
  647 : KV3A3_MOUSE         0.54  0.76    1  108    1  111  112    2    5  111  P01656     Ig kappa chain V-III region MOPC 70 OS=Mus musculus PE=1 SV=1
  648 : KV3A8_MOUSE 2VL5    0.54  0.76    1  108    1  111  112    2    5  111  P01660     Ig kappa chain V-III region PC 3741/TEPC 111 OS=Mus musculus PE=1 SV=1
  649 : KV3AC_MOUSE         0.54  0.77    1  108    1  111  112    2    5  111  P01664     Ig kappa chain V-III region CBPC 101 OS=Mus musculus PE=1 SV=1
  650 : KV402_HUMAN 1QAC    0.54  0.75    1  108    1  113  114    2    7  114  P01625     Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2
  651 : KV403_HUMAN         0.54  0.73    1  108   21  132  114    2    8  133  P06313     Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1
  652 : KV5AI_MOUSE         0.54  0.73    1  108    1  107  108    1    1  108  P01651     Ig kappa chain V-V region EPC 109 OS=Mus musculus PE=1 SV=1
  653 : KV6AB_MOUSE         0.54  0.76    1  108    1  108  109    2    2  108  P04945     Ig kappa chain V-VI region NQ2-6.1 OS=Mus musculus PE=2 SV=1
  654 : Q9N0W4_RABIT        0.54  0.67  110  227    1  124  126    2   10  124  Q9N0W4     Anti-human A33 heavy chain domain (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
  655 : Q9N0W6_RABIT        0.54  0.67  110  227    1  124  126    2   10  124  Q9N0W6     Anti-human A33 heavy chain domain (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
  656 : Q9QXF0_MOUSE        0.54  0.76  110  227    1  117  119    2    3  117  Q9QXF0     Immunoglobulin heavy chain V-D-J region (Fragment) OS=Mus musculus GN=Igh PE=2 SV=1
  657 : A0N5G5_HUMAN        0.53  0.81    1  108    1  109  109    1    1  118  A0N5G5     Rheumatoid factor D5 light chain (Fragment) OS=Homo sapiens GN=V3 PE=2 SV=1
  658 : A0N6Q6_9MURI        0.53  0.77   10  108    1  104  104    2    5  104  A0N6Q6     Rheumatoid factor RF3-5A (Fragment) OS=Mus sp. GN=Ig V PE=2 SV=1
  659 : A2N2F4_HUMAN        0.53  0.74    4  108    1  105  106    2    2  108  A2N2F4     VK3 protein (Fragment) OS=Homo sapiens GN=VK3 PE=2 SV=1
  660 : A2NW55_MOUSE        0.53  0.73  110  227    1  117  120    2    5  117  A2NW55     E8 variable heavy chain (Fragment) OS=Mus musculus PE=2 SV=1
  661 : A2NW98_HUMAN        0.53  0.75    1  108   21  133  114    2    7  134  A2NW98     Rheumatoid factor light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  662 : B5UB61_MOUSE        0.53  0.78    1   96    1  102  102    1    6  115  B5UB61     CP1-5 light chain variable region (Fragment) OS=Mus musculus GN=CP1-5VL PE=2 SV=1
  663 : D3ZPL2_RAT          0.53  0.79    1  108   20  123  108    1    4  123  D3ZPL2     Uncharacterized protein OS=Rattus norvegicus PE=2 SV=2
  664 : F1LWW1_RAT          0.53  0.75    1  107   21  120  107    1    7  121  F1LWW1     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  665 : F6S1J6_MACMU        0.53  0.78    4  108    1  104  105    1    1  104  F6S1J6     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  666 : F6TG26_XENTR        0.53  0.73    1   89    1   88   89    1    1  107  F6TG26     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
  667 : F6V1L8_MONDO        0.53  0.69    1   95   21  120  100    1    5  120  F6V1L8     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=1
  668 : F6VT01_HORSE        0.53  0.76    1  106   22  121  106    1    6  121  F6VT01     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100065623 PE=4 SV=1
  669 : F7EPX5_ORNAN        0.53  0.70  110  221   20  140  123    2   13  153  F7EPX5     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100681918 PE=4 SV=1
  670 : G1TPR4_RABIT        0.53  0.78    2  106    2  103  105    1    3  111  G1TPR4     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=IGKC1 PE=4 SV=1
  671 : G1TXI3_RABIT        0.53  0.79    4  100    8  105   99    2    3  105  G1TXI3     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  672 : G3TSL1_LOXAF        0.53  0.71    1  108    1  102  108    1    6  109  G3TSL1     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  673 : G3VLF6_SARHA        0.53  0.73    2  104    2  109  108    2    5  114  G3VLF6     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
  674 : G3VPR0_SARHA        0.53  0.77    2  108   22  127  107    1    1  128  G3VPR0     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  675 : H3AN87_LATCH        0.53  0.75  110  227   20  135  119    2    4  135  H3AN87     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
  676 : HV02_XENLA          0.53  0.73  113  227   21  135  117    3    4  135  P20957     Ig heavy chain V region XIG14 (Fragment) OS=Xenopus laevis PE=2 SV=1
  677 : HVM13_MOUSE 2OZ4    0.53  0.75  110  227    1  117  118    1    1  117  P01757     Ig heavy chain V region J558 OS=Mus musculus PE=1 SV=1
  678 : I3N0W9_SPETR        0.53  0.75    1  108    1  104  108    1    4  108  I3N0W9     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  679 : K7T993_MOUSE        0.53  0.75  118  227    1  112  114    2    6  112  K7T993     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  680 : K7T9V0_MOUSE        0.53  0.80  120  227    1  109  110    3    3  109  K7T9V0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  681 : K7TD20_MOUSE        0.53  0.77  118  227    1  109  110    1    1  109  K7TD20     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  682 : K7TRD7_MOUSE        0.53  0.78  118  227    1  109  111    3    3  109  K7TRD7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  683 : K7TRF0_MOUSE        0.53  0.73  118  227    1  113  113    2    3  113  K7TRF0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  684 : K7TRJ3_MOUSE        0.53  0.72  118  227    1  109  111    2    3  109  K7TRJ3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  685 : K7U5Q2_MOUSE        0.53  0.77  118  227    1  110  111    2    2  110  K7U5Q2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  686 : KV3A4_MOUSE         0.53  0.76    1  108    1  111  112    2    5  111  P03977     Ig kappa chain V-III region 50S10.1 OS=Mus musculus PE=1 SV=1
  687 : KV3A9_MOUSE 1EGJ    0.53  0.77    1  108   21  131  112    2    5  131  P01661     Ig kappa chain V-III region MOPC 63 OS=Mus musculus PE=1 SV=1
  688 : KV3AA_MOUSE         0.53  0.77    1  108    1  111  112    2    5  111  P01662     Ig kappa chain V-III region ABPC 22/PC 9245 OS=Mus musculus PE=1 SV=1
  689 : KV3AD_MOUSE 2ZCL    0.53  0.77    1  108    1  111  112    2    5  111  P01665     Ig kappa chain V-III region PC 7043 OS=Mus musculus PE=1 SV=1
  690 : KV3AF_MOUSE         0.53  0.77    1  108    1  111  112    2    5  111  P01667     Ig kappa chain V-III region PC 6308 OS=Mus musculus PE=1 SV=1
  691 : KV401_HUMAN         0.53  0.75    1   95   21  121  101    1    6  121  P06312     Ig kappa chain V-IV region (Fragment) OS=Homo sapiens GN=IGKV4-1 PE=4 SV=1
  692 : KV4A1_MOUSE         0.53  0.73    1  108   23  128  109    2    4  129  P01680     Ig kappa chain V-IV region S107B OS=Mus musculus PE=4 SV=1
  693 : KV6A1_MOUSE 3BT2    0.53  0.74    1   90    1   89   90    1    1  107  P01675     Ig kappa chain V-VI region XRPC 44 OS=Mus musculus PE=1 SV=1
  694 : KV6A2_MOUSE         0.53  0.74    1   90    1   89   90    1    1  107  P01676     Ig kappa chain V-VI region XRPC 24 OS=Mus musculus PE=1 SV=1
  695 : KV6A3_MOUSE         0.53  0.74    1   90    1   89   90    1    1  107  P01677     Ig kappa chain V-VI region TEPC 601/TEPC 191 OS=Mus musculus PE=1 SV=1
  696 : KV6A4_MOUSE         0.53  0.74    1   90    1   89   90    1    1  107  P01678     Ig kappa chain V-VI region SAPC 10 OS=Mus musculus PE=1 SV=1
  697 : KV6A5_MOUSE 2FBJ    0.53  0.71    1  108    1  106  108    2    2  107  P01679     Ig kappa chain V-VI region J539 OS=Mus musculus PE=1 SV=1
  698 : KV6A6_MOUSE         0.53  0.75    1  108    1  106  108    2    2  107  P04940     Ig kappa chain V-VI region NQ2-17.4.1 OS=Mus musculus PE=4 SV=1
  699 : KV6A8_MOUSE         0.53  0.75    1  108    1  106  108    2    2  107  P04942     Ig kappa chain V-VI region NQ5-61.1.2 OS=Mus musculus PE=4 SV=1
  700 : M3YDF0_MUSPF        0.53  0.75    1  106   21  120  106    1    6  121  M3YDF0     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
  701 : Q5F2I7_MOUSE        0.53  0.76    1  108    1  111  112    2    5  111  Q5F2I7     Kappa light chain variable region (Fragment) OS=Mus musculus GN=Igk PE=2 SV=1
  702 : Q5R3X1_MOUSE1MOE    0.53  0.72  116  228    1  114  117    2    7  114  Q5R3X1     V(H) region of G5 Bb 2.2 (Fragment) OS=Mus musculus PE=1 SV=1
  703 : Q8VIJ0_MOUSE        0.53  0.79    1  108    1  107  108    1    1  108  Q8VIJ0     Anti-DNA light chain (Fragment) OS=Mus musculus GN=Igkv6-14 PE=2 SV=1
  704 : Q924R0_MOUSE        0.53  0.79  110  231    1  122  123    2    2  143  Q924R0     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  705 : Q9JL84_MOUSE        0.53  0.74    1  108    1  107  108    1    1  107  Q9JL84     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  706 : Q9U410_MOUSE        0.53  0.74    1  108    1  106  108    2    2  106  Q9U410     Monoclonal anti-idiotypic Schistosoma japonicum antibody NP30 immunoglobulin light chain variable region (Fragment) OS=Mus musculus GN=Gm1524 PE=4 SV=1
  707 : Q9UL92_HUMAN        0.53  0.76  110  227    1  124  124    1    6  124  Q9UL92     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  708 : A0N262_MOUSE        0.52  0.78    1   90    2   97   96    1    6  115  A0N262     Vk protein (Fragment) OS=Mus musculus GN=Vk PE=4 SV=1
  709 : A2NC20_MOUSE        0.52  0.76    1  108   21  133  114    2    7  133  A2NC20     CC49 Fab (Precursor) OS=Mus musculus GN=Igkv8-30 PE=2 SV=1
  710 : A2NUE8_MOUSE2AJV    0.52  0.78  110  232   19  142  125    3    3  149  A2NUE8     Vh gene product (Fragment) OS=Mus musculus PE=2 SV=1
  711 : B5UB67_MOUSE        0.52  0.73    1  108    1  112  113    2    6  114  B5UB67     EP3-1 light chain variable region (Fragment) OS=Mus musculus GN=EP3-1VL PE=2 SV=1
  712 : F1M279_RAT          0.52  0.75    1  108    1  107  108    1    1  108  F1M279     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=2 SV=2
  713 : F1M8N5_RAT          0.52  0.76    1  105    1  104  105    1    1  108  F1M8N5     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  714 : F7H150_MACMU        0.52  0.74    1  108    1  104  108    1    4  104  F7H150     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  715 : G1THC9_RABIT        0.52  0.77    2  106    1  101  105    1    4  106  G1THC9     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  716 : G1TMG6_RABIT        0.52  0.77    1  107    3  107  108    2    4  114  G1TMG6     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  717 : G1TW88_RABIT        0.52  0.83    4  105    5  103  103    2    5  112  G1TW88     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  718 : G1U6V8_RABIT        0.52  0.75    1  106    2  104  106    1    3  107  G1U6V8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  719 : G3VA59_SARHA        0.52  0.72    2  108   22  133  112    2    5  139  G3VA59     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  720 : G3VJI1_SARHA        0.52  0.75    1  106   21  120  106    1    6  121  G3VJI1     Uncharacterized protein OS=Sarcophilus harrisii PE=4 SV=1
  721 : HVM12_MOUSE         0.52  0.74  110  227    1  117  119    2    3  117  P01756     Ig heavy chain V region MOPC 104E OS=Mus musculus PE=1 SV=1
  722 : I3MZD7_SPETR        0.52  0.69    1  108    1  104  108    1    4  109  I3MZD7     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  723 : I3N1A0_SPETR        0.52  0.75    1  108    3  110  108    0    0  113  I3N1A0     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  724 : I3N4M7_SPETR        0.52  0.70    1  108    1  104  108    1    4  109  I3N4M7     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  725 : K7FYE6_PELSI        0.52  0.70    1  108   21  131  112    2    5  132  K7FYE6     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  726 : K7T926_MOUSE        0.52  0.79  118  227    1  111  112    3    3  111  K7T926     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  727 : K7T9A5_MOUSE        0.52  0.74  118  227    1  109  111    2    3  109  K7T9A5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  728 : K7T9J0_MOUSE        0.52  0.76  118  227    1  112  114    3    6  112  K7T9J0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  729 : K7TD32_MOUSE        0.52  0.79  118  231    1  113  114    1    1  120  K7TD32     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  730 : K7TD54_MOUSE        0.52  0.77  118  227    1  111  111    1    1  111  K7TD54     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  731 : K7TDI6_MOUSE        0.52  0.79  118  227    1  111  112    3    3  111  K7TDI6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  732 : K7TGQ2_MOUSE        0.52  0.75  118  227    1  105  110    1    5  105  K7TGQ2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  733 : K7TH02_MOUSE        0.52  0.74  118  227    1  116  116    1    6  116  K7TH02     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  734 : K7TH26_MOUSE        0.52  0.76  118  227    1  112  114    3    6  112  K7TH26     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  735 : K7TR49_MOUSE        0.52  0.72  118  227    1  109  111    2    3  109  K7TR49     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  736 : K7TRB5_MOUSE        0.52  0.79  118  227    1  111  112    3    3  111  K7TRB5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  737 : K7TRG3_MOUSE        0.52  0.73  118  227    1  109  111    2    3  109  K7TRG3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  738 : K7U5V5_MOUSE        0.52  0.75  118  227    1  107  110    2    3  107  K7U5V5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  739 : KV05_RABIT          0.52  0.75    1  108    1  107  108    1    1  108  P01686     Ig kappa chain V region BS-1 OS=Oryctolagus cuniculus PE=1 SV=1
  740 : KV08_RABIT          0.52  0.79    2  108    2  107  107    1    1  108  P01689     Ig kappa chain V region 120 OS=Oryctolagus cuniculus PE=1 SV=1
  741 : KV3AE_MOUSE 1F58    0.52  0.77    1  108    1  111  112    2    5  111  P01666     Ig kappa chain V-III region PC 7183 OS=Mus musculus PE=1 SV=1
  742 : KV3AH_MOUSE         0.52  0.76    1  108    1  111  112    2    5  111  P01669     Ig kappa chain V-III region PC 7769 OS=Mus musculus PE=1 SV=1
  743 : KV3AM_MOUSE         0.52  0.75    1  105    1  108  109    2    5  108  P01674     Ig kappa chain V-III region PC 2154 OS=Mus musculus PE=1 SV=1
  744 : KV405_HUMAN         0.52  0.69    1  104    1  109  110    2    7  109  P83593     Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1
  745 : KV6A7_MOUSE         0.52  0.74    1  108    1  106  108    2    2  107  P04941     Ig kappa chain V-VI region NQ2-48.2.2 OS=Mus musculus PE=4 SV=1
  746 : KV6A9_MOUSE         0.52  0.74    1  108    1  106  108    2    2  107  P04943     Ig kappa chain V-VI region NQ6-8.3.1 OS=Mus musculus PE=4 SV=1
  747 : KV6AA_MOUSE         0.52  0.73    1  108    1  106  108    2    2  107  P04944     Ig kappa chain V-VI region NQ5-78.2.6 OS=Mus musculus PE=4 SV=1
  748 : M9MMM3_PONAB        0.52  0.73    1  107   21  123  107    1    4  123  M9MMM3     Uncharacterized protein OS=Pongo abelii PE=4 SV=1
  749 : Q924P7_MOUSE        0.52  0.77  110  231    1  124  124    1    2  145  Q924P7     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  750 : Q924Q1_MOUSE        0.52  0.77  110  231    1  121  122    1    1  142  Q924Q1     V23-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighv1-53 PE=2 SV=1
  751 : Q924Q6_MOUSE1I8M    0.52  0.77  110  231    1  124  124    1    2  145  Q924Q6     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=1 SV=1
  752 : Q924Q9_MOUSE        0.52  0.77  110  231    1  124  124    1    2  145  Q924Q9     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
  753 : Q924R1_MOUSE        0.52  0.77  110  231    1  124  124    1    2  145  Q924R1     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
  754 : Q924R2_MOUSE        0.52  0.77  110  231    1  119  122    2    3  140  Q924R2     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  755 : Q924R4_MOUSE        0.52  0.78  110  231    1  124  124    2    2  145  Q924R4     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
  756 : Q925S3_MOUSE        0.52  0.76  110  230    3  124  122    1    1  147  Q925S3     MRP3 OS=Mus musculus PE=2 SV=1
  757 : Q9JL80_MOUSE        0.52  0.75    9  108    1  103  104    2    5  103  Q9JL80     Anti-myosin immunoglobulin light chain variable region (Fragment) OS=Mus musculus GN=Igk-V21-5 PE=2 SV=1
  758 : Q9JL85_MOUSE1J05    0.52  0.73  118  227    1  109  112    2    5  109  Q9JL85     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=1 SV=1
  759 : Q9N0W5_RABIT        0.52  0.77    1  108    1  109  109    1    1  109  Q9N0W5     Anti-human A33 light chain variable region (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
  760 : Q9UL86_HUMAN        0.52  0.76    1  108    1  108  109    2    2  109  Q9UL86     Myosin-reactive immunoglobulin kappa chain variable region (Fragment) OS=Homo sapiens PE=1 SV=1
  761 : A0N6R1_9MURI        0.51  0.75    1  107    1  110  111    2    5  110  A0N6R1     Rheumatoid factor RFA28 (Fragment) OS=Mus sp. GN=Igk-V21 PE=2 SV=1
  762 : A0N6R2_9MURI        0.51  0.71    1  107    1  109  111    2    6  109  A0N6R2     Rheumatoid factor RF1-7 (Fragment) OS=Mus sp. GN=Ig V PE=2 SV=1
  763 : A1A540_MOUSE        0.51  0.74    1  105   10  108  105    1    6  108  A1A540     Igk protein OS=Mus musculus GN=Igkv10-96 PE=4 SV=1
  764 : A2N7P4_HUMAN        0.51  0.76  110  222    4  120  118    2    6  120  A2N7P4     Immunoglobulin mu-chain D-J4-region (Fragment) OS=Homo sapiens GN=IGHM PE=4 SV=1
  765 : A2NW97_HUMAN        0.51  0.79  110  227   20  134  118    2    3  134  A2NW97     Rheumatoid factor Vh I region (Fragment) OS=Homo sapiens PE=2 SV=1
  766 : F1LZG3_RAT          0.51  0.74    1  108    1  105  108    1    3  108  F1LZG3     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=2 SV=2
  767 : F6S1P2_MACMU        0.51  0.73    1  108    1  104  108    1    4  108  F6S1P2     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  768 : F6XJR1_XENTR        0.51  0.73    1  107    1  106  107    1    1  116  F6XJR1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
  769 : G1LUD7_AILME        0.51  0.70    1  108    1  107  108    1    1  107  G1LUD7     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=4 SV=1
  770 : G1U9A4_RABIT        0.51  0.75    4  103    8  104  102    2    7  104  G1U9A4     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  771 : G3SEI0_GORGO        0.51  0.69    1  108    1  102  108    1    6  109  G3SEI0     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  772 : G3U4C5_LOXAF        0.51  0.72    1  108    1  102  108    1    6  108  G3U4C5     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  773 : G3UC44_LOXAF        0.51  0.75    1  108   21  123  108    1    5  123  G3UC44     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  774 : G3ULD5_LOXAF        0.51  0.69    1  108   21  128  114    2   12  134  G3ULD5     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  775 : G3VBT9_SARHA        0.51  0.73    2  108    2  102  107    1    6  109  G3VBT9     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii PE=4 SV=1
  776 : H0XH36_OTOGA        0.51  0.74    1  100    1  106  106    1    6  116  H0XH36     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=IGKV4-1 PE=4 SV=1
  777 : H9G6T0_ANOCA        0.51  0.72  110  223    1  112  117    2    8  112  H9G6T0     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
  778 : HVM07_MOUSE 1NQB    0.51  0.75  110  227   20  139  122    2    6  139  P01751     Ig heavy chain V region B1-8/186-2 OS=Mus musculus GN=Gm16709 PE=1 SV=1
  779 : I3L728_PIG          0.51  0.73    2  106   22  124  109    2   10  133  I3L728     Uncharacterized protein OS=Sus scrofa GN=LOC100739851 PE=4 SV=1
  780 : I3M5F0_SPETR        0.51  0.72    1  108    1  104  108    1    4  108  I3M5F0     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  781 : I3NFX5_SPETR        0.51  0.72    1  108    1  104  108    1    4  108  I3NFX5     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  782 : K7FWW0_PELSI        0.51  0.70    1  107   21  131  111    1    4  133  K7FWW0     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  783 : K7T9M7_MOUSE        0.51  0.71  118  227    1  108  111    2    4  108  K7T9M7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  784 : K7T9N2_MOUSE        0.51  0.74  118  227    1  110  110    0    0  110  K7T9N2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  785 : K7T9N8_MOUSE        0.51  0.74  118  227    1  112  113    2    4  112  K7T9N8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  786 : K7TD27_MOUSE        0.51  0.77  118  227    1  109  111    3    3  109  K7TD27     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  787 : K7TDF1_MOUSE        0.51  0.76  118  227    1  109  110    1    1  109  K7TDF1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  788 : K7TDF6_MOUSE        0.51  0.76  118  227    1  111  113    3    5  111  K7TDF6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  789 : K7TH28_MOUSE        0.51  0.80  118  227    1  108  111    3    4  108  K7TH28     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  790 : K7TH34_MOUSE        0.51  0.74  118  227    1  111  112    2    3  111  K7TH34     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  791 : K7TH59_MOUSE        0.51  0.75  110  227    2  122  122    2    5  122  K7TH59     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  792 : K7TH96_MOUSE        0.51  0.71  118  227    1  108  111    2    4  108  K7TH96     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  793 : K7TR35_MOUSE        0.51  0.77  118  227    1  109  110    1    1  109  K7TR35     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  794 : K7U690_MOUSE        0.51  0.80  118  227    1  113  114    2    5  113  K7U690     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  795 : K7U6B8_MOUSE        0.51  0.73  118  227    1  109  110    1    1  109  K7U6B8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  796 : KV121_HUMAN         0.51  0.76    1  108    1  111  112    2    5  112  P01613     Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1
  797 : KV15_RABIT          0.51  0.73    2  108    1  108  109    2    3  110  P01696     Ig kappa chain V region K29-213 OS=Oryctolagus cuniculus PE=1 SV=1
  798 : KV1_CANFA           0.51  0.71    1  108    1  107  108    1    1  108  P01618     Ig kappa chain V region GOM OS=Canis familiaris PE=1 SV=1
  799 : KV201_HUMAN         0.51  0.71    1  108    2  114  114    2    7  115  P01614     Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1
  800 : KV2A7_MOUSE 2VQ1    0.51  0.74    1  108    1  112  113    2    6  113  P01631     Ig kappa chain V-II region 26-10 OS=Mus musculus PE=1 SV=1
  801 : KV301_HUMAN         0.51  0.78    1  108    1  108  109    2    2  108  P01619     Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1
  802 : KV3A5_MOUSE         0.51  0.73    1  107    1  110  111    2    5  111  P01657     Ig kappa chain V-III region PC 2413 OS=Mus musculus PE=1 SV=1
  803 : KV3AB_MOUSE 1ACY    0.51  0.77    1  108    1  111  112    2    5  111  P01663     Ig kappa chain V-III region PC 4050 OS=Mus musculus PE=1 SV=1
  804 : KVM5_MOUSE          0.51  0.78    1  108    1  107  108    1    1  121  P84750     Ig kappa chain V region Mem5 (Fragment) OS=Mus musculus PE=1 SV=1
  805 : L8B0W4_PIG          0.51  0.71  110  232   20  158  139    2   16  481  L8B0W4     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  806 : M0R7F5_RAT          0.51  0.69    1  108    1  100  108    1    8  108  M0R7F5     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  807 : Q6LEM8_MOUSE        0.51  0.71    1  108    1  112  113    2    6  112  Q6LEM8     Putative uncharacterized protein (Fragment) OS=Mus musculus PE=2 SV=1
  808 : Q924Q2_MOUSE        0.51  0.76  110  231    1  121  122    1    1  142  Q924Q2     V303-D-J-C mu protein (Fragment) OS=Mus musculus GN=V303-D-J-C mu PE=2 SV=1
  809 : Q924Q3_MOUSE        0.51  0.75  110  231    1  125  126    2    5  146  Q924Q3     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
  810 : A0N274_MOUSE2GKI    0.50  0.74  110  228   20  140  121    1    2  152  A0N274     Antigen, B-cell receptor (Precursor) OS=Mus musculus PE=1 SV=1
  811 : A0N5T9_9MURI        0.50  0.76  110  227    1  118  119    2    2  118  A0N5T9     Anti-hepatitis B virus core antigen MoAb 13C9 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  812 : A0N6Q0_9MURI        0.50  0.71  110  224    1  117  117    1    2  117  A0N6Q0     Rheumatoid factor RF10-2 (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  813 : A0N6Q8_9MURI        0.50  0.72  110  224    1  118  119    2    5  118  A0N6Q8     Rheumatoid factor RFA28-A (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  814 : A0N7D1_9MURI        0.50  0.75    1  108    1  111  112    2    5  115  A0N7D1     SD6 Fab kappa light chain variable region (Fragment) OS=Mus sp. GN=Ig PE=4 SV=1
  815 : A0N7G5_9MURI        0.50  0.74  110  219    3  113  113    3    5  113  A0N7G5     H2 (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  816 : A2MY50_MOUSE        0.50  0.73    1  108    1  112  113    2    6  114  A2MY50     Anti-acid phosphatase variable light chain 11 (Fragment) OS=Mus musculus PE=2 SV=1
  817 : A2N1N0_MOUSE        0.50  0.77  110  228   20  138  120    2    2  150  A2N1N0     B cell antigen receptor (Precursor) OS=Mus musculus PE=4 SV=1
  818 : A2NB45_HUMAN        0.50  0.73    1  108    1  112  113    2    6  113  A2NB45     Cold agglutinin FS-1 L-chain (Fragment) OS=Homo sapiens PE=2 SV=1
  819 : B5DC72_MOUSE        0.50  0.73    1  108    1  112  113    2    6  114  B5DC72     Variable domain of Fab 54-5C10-A light chain (Fragment) OS=Mus musculus GN=Na PE=2 SV=1
  820 : F1LZK3_RAT          0.50  0.70    1  107    1  101  107    1    6  104  F1LZK3     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  821 : F1M7B3_RAT          0.50  0.71    1   96    1  101  101    1    5  102  F1M7B3     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  822 : F6RVX2_MACMU        0.50  0.71    1   96    1  101  101    1    5  102  F6RVX2     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  823 : F6TED1_HORSE        0.50  0.69    1   98    1  107  108    2   11  107  F6TED1     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  824 : F6V2R3_MONDO        0.50  0.66    1  108   22  125  113    2   14  135  F6V2R3     Uncharacterized protein OS=Monodelphis domestica PE=4 SV=1
  825 : F6VKZ3_HORSE        0.50  0.72    1  105    4  102  105    1    6  102  F6VKZ3     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  826 : F7A8G3_MACMU        0.50  0.72    1  108    1  108  108    0    0  108  F7A8G3     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  827 : F7CEY4_HORSE        0.50  0.79    1   96    3  104  102    1    6  104  F7CEY4     Uncharacterized protein (Fragment) OS=Equus caballus GN=IGKV4-1 PE=4 SV=1
  828 : F7E8D4_CALJA        0.50  0.73    1  100    1  104  105    2    6  108  F7E8D4     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=IGKV4-1 PE=4 SV=1
  829 : F7FQF7_MONDO        0.50  0.72    1   96   13  113  101    1    5  113  F7FQF7     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
  830 : G1SAC6_NOMLE        0.50  0.72    1   96    1  101  101    1    5  102  G1SAC6     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=LOC100591384 PE=4 SV=1
  831 : G1TGU6_RABIT        0.50  0.76    1  103    5  104  105    2    7  104  G1TGU6     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  832 : G1THE8_RABIT        0.50  0.74    1  108    1  109  109    1    1  110  G1THE8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  833 : G1U3T3_RABIT        0.50  0.77   10  107    1   99  100    2    3  102  G1U3T3     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  834 : G1U5Y2_RABIT        0.50  0.75    4  106    4   98  103    1    8  107  G1U5Y2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  835 : G3GAU4_HUMAN        0.50  0.75    1  108    1  105  109    2    5  107  G3GAU4     Anti-H1N1 influenza HA kappa chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  836 : G3UIN4_LOXAF        0.50  0.74    1   96    1  102  102    1    6  115  G3UIN4     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  837 : H0XIK9_OTOGA        0.50  0.71    1   95    1  100  100    1    5  102  H0XIK9     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  838 : H2RF78_PANTR        0.50  0.72    1   96    1  101  101    1    5  102  H2RF78     Uncharacterized protein (Fragment) OS=Pan troglodytes PE=4 SV=1
  839 : H9H2J4_MELGA        0.50  0.68  111  217    2  116  120    2   18  126  H9H2J4     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100542723 PE=4 SV=1
  840 : HVM03_MOUSE 1JFQ    0.50  0.75  111  227    1  120  121    2    5  120  P01747     Ig heavy chain V region 36-65 OS=Mus musculus PE=1 SV=1
  841 : HVM11_MOUSE 2FAT    0.50  0.76  110  227   20  137  120    2    4  137  P01755     Ig heavy chain V region S43 OS=Mus musculus PE=1 SV=1
  842 : I3M2D8_SPETR        0.50  0.72    1  104    1   99  105    2    7  111  I3M2D8     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
  843 : I3MM99_SPETR        0.50  0.75    1  108   21  130  110    1    2  130  I3MM99     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
  844 : K7EYR4_PELSI        0.50  0.70    1  107    1  107  107    0    0  107  K7EYR4     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  845 : K7T988_MOUSE        0.50  0.73  118  227    1  106  110    1    4  106  K7T988     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  846 : K7T9B2_MOUSE        0.50  0.77  118  227    1  109  110    1    1  109  K7T9B2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  847 : K7T9E3_MOUSE        0.50  0.76  118  227    1  110  112    3    4  110  K7T9E3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  848 : K7T9J8_MOUSE        0.50  0.71  118  227    1  114  115    2    6  114  K7T9J8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  849 : K7T9K2_MOUSE        0.50  0.75  118  227    1  105  110    2    5  105  K7T9K2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  850 : K7T9L5_MOUSE        0.50  0.76  118  227    1  112  112    2    2  112  K7T9L5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  851 : K7T9M3_MOUSE        0.50  0.75  118  227    1  108  110    2    2  108  K7T9M3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  852 : K7T9N4_MOUSE        0.50  0.75  118  227    1  112  115    2    8  112  K7T9N4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  853 : K7T9P1_MOUSE        0.50  0.74  118  227    1  112  113    2    4  112  K7T9P1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  854 : K7T9Q4_MOUSE        0.50  0.75  118  227    1  104  110    1    6  104  K7T9Q4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  855 : K7T9T8_MOUSE        0.50  0.73  118  227    1  113  116    2    9  113  K7T9T8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  856 : K7TD91_MOUSE        0.50  0.74  118  227    1  115  117    3    9  115  K7TD91     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  857 : K7TDD9_MOUSE        0.50  0.75  118  227    1  114  116    3    8  114  K7TDD9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  858 : K7TDH5_MOUSE        0.50  0.67  118  227    1  111  112    2    3  111  K7TDH5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  859 : K7TDI0_MOUSE        0.50  0.75  118  227    1  105  110    2    5  105  K7TDI0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  860 : K7TDK2_MOUSE        0.50  0.66  118  227    1  113  115    2    7  113  K7TDK2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  861 : K7TDM1_MOUSE        0.50  0.70  118  227    1  108  111    2    4  108  K7TDM1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  862 : K7TDT9_MOUSE        0.50  0.68  119  227    1  106  111    2    7  106  K7TDT9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  863 : K7TDU6_MOUSE        0.50  0.78  120  227    1  109  110    2    3  109  K7TDU6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  864 : K7TH54_MOUSE        0.50  0.79  118  227    1  112  113    2    4  112  K7TH54     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  865 : K7THA4_MOUSE        0.50  0.77  118  227    1  109  110    1    1  109  K7THA4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  866 : K7THC0_MOUSE        0.50  0.74  118  227    1  112  113    2    4  112  K7THC0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  867 : K7THI4_MOUSE        0.50  0.76  120  227    1  109  111    3    5  109  K7THI4     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  868 : K7TQZ6_MOUSE        0.50  0.77  118  227    1  111  113    3    5  111  K7TQZ6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  869 : K7TR19_MOUSE        0.50  0.77  118  227    1  110  111    2    2  110  K7TR19     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  870 : K7TR43_MOUSE        0.50  0.75  118  227    1  111  112    2    3  111  K7TR43     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  871 : K7TR64_MOUSE        0.50  0.73  118  227    1  112  113    2    4  112  K7TR64     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  872 : K7TR97_MOUSE        0.50  0.75  118  227    1  113  115    3    7  113  K7TR97     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  873 : K7TRC9_MOUSE        0.50  0.78  118  227    1  109  111    3    3  109  K7TRC9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  874 : K7TRI2_MOUSE        0.50  0.74  118  227    1  113  115    3    7  113  K7TRI2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  875 : K7TRL3_MOUSE        0.50  0.71  118  227    1  110  110    0    0  110  K7TRL3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  876 : K7TRM1_MOUSE        0.50  0.68  118  226    1  109  110    2    2  109  K7TRM1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  877 : K7TRN8_MOUSE        0.50  0.71  118  227    1  110  113    2    6  110  K7TRN8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  878 : K7U5M3_MOUSE        0.50  0.79  118  227    1  112  113    2    4  112  K7U5M3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  879 : K7U5T0_MOUSE        0.50  0.76  118  227    1  113  115    3    7  113  K7U5T0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  880 : K7U5Y8_MOUSE        0.50  0.75  118  227    1  111  113    3    5  111  K7U5Y8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  881 : K7U5Z3_MOUSE        0.50  0.65  118  227    1  113  113    1    3  113  K7U5Z3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  882 : K7U624_MOUSE        0.50  0.75  118  227    1  113  114    2    5  113  K7U624     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  883 : K7U676_MOUSE        0.50  0.73  118  227    1  113  115    3    7  113  K7U676     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  884 : K7U6E0_MOUSE        0.50  0.75  118  227    1  110  111    2    2  110  K7U6E0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  885 : K7U6G2_MOUSE        0.50  0.77  118  227    1  110  111    2    2  110  K7U6G2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  886 : KV01_RABIT          0.50  0.76    4  108    4  109  107    2    3  110  P01682     Ig kappa chain V region 2717 OS=Oryctolagus cuniculus PE=1 SV=1
  887 : KV02_RABIT          0.50  0.78    1  108    2  114  113    2    5  115  P01683     Ig kappa chain V region 3315 OS=Oryctolagus cuniculus PE=1 SV=1
  888 : KV10_RABIT          0.50  0.76    4  108   10  116  107    1    2  117  P01691     Ig kappa chain V region 12F2 (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  889 : KV14_RABIT          0.50  0.78    2  108    2  109  108    1    1  109  P01695     Ig kappa chain V region K16-167 OS=Oryctolagus cuniculus PE=1 SV=1
  890 : KV1A1_MOUSE         0.50  0.70    1  108    1  113  114    2    7  114  P01632     Ig kappa chain V-I region S107A OS=Mus musculus PE=4 SV=1
  891 : KV203_HUMAN         0.50  0.71    1  108    1  111  112    2    5  112  P01616     Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1
  892 : KV204_HUMAN         0.50  0.71    1  108    1  112  113    2    6  113  P01617     Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1
  893 : KV205_HUMAN         0.50  0.72    1  108    5  116  113    2    6  117  P06309     Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1
  894 : KV2A5_MOUSE 3CFB    0.50  0.72    1  108    1  112  113    2    6  113  P03976     Ig kappa chain V-II region 17S29.1 OS=Mus musculus PE=1 SV=1
  895 : KV2A6_MOUSE         0.50  0.70    1  108    1  112  113    2    6  113  P01630     Ig kappa chain V-II region 7S34.1 OS=Mus musculus PE=1 SV=1
  896 : KV3AG_MOUSE         0.50  0.76    1  108    1  110  112    2    6  110  P01668     Ig kappa chain V-III region PC 7210 OS=Mus musculus PE=1 SV=1
  897 : M0RC23_RAT          0.50  0.70    1   96    1  101  101    1    5  102  M0RC23     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
  898 : M3XQD9_MUSPF        0.50  0.68  110  228    3  115  125    3   18  115  M3XQD9     Uncharacterized protein (Fragment) OS=Mustela putorius furo PE=4 SV=1
  899 : Q53VP8_MOUSE        0.50  0.69    1  108    1  112  113    2    6  112  Q53VP8     Kappa chain (Fragment) OS=Mus musculus PE=2 SV=1
  900 : Q5F2I0_MOUSE        0.50  0.74    1  108    1  113  113    1    5  115  Q5F2I0     Kappa light chain variable region (Fragment) OS=Mus musculus GN=IgG1 anti-TS1 VL PE=2 SV=1
  901 : Q683Y8_MOUSE        0.50  0.72  110  227    1  116  119    2    4  116  Q683Y8     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHV PE=2 SV=1
  902 : Q811U6_MOUSE        0.50  0.77    2  108    1  110  111    2    5  111  Q811U6     Anti-human Fc gamma receptor III 3G8 kappa light chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  903 : Q924P8_MOUSE        0.50  0.74  110  231    1  119  122    2    3  140  Q924P8     V23-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighv1-53 PE=2 SV=1
  904 : Q924P9_MOUSE        0.50  0.76  110  231    1  122  123    2    2  143  Q924P9     V303-D-J-C mu protein (Fragment) OS=Mus musculus GN=V303-D-J-C mu PE=2 SV=1
  905 : Q924Q5_MOUSE        0.50  0.75  110  231    1  122  122    0    0  143  Q924Q5     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  906 : Q924R6_MOUSE        0.50  0.75  110  231    1  116  122    2    6  137  Q924R6     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  907 : Q924R7_MOUSE        0.50  0.76  110  231    1  122  122    0    0  143  Q924R7     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  908 : Q99NG4_MOUSE        0.50  0.75  110  228    1  121  123    3    6  121  Q99NG4     Single chain Fv (Fragment) OS=Mus musculus PE=2 SV=1
  909 : Q9Z1C4_MOUSE        0.50  0.75  110  227    1  118  120    2    4  118  Q9Z1C4     Anti-porcine VCAM mAb 3F4 heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  910 : A0N3V1_MOUSE        0.49  0.77  110  227    1  117  120    4    5  117  A0N3V1     C72-3A1 protein (Fragment) OS=Mus musculus GN=Ighv3-5 PE=2 SV=1
  911 : A2IPI1_HUMAN        0.49  0.73    1  108    3  114  113    2    6  118  A2IPI1     HRV Fab N8-VL (Fragment) OS=Homo sapiens PE=2 SV=1
  912 : A2N2G7_HUMAN        0.49  0.71  110  227    1  117  118    1    1  117  A2N2G7     VHC8 protein (Fragment) OS=Homo sapiens GN=VHC8 PE=2 SV=1
  913 : A2NW25_MOUSE        0.49  0.75  116  227    1  107  112    2    5  107  A2NW25     Rearranged heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  914 : A2P2G9_SHEEP        0.49  0.76  110  227   20  137  121    3    6  137  A2P2G9     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  915 : B5UB69_MOUSE        0.49  0.75    1  108    1  112  114    2    8  114  B5UB69     EP3-6 light chain variable region (Fragment) OS=Mus musculus GN=Igkv8-19 PE=2 SV=1
  916 : D3ZIL8_RAT          0.49  0.68    1  105    1  110  110    1    5  115  D3ZIL8     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  917 : F1M1G3_RAT          0.49  0.73    1  108    1  108  108    0    0  109  F1M1G3     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
  918 : F6VC90_HORSE        0.49  0.75    1  106    1  100  106    1    6  100  F6VC90     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  919 : F7CT45_MONDO        0.49  0.66    2  106   16  111  105    2    9  119  F7CT45     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
  920 : F7FQ18_MONDO        0.49  0.72    1  108    1  112  113    2    6  112  F7FQ18     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
  921 : G1SAA1_NOMLE        0.49  0.72    1   95    1  100  100    1    5  100  G1SAA1     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=LOC100586487 PE=4 SV=1
  922 : G1TFB3_RABIT        0.49  0.74    1  101    6  103  102    3    5  103  G1TFB3     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  923 : G1U8X8_RABIT        0.49  0.78    1  107    1  110  110    2    3  111  G1U8X8     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  924 : G3ILT5_CRIGR        0.49  0.70    1  106   21  135  121    2   21  138  G3ILT5     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_024857 PE=4 SV=1
  925 : H9H5F5_MACMU        0.49  0.75    1  107    5  108  107    1    3  112  H9H5F5     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  926 : H9H5T8_MACMU        0.49  0.70    1   96    1  101  101    1    5  102  H9H5T8     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  927 : HV209_HUMAN         0.49  0.72  110  227   21  146  127    2   10  146  P06331     Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1
  928 : HVM01_MOUSE         0.49  0.72  110  227    1  121  123    2    7  121  P01745     Ig heavy chain V region MPC 11 OS=Mus musculus PE=4 SV=1
  929 : HVM02_MOUSE         0.49  0.74  110  227   20  140  122    2    5  140  P01746     Ig heavy chain V region 93G7 OS=Mus musculus PE=2 SV=1
  930 : HVM51_MOUSE         0.49  0.73  110  227    1  118  121    2    6  118  P06330     Ig heavy chain V region AC38 205.12 OS=Mus musculus PE=1 SV=1
  931 : K7EYM8_PELSI        0.49  0.72    1  107    3  109  107    0    0  114  K7EYM8     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  932 : K7FU25_PELSI        0.49  0.71    1  108   21  126  112    2   10  131  K7FU25     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  933 : K7T9J6_MOUSE        0.49  0.76  118  227    1  110  110    0    0  110  K7T9J6     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  934 : K7TDI1_MOUSE        0.49  0.71  118  227    1  109  112    2    5  109  K7TDI1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  935 : K7TDN3_MOUSE        0.49  0.69  118  227    1  109  112    2    5  109  K7TDN3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  936 : K7TDN5_MOUSE        0.49  0.70  118  227    1  108  111    2    4  108  K7TDN5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  937 : K7TDQ0_MOUSE        0.49  0.70  118  227    1  105  110    1    5  105  K7TDQ0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  938 : K7TH77_MOUSE        0.49  0.70  118  227    1  109  111    2    3  109  K7TH77     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  939 : K7THA1_MOUSE        0.49  0.68  118  227    1  104  110    1    6  104  K7THA1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  940 : K7THF9_MOUSE        0.49  0.71  118  227    1  111  113    2    5  111  K7THF9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  941 : K7TQX5_MOUSE        0.49  0.73  118  227    1  112  113    2    4  112  K7TQX5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  942 : K7TRJ0_MOUSE        0.49  0.73  118  227    1  108  110    2    2  108  K7TRJ0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  943 : K7TRM9_MOUSE        0.49  0.69  118  227    1  111  114    2    7  111  K7TRM9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  944 : K7U5T7_MOUSE        0.49  0.65  118  227    1  116  118    2   10  116  K7U5T7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  945 : K7U6D0_MOUSE        0.49  0.73  118  227    1  106  110    2    4  106  K7U6D0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  946 : KV17_RABIT          0.49  0.70    1  102    2  104  104    2    3  104  P01698     Ig kappa chain V region XP-1 (Fragment) OS=Oryctolagus cuniculus PE=1 SV=1
  947 : KV2A4_MOUSE         0.49  0.72    1  108    1  112  113    2    6  112  P01629     Ig kappa chain V-II region 2S1.3 OS=Mus musculus PE=1 SV=1
  948 : KVX01_RAT           0.49  0.75    1  108    1  108  109    2    2  109  P01681     Ig kappa chain V region S211 OS=Rattus norvegicus PE=1 SV=1
  949 : M7BAM3_CHEMY        0.49  0.73    1  107    1  107  107    0    0  107  M7BAM3     Ig kappa chain V-III region VG (Fragment) OS=Chelonia mydas GN=UY3_10240 PE=4 SV=1
  950 : Q5F2I1_MOUSE        0.49  0.74  110  226    1  120  120    2    3  120  Q5F2I1     Gamma heavy chain variable region (Fragment) OS=Mus musculus GN=IgG1 anti-TS1 VH PE=2 SV=1
  951 : Q5R3U9_MOUSE        0.49  0.69  119  228    1  111  114    2    7  111  Q5R3U9     VH region of G7 Ab 2.9 (Fragment) OS=Mus musculus PE=2 SV=1
  952 : Q91VA2_MOUSE        0.49  0.76  110  231    1  122  122    0    0  143  Q91VA2     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  953 : Q924P5_MOUSE        0.49  0.73  110  231    1  123  123    1    1  144  Q924P5     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  954 : Q924P6_MOUSE        0.49  0.73  110  231    1  122  124    2    4  143  Q924P6     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=VH186.2-D-J-C mu PE=2 SV=1
  955 : Q924Q4_MOUSE        0.49  0.77  110  231    1  120  122    2    2  141  Q924Q4     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  956 : Q924Q7_MOUSE        0.49  0.74  110  231    1  124  126    2    6  145  Q924Q7     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
  957 : Q924R5_MOUSE        0.49  0.74  110  231    1  118  122    1    4  139  Q924R5     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Slc25a30 PE=2 SV=1
  958 : Q924R8_MOUSE        0.49  0.74  110  231    1  125  126    2    5  146  Q924R8     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
  959 : Q9GYZ2_MOUSE        0.49  0.77  110  227    1  119  120    2    3  119  Q9GYZ2     Monoclonal anti-idiotypic Schistosoma japonicum antibody NP30 heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  960 : Q9UL73_HUMAN        0.49  0.70  110  227    1  119  121    3    5  119  Q9UL73     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  961 : Q9UL89_HUMAN        0.49  0.73  114  227    1  116  116    1    2  116  Q9UL89     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
  962 : A0N6Y4_9MURI        0.48  0.77  110  227    1  116  120    3    6  116  A0N6Y4     F30C7 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
  963 : A2N011_HUMAN        0.48  0.68  110  227    1  127  130    2   15  127  A2N011     Vh1-D-J3-region (Fragment) OS=Homo sapiens PE=2 SV=1
  964 : A2P2G0_SHEEP        0.48  0.75  110  227   20  132  118    3    5  132  A2P2G0     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  965 : A2P2G1_SHEEP        0.48  0.75  110  227   20  141  123    3    6  141  A2P2G1     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  966 : A2P2G2_SHEEP        0.48  0.75  110  227   20  140  122    2    5  140  A2P2G2     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  967 : A2P2G8_SHEEP        0.48  0.73  110  227   20  139  122    3    6  139  A2P2G8     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  968 : A2P2H0_SHEEP        0.48  0.75  110  227   20  139  122    3    6  139  A2P2H0     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
  969 : F7B4K6_ORNAN        0.48  0.75    1  106    1  105  106    1    1  108  F7B4K6     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  970 : F7CAG8_HORSE        0.48  0.72    1   96    5  105  101    1    5  106  F7CAG8     Uncharacterized protein (Fragment) OS=Equus caballus PE=4 SV=1
  971 : F7HD19_MACMU        0.48  0.70    1   99    1  103  104    2    6  103  F7HD19     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
  972 : G3UG07_LOXAF        0.48  0.72  110  232   17  146  130    1    7  151  G3UG07     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
  973 : G7PN09_MACFA        0.48  0.69    1   95    3  102  100    1    5  102  G7PN09     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_05139 PE=4 SV=1
  974 : G7PN16_MACFA        0.48  0.69    1   99    1  103  104    2    6  103  G7PN16     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_05147 PE=4 SV=1
  975 : G8F1V7_MACMU        0.48  0.69    1   99    1  103  104    2    6  103  G8F1V7     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21496 PE=4 SV=1
  976 : G8F222_MACMU        0.48  0.70    1   95    4  104  101    1    6  104  G8F222     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_21131 PE=4 SV=1
  977 : H0XH74_OTOGA        0.48  0.67    1  105    1  110  110    1    5  114  H0XH74     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
  978 : H0XNS3_OTOGA        0.48  0.68    1  106   10  114  111    2   11  115  H0XNS3     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  979 : H2ZSM2_LATCH        0.48  0.71    1  104    1  104  104    0    0  106  H2ZSM2     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  980 : H8EAI0_CLOTM        0.48  0.71  110  232    2  125  127    4    7  151  H8EAI0     Immunoglobulin V-set domain protein (Fragment) OS=Clostridium thermocellum AD2 GN=AD2_3042 PE=4 SV=1
  981 : HV1A_RABIT          0.48  0.66  113  226    3  116  120    4   12  116  P01826     Ig heavy chain V-A1 region BS-5 OS=Oryctolagus cuniculus PE=1 SV=1
  982 : K7T921_MOUSE        0.48  0.73  118  227    1  112  113    2    4  112  K7T921     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  983 : K7T9I8_MOUSE        0.48  0.75  118  227    1  112  113    3    4  112  K7T9I8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  984 : K7TD85_MOUSE        0.48  0.73  118  227    1  112  112    1    2  112  K7TD85     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  985 : K7TDB7_MOUSE        0.48  0.76  118  227    1  110  111    2    2  110  K7TDB7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  986 : K7TGP2_MOUSE        0.48  0.74  118  227    1  117  119    3   11  117  K7TGP2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  987 : K7TH39_MOUSE        0.48  0.77  118  227    1  106  111    3    6  106  K7TH39     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  988 : K7TH64_MOUSE        0.48  0.72  119  227    1  114  115    2    7  114  K7TH64     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  989 : K7TH68_MOUSE        0.48  0.73  123  227    1  110  111    2    7  110  K7TH68     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  990 : K7TRE7_MOUSE        0.48  0.70  118  227    1  113  118    2   13  113  K7TRE7     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  991 : K7TRL7_MOUSE        0.48  0.70  118  227    1  113  115    2    7  113  K7TRL7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  992 : K7U695_MOUSE        0.48  0.77  118  227    1  111  111    1    1  111  K7U695     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  993 : K7U6A0_MOUSE        0.48  0.76  118  227    1  109  110    1    1  109  K7U6A0     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  994 : K7U6C3_MOUSE        0.48  0.70  118  227    1  114  115    2    6  114  K7U6C3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  995 : K7U6E5_MOUSE        0.48  0.78  118  227    1  113  114    2    5  113  K7U6E5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
  996 : K9IV85_DESRO        0.48  0.71  110  232   20  144  126    3    4  149  K9IV85     Putative conserved secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  997 : L7N0G5_CANFA        0.48  0.69    1   96    1  101  101    1    5  102  L7N0G5     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=1
  998 : L7N2N8_XENTR        0.48  0.73    1  106    1  102  106    1    4  108  L7N2N8     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
  999 : M0R7M5_RAT          0.48  0.68    1  105    1  110  110    1    5  115  M0R7M5     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 1000 : M7B658_CHEMY        0.48  0.68    4  107    1  107  107    2    3  116  M7B658     Ig kappa chain V-I region Walker OS=Chelonia mydas GN=UY3_10239 PE=4 SV=1
 1001 : Q65ZL3_9MURI        0.48  0.72  110  228   20  140  121    2    2  140  Q65ZL3     Tg10H (Fragment) OS=Mus sp. GN=Tg10H PE=2 SV=1
 1002 : Q91V67_MOUSE        0.48  0.73  110  231    1  122  124    2    4  143  Q91V67     V304-D-J-C mu protein (Fragment) OS=Mus musculus GN=EG432708 PE=2 SV=1
 1003 : Q924Q0_MOUSE2FD6    0.48  0.77  110  231    1  122  124    2    4  143  Q924Q0     V165-D-J-C mu protein (Fragment) OS=Mus musculus GN=V165-D-J-C mu PE=1 SV=1
 1004 : Q924Q8_MOUSE        0.48  0.73  110  231    1  125  128    2    9  146  Q924Q8     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
 1005 : Q924R3_MOUSE        0.48  0.73  110  231    1  124  126    2    6  145  Q924R3     VH186.2-D-J-C mu protein (Fragment) OS=Mus musculus GN=Ighm PE=2 SV=1
 1006 : Q9UL95_HUMAN2D7T    0.48  0.72  110  227    1  125  128    2   13  125  Q9UL95     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1007 : A2MY48_MOUSE        0.47  0.74  110  227    1  120  121    2    4  120  A2MY48     Anti-acid phosphatase variable light chain 11 (Fragment) OS=Mus musculus PE=2 SV=1
 1008 : A2NV55_HUMAN        0.47  0.66  110  227   20  146  129    4   13  146  A2NV55     Precursor (AA -19 to 113) (Precursor) OS=Homo sapiens PE=2 SV=1
 1009 : A2P2G4_SHEEP        0.47  0.72  110  227   20  141  123    3    6  141  A2P2G4     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1010 : B5UB68_MOUSE        0.47  0.76  110  227    1  117  119    3    3  117  B5UB68     EP3-6 heavy chain variable region (Fragment) OS=Mus musculus GN=EP3-6VH PE=2 SV=1
 1011 : E2QXH1_CANFA        0.47  0.74    1  108    3  110  114    2   12  120  E2QXH1     Uncharacterized protein (Fragment) OS=Canis familiaris PE=4 SV=2
 1012 : G1QFT3_MYOLU        0.47  0.74  110  217   20  133  116    4   10  143  G1QFT3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1013 : G3PH07_GASAC        0.47  0.72  113  227   21  136  116    1    1  136  G3PH07     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1014 : G3UJP8_LOXAF        0.47  0.79  110  219    3  113  113    3    5  113  G3UJP8     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1015 : G3UKB2_LOXAF        0.47  0.65    1  108    1  110  116    2   14  116  G3UKB2     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=LOC100667242 PE=4 SV=1
 1016 : G5E6I6_BOVIN        0.47  0.72    1  108    1  112  113    2    6  113  G5E6I6     Uncharacterized protein (Fragment) OS=Bos taurus PE=4 SV=1
 1017 : H0XHP3_OTOGA        0.47  0.69    1  108    1  112  113    2    6  113  H0XHP3     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1018 : H2M8H7_ORYLA        0.47  0.70  113  222    2  119  118    1    8  119  H2M8H7     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1019 : H2UG38_TAKRU        0.47  0.67  113  227    4  122  122    2   10  122  H2UG38     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1020 : HVM00_MOUSE         0.47  0.76  110  223    1  114  116    2    4  114  P01741     Ig heavy chain V region OS=Mus musculus PE=1 SV=1
 1021 : HVM43_MOUSE         0.47  0.76  110  227   20  144  126    2    9  144  P01819     Ig heavy chain V region MOPC 141 OS=Mus musculus PE=4 SV=1
 1022 : HVM50_MOUSE         0.47  0.73  110  227    1  120  122    2    6  120  P06329     Ig heavy chain V region AC38 15.3 OS=Mus musculus PE=1 SV=1
 1023 : I3JIU6_ORENI        0.47  0.70    1  101    1  102  102    1    1  112  I3JIU6     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1024 : I3MKU1_SPETR        0.47  0.72  113  220    1  105  110    3    7  125  I3MKU1     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1025 : K7T9I0_MOUSE        0.47  0.77  118  227    1  109  112    3    5  109  K7T9I0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1026 : K7T9K9_MOUSE        0.47  0.73  118  227    1  113  115    3    7  113  K7T9K9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1027 : K7TGT1_MOUSE        0.47  0.74  118  227    1  114  116    3    8  114  K7TGT1     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1028 : K7TGT6_MOUSE        0.47  0.74  118  227    1  109  113    3    7  109  K7TGT6     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1029 : K7TGU3_MOUSE        0.47  0.76  118  227    1  109  113    3    7  109  K7TGU3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1030 : K7THH3_MOUSE        0.47  0.72  122  227    1  108  111    2    8  108  K7THH3     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1031 : K7TQW9_MOUSE        0.47  0.68  118  227    1  111  113    2    5  111  K7TQW9     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1032 : K7TR13_MOUSE        0.47  0.74  118  227    1  114  116    3    8  114  K7TR13     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1033 : K7TR71_MOUSE        0.47  0.73  118  227    1  110  111    2    2  110  K7TR71     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1034 : K7TRP3_MOUSE        0.47  0.69  118  227    1  112  115    2    8  112  K7TRP3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1035 : K7U5X0_MOUSE        0.47  0.73  118  227    1  115  116    2    7  115  K7U5X0     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1036 : K7U6D5_MOUSE        0.47  0.74  118  227    1  110  111    2    2  110  K7U6D5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1037 : K7U6I8_MOUSE        0.47  0.73  118  227    1  109  112    2    5  109  K7U6I8     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1038 : K9IVC6_DESRO        0.47  0.72  110  232   20  138  124    2    6  147  K9IVC6     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1039 : K9IVD0_DESRO        0.47  0.72  110  232   26  144  124    2    6  152  K9IVD0     Uncharacterized protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1040 : KV16_RABIT          0.47  0.70    2  108    1  113  113    3    6  114  P01697     Ig kappa chain V region AH80-5 OS=Oryctolagus cuniculus PE=1 SV=1
 1041 : KV202_HUMAN         0.47  0.71    1  108    1  112  113    2    6  113  P01615     Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1
 1042 : KV3A7_MOUSE         0.47  0.76    1  108    1  111  112    2    5  112  P01659     Ig kappa chain V-III region TEPC 124 OS=Mus musculus PE=1 SV=1
 1043 : M3Z565_MUSPF        0.47  0.71    1  104    1  109  109    1    5  114  M3Z565     Uncharacterized protein (Fragment) OS=Mustela putorius furo PE=4 SV=1
 1044 : Q53VQ5_MOUSE        0.47  0.75  110  221    1  119  120    3    9  119  Q53VQ5     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1045 : Q7TPE3_MOUSE        0.47  0.70  113  232    1  122  125    2    8  136  Q7TPE3     V23-D-J-IgG1 protein (Fragment) OS=Mus musculus GN=V23-D-J-IgG1 PE=2 SV=1
 1046 : Q9JL83_MOUSE        0.47  0.71  118  227    1  110  111    2    2  110  Q9JL83     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1047 : Q9UL80_HUMAN        0.47  0.72    1  108    1  113  113    1    5  114  Q9UL80     Myosin-reactive immunoglobulin light chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1048 : Q9UL94_HUMAN        0.47  0.74  110  227    1  119  121    2    5  119  Q9UL94     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1049 : A0N1R6_MOUSE        0.46  0.75  110  227   20  134  120    4    7  134  A0N1R6     CC49 Fab (Precursor) OS=Mus musculus PE=2 SV=1
 1050 : A0N587_9MURI        0.46  0.72  110  227   20  139  121    4    4  139  A0N587     Anti-CD4 mAb M-T151 variable region heavy chain (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
 1051 : A0N5U0_9MURI        0.46  0.77  110  227    1  119  120    2    3  119  A0N5U0     Anti-hepatitis B virus core antigen MoAb 14B8 heavy chain variable region (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
 1052 : A2MY49_MOUSE        0.46  0.71  110  227    1  116  119    2    4  116  A2MY49     Anti-acid phosphatase variable heavy chain 18 (Fragment) OS=Mus musculus PE=2 SV=1
 1053 : A2NYU9_HUMAN        0.46  0.67  110  227    1  122  123    3    6  122  A2NYU9     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1054 : A2P2H8_SHEEP        0.46  0.69  110  227   20  140  125    3   11  140  A2P2H8     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1055 : F1LYU4_RAT          0.46  0.75   11  105   10  107   99    2    5  107  F1LYU4     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1056 : F1M6G9_RAT          0.46  0.66    1  107   20  131  112    1    5  132  F1M6G9     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1057 : F6XWB2_MOUSE        0.46  0.65    1  107    1  112  112    1    5  114  F6XWB2     Uncharacterized protein OS=Mus musculus GN=Igkv1-115 PE=4 SV=1
 1058 : F7H884_MACMU        0.46  0.68    1  108    1  113  114    2    7  114  F7H884     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=LOC708249 PE=4 SV=1
 1059 : G1PYP0_MYOLU        0.46  0.68  110  218   20  129  114    4    9  142  G1PYP0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1060 : G1Q1X4_MYOLU        0.46  0.76  110  225   20  132  118    2    7  134  G1Q1X4     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1061 : G3UDE8_LOXAF        0.46  0.71    1  108    1  114  114    1    6  114  G3UDE8     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1062 : HV01_XENLA          0.46  0.70  113  227   21  136  119    3    7  136  P20956     Ig heavy chain V region XIG8 (Fragment) OS=Xenopus laevis PE=2 SV=1
 1063 : HVM15_MOUSE         0.46  0.72  110  227   20  136  119    2    3  136  P01759     Ig heavy chain V region BCL1 OS=Mus musculus PE=4 SV=1
 1064 : HVM47_MOUSE 1J1O    0.46  0.72  110  227    1  113  118    2    5  113  P01823     Ig heavy chain V region 36-60 OS=Mus musculus PE=1 SV=1
 1065 : HVM48_MOUSE         0.46  0.73  110  227   20  138  120    3    3  138  P03980     Ig heavy chain V region TEPC 1017 OS=Mus musculus PE=4 SV=1
 1066 : K7T9P5_MOUSE        0.46  0.68  118  227    1  113  115    2    7  113  K7T9P5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1067 : K7TD45_MOUSE        0.46  0.71  118  227    1  107  113    3    9  107  K7TD45     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1068 : K7TDG8_MOUSE        0.46  0.75  118  227    1  112  113    3    4  112  K7TDG8     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1069 : K7TDM5_MOUSE        0.46  0.70  118  227    1  109  112    2    5  109  K7TDM5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1070 : K7TH41_MOUSE        0.46  0.75  118  227    1  112  113    3    4  112  K7TH41     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1071 : K7TH43_MOUSE        0.46  0.67  118  227    1  112  114    2    6  112  K7TH43     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1072 : K7THB2_MOUSE        0.46  0.68  118  227    1  111  114    2    7  111  K7THB2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1073 : K7TR05_MOUSE        0.46  0.73  118  227    1  111  112    2    3  111  K7TR05     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1074 : K7TRK1_MOUSE        0.46  0.70  118  227    1  112  114    2    6  112  K7TRK1     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1075 : K7TRK9_MOUSE        0.46  0.73  118  227    1  110  113    4    6  110  K7TRK9     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1076 : K7U643_MOUSE        0.46  0.73  118  227    1  109  112    3    5  109  K7U643     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1077 : KV2A1_MOUSE         0.46  0.69    1  108    1  112  113    2    6  112  P01626     Ig kappa chain V-II region MOPC 167 OS=Mus musculus PE=1 SV=1
 1078 : KV2A3_MOUSE         0.46  0.69    1  108    1  112  113    2    6  113  P01628     Ig kappa chain V-II region MOPC 511 OS=Mus musculus PE=1 SV=1
 1079 : M0R813_RAT          0.46  0.66    1  107    1  112  112    1    5  114  M0R813     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 1080 : O95973_HUMAN        0.46  0.72  110  232   20  142  127    4    8  150  O95973     VH4 heavy chain variable region (Precursor) OS=Homo sapiens GN=IGM PE=1 SV=1
 1081 : Q53VQ9_MOUSE        0.46  0.73  110  221    1  119  120    3    9  119  Q53VQ9     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1082 : Q53VR3_MOUSE        0.46  0.73  110  221    1  119  120    3    9  119  Q53VR3     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1083 : Q683Y7_MOUSE        0.46  0.68  110  227    1  116  119    2    4  116  Q683Y7     Immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus GN=IGHV PE=2 SV=1
 1084 : Q6LBQ5_MOUSE        0.46  0.75  111  227   20  136  118    2    2  136  Q6LBQ5     VH gene product (Fragment) OS=Mus musculus GN=Gm16932 PE=4 SV=1
 1085 : Q8VIJ1_MOUSE        0.46  0.71  110  227    1  123  126    2   11  123  Q8VIJ1     Anti-DNA heavy chain (Fragment) OS=Mus musculus GN=J558 PE=2 SV=1
 1086 : Q920E8_MOUSE        0.46  0.70  110  226    1  120  122    2    7  120  Q920E8     Pterin-mimicking anti-idiotope heavy chain variable region (Fragment) OS=Mus musculus PE=4 SV=1
 1087 : Q96QS0_HUMAN        0.46  0.74  110  232   20  154  136    4   14  159  Q96QS0     Putative matrix cell adhesion molecule-3 OS=Homo sapiens PE=1 SV=1
 1088 : Q9JL81_MOUSE        0.46  0.71  118  227    1  114  115    2    6  114  Q9JL81     Anti-myosin immunoglobulin heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1089 : A0N5G4_HUMAN        0.45  0.67  117  232    1  119  123    4   11  119  A0N5G4     Rheumatoid factor G9 heavy chain (Fragment) OS=Homo sapiens GN=VH4 PE=2 SV=1
 1090 : A2NB44_HUMAN        0.45  0.66  110  222    1  114  116    3    5  114  A2NB44     Cold agglutinin FS-2 H-chain (Fragment) OS=Homo sapiens GN=IGH@ PE=2 SV=1
 1091 : A2NYU8_HUMAN        0.45  0.71  110  227    1  116  119    3    4  116  A2NYU8     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1092 : A2P2G6_SHEEP        0.45  0.71  110  227   20  139  122    3    6  139  A2P2G6     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1093 : B5UB60_MOUSE        0.45  0.72  110  227    1  119  120    2    3  119  B5UB60     CP1-5 heavy chain variable region (Fragment) OS=Mus musculus GN=CP1-5VH PE=2 SV=1
 1094 : B5UB62_MOUSE        0.45  0.71  110  227    1  119  120    2    3  119  B5UB62     CP1-10 heavy chain variable region (Fragment) OS=Mus musculus GN=CP1-10VH PE=2 SV=1
 1095 : F1LYF1_RAT          0.45  0.68    1  107    1  112  112    1    5  115  F1LYF1     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1096 : F1M195_RAT          0.45  0.69    2  108    2  114  113    1    6  118  F1M195     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=2
 1097 : F6W517_ORNAN        0.45  0.67  113  220    2  110  112    4    7  117  F6W517     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1098 : F6ZNU9_ORNAN        0.45  0.65  110  227   20  143  127    4   12  143  F6ZNU9     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=1
 1099 : F7E5M1_CALJA        0.45  0.74  110  226   20  135  119    2    5  136  F7E5M1     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
 1100 : F7EBH2_ORNAN        0.45  0.63  110  226   19  134  120    3    7  135  F7EBH2     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1101 : G1Q136_MYOLU        0.45  0.69  110  219    3  114  118    3   14  114  G1Q136     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1102 : G1QB60_MYOLU        0.45  0.69  110  219   20  137  121    5   14  137  G1QB60     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1103 : G3MWT1_BOVIN        0.45  0.73  110  220   20  127  114    3    9  137  G3MWT1     Uncharacterized protein OS=Bos taurus GN=LOC100300028 PE=4 SV=1
 1104 : G3UDY8_LOXAF        0.45  0.75  110  223   20  138  119    2    5  142  G3UDY8     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1105 : H0VCV9_CAVPO        0.45  0.70    1  108    1  108  114    2   12  115  H0VCV9     Uncharacterized protein (Fragment) OS=Cavia porcellus PE=4 SV=1
 1106 : H0XS43_OTOGA        0.45  0.65    1  106    1  105  111    2   11  114  H0XS43     Uncharacterized protein (Fragment) OS=Otolemur garnettii PE=4 SV=1
 1107 : HV2A_RABIT          0.45  0.67  115  226    5  114  114    4    6  114  P01827     Ig heavy chain V-A2 region BS-1 OS=Oryctolagus cuniculus PE=1 SV=1
 1108 : HVM46_MOUSE         0.45  0.74  110  227   19  137  121    4    5  137  P01822     Ig heavy chain V region MOPC 315 OS=Mus musculus PE=1 SV=2
 1109 : K9J4H4_DESRO        0.45  0.71  110  232   20  144  128    2    8  153  K9J4H4     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
 1110 : Q53VQ1_MOUSE        0.45  0.73  110  221    1  115  117    4    7  115  Q53VQ1     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1111 : Q53VR7_MOUSE        0.45  0.72  110  221    1  120  121    3   10  120  Q53VR7     VH-D-JH region (Fragment) OS=Mus musculus PE=2 SV=1
 1112 : Q7Z3Y6_HUMAN        0.45  0.68  110  217    1  116  117    3   10  116  Q7Z3Y6     Rearranged VH4-34 V gene segment (Fragment) OS=Homo sapiens GN=VH4-34 PE=4 SV=1
 1113 : Q9Z1C6_MOUSE        0.45  0.71  110  227    1  117  119    2    3  117  Q9Z1C6     Anti-porcine VCAM mAb 2A2 heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1114 : A2IPH2_HUMAN        0.44  0.64  113  227    1  123  126    4   14  123  A2IPH2     HRV Fab N6-VH (Fragment) OS=Homo sapiens PE=2 SV=1
 1115 : A2IPH5_HUMAN        0.44  0.64  113  227    1  123  126    4   14  123  A2IPH5     HRV Fab N28-VH (Fragment) OS=Homo sapiens PE=2 SV=1
 1116 : A2MYC6_9MURI        0.44  0.74  110  227    1  125  126    2    9  125  A2MYC6     MA-15 heavy chain (Fragment) OS=Mus sp. PE=2 SV=1
 1117 : A2N0S6_HUMAN        0.44  0.68  118  229    1  119  119    3    7  120  A2N0S6     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1118 : A2N0S9_HUMAN        0.44  0.69  118  229    1  115  117    4    7  116  A2N0S9     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1119 : A2N0T1_HUMAN        0.44  0.68  118  229    1  118  118    4    6  119  A2N0T1     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1120 : A2P2G5_SHEEP        0.44  0.68  110  227   20  141  126    3   12  141  A2P2G5     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1121 : A2P2G7_SHEEP        0.44  0.69  110  227   20  140  126    4   13  140  A2P2G7     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1122 : A2P2H5_SHEEP        0.44  0.68  110  227   20  140  125    3   11  140  A2P2H5     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1123 : A2P2I0_SHEEP        0.44  0.71  110  227   20  142  126    3   11  142  A2P2I0     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1124 : A2P2I3_SHEEP        0.44  0.69  110  227   20  142  127    3   13  142  A2P2I3     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1125 : F1D885_MACMU        0.44  0.64  110  232   12  148  137    1   14  162  F1D885     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1126 : F7FT14_MONDO        0.44  0.63    3   96    1  114  114    1   20  115  F7FT14     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
 1127 : G1PNR8_MYOLU        0.44  0.75  110  226    1  121  122    3    6  122  G1PNR8     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1128 : G1Q853_MYOLU        0.44  0.70  110  217   15  128  117    4   12  139  G1Q853     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1129 : G1Q951_MYOLU        0.44  0.71  110  223   20  137  119    3    6  140  G1Q951     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1130 : G3N1H5_BOVIN        0.44  0.74  110  227   20  132  119    3    7  132  G3N1H5     Uncharacterized protein OS=Bos taurus GN=LOC100300716 PE=4 SV=1
 1131 : G3RB23_GORGO        0.44  0.66    1  106    1  105  111    2   11  105  G3RB23     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
 1132 : H2LBT0_ORYLA        0.44  0.69    1  108    1  105  108    1    3  105  H2LBT0     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1133 : K7T947_MOUSE        0.44  0.69  118  227    1  113  116    2    9  113  K7T947     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1134 : K7TDJ4_MOUSE        0.44  0.70  118  227    1  113  115    2    7  113  K7TDJ4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1135 : K7TDQ4_MOUSE        0.44  0.68  118  227    1  110  114    4    8  110  K7TDQ4     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1136 : K7TR77_MOUSE        0.44  0.73  118  227    1  111  114    2    7  111  K7TR77     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1137 : Q8CGS2_MOUSE        0.44  0.74  110  227    3  121  119    1    1  121  Q8CGS2     Anti-deoxynivalenol scFv lambda heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1138 : Q9UL75_HUMAN        0.44  0.67  110  227    1  122  125    4   10  122  Q9UL75     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1139 : A2IPH3_HUMAN        0.43  0.64  113  227    1  123  126    4   14  123  A2IPH3     HRV Fab N27-VH (Fragment) OS=Homo sapiens PE=2 SV=1
 1140 : A2N0T0_HUMAN        0.43  0.65  118  229    1  119  120    4    9  120  A2N0T0     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1141 : A2N0T8_HUMAN        0.43  0.66  118  229    1  115  116    4    5  116  A2N0T8     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1142 : A2P2H1_SHEEP        0.43  0.71  110  227   20  138  120    3    3  138  A2P2H1     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1143 : A2P2H3_SHEEP        0.43  0.72  110  227   20  140  123    3    7  140  A2P2H3     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1144 : A2P2H4_SHEEP        0.43  0.70  110  227   20  138  121    3    5  138  A2P2H4     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1145 : A2P2H6_SHEEP        0.43  0.67  110  227   20  144  129    3   15  144  A2P2H6     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1146 : A2P2H9_SHEEP        0.43  0.70  110  227   20  140  125    3   11  140  A2P2H9     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1147 : A2P2I2_SHEEP        0.43  0.65  110  227   20  145  129    3   14  145  A2P2I2     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1148 : A2P2I4_SHEEP        0.43  0.69  110  227   20  143  127    3   12  143  A2P2I4     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1149 : B5DC71_MOUSE        0.43  0.74  110  227    1  118  120    3    4  118  B5DC71     Variable domain of Fab 54-5C10-A heavy chain (Fragment) OS=Mus musculus GN=Na PE=2 SV=1
 1150 : F1D884_MACMU        0.43  0.63  110  232   12  150  139    1   16  164  F1D884     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1151 : F6T196_ORNAN        0.43  0.63  113  218    2  109  113    2   12  121  F6T196     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1152 : F7CW73_XENTR        0.43  0.66  113  218    4  117  116    3   12  125  F7CW73     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1153 : G1QCT2_MYOLU        0.43  0.73  110  221   20  133  117    2    8  139  G1QCT2     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1154 : G1QD96_MYOLU        0.43  0.69  110  230   20  139  123    4    5  139  G1QD96     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1155 : G3U707_LOXAF        0.43  0.69    1  106    1  105  111    2   11  114  G3U707     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1156 : H9H3X7_MACMU        0.43  0.74  110  219    1  113  114    3    5  121  H9H3X7     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=4 SV=1
 1157 : HV201_HUMAN         0.43  0.69  110  227    1  126  127    4   10  126  P01814     Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1
 1158 : K7T9U2_MOUSE        0.43  0.70  118  227    1  112  116    3   10  112  K7T9U2     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1159 : K7TDP3_MOUSE        0.43  0.71  118  227    1  111  115    5    9  111  K7TDP3     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1160 : K7TGR5_MOUSE        0.43  0.69  118  227    1  112  115    4    8  112  K7TGR5     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1161 : M0RAB8_RAT          0.43  0.66    1  107    1  115  115    2    8  116  M0RAB8     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 1162 : Q9UL96_HUMAN        0.43  0.69  110  227    1  121  124    4    9  121  Q9UL96     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1163 : A0N589_9MURI        0.42  0.70  110  227   19  137  121    4    5  137  A0N589     Anti-CD4 mAb M-T310 variable region heavy chain (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
 1164 : A2N0T7_HUMAN        0.42  0.66  118  229    1  113  115    4    5  114  A2N0T7     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1165 : A2N0T9_HUMAN        0.42  0.67  118  229    1  114  115    3    4  115  A2N0T9     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1166 : A2N0U0_HUMAN        0.42  0.64  118  229    1  113  115    4    5  114  A2N0U0     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1167 : A2N0U1_HUMAN        0.42  0.67  118  229    1  113  115    4    5  114  A2N0U1     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1168 : A2N0U2_HUMAN        0.42  0.65  118  229    1  113  115    4    5  114  A2N0U2     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1169 : A2N0U6_HUMAN        0.42  0.65  118  229    1  115  118    4    9  116  A2N0U6     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1170 : A2NYU6_HUMAN        0.42  0.64  110  227    1  127  128    4   11  127  A2NYU6     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1171 : A2NYU7_HUMAN        0.42  0.64  110  227    1  127  128    4   11  127  A2NYU7     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1172 : A2NYV0_HUMAN        0.42  0.67  110  227    1  122  124    3    8  122  A2NYV0     Heavy chain Fab (Fragment) OS=Homo sapiens PE=2 SV=1
 1173 : F1D886_MACMU        0.42  0.65  110  232   12  149  139    2   17  163  F1D886     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1174 : G1Q2B0_MYOLU        0.42  0.66  110  223   20  138  125    4   17  142  G1Q2B0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1175 : G1QDI2_MYOLU        0.42  0.69  110  227    1  121  127    3   15  121  G1QDI2     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1176 : G3MZH0_BOVIN        0.42  0.71  110  227   20  132  119    3    7  132  G3MZH0     Uncharacterized protein OS=Bos taurus GN=LOC100300806 PE=4 SV=1
 1177 : G3S1A4_GORGO        0.42  0.66    1  108    1  107  113    2   11  112  G3S1A4     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=IGKV2D-29 PE=4 SV=1
 1178 : G3TZY3_LOXAF        0.42  0.72  110  223   20  141  123    2   10  145  G3TZY3     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
 1179 : H0VLG7_CAVPO        0.42  0.63    1  108    1  107  113    2   11  113  H0VLG7     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100728846 PE=4 SV=1
 1180 : HV105_HUMAN         0.42  0.59  110  229    1  124  125    2    6  124  P01760     Ig heavy chain V-I region WOL OS=Homo sapiens PE=1 SV=1
 1181 : HV203_HUMAN         0.42  0.64  110  227    1  119  122    4    7  119  P01816     Ig heavy chain V-II region DAW OS=Homo sapiens PE=1 SV=1
 1182 : HV2C_RABIT          0.42  0.64  115  227   24  136  118    3   10  136  P01829     Ig heavy chain V-A2 region P-MU-3 OS=Oryctolagus cuniculus PE=4 SV=1
 1183 : K7FFG6_PELSI        0.42  0.57  113  227    4  127  127    3   15  127  K7FFG6     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
 1184 : K7TRE2_MOUSE        0.42  0.72  118  227    1  113  116    4    9  113  K7TRE2     IgM heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1185 : L5M8S2_MYODS        0.42  0.59  111  206   22  148  128    4   33  156  L5M8S2     Ig heavy chain V-III region VH26 OS=Myotis davidii GN=MDA_GLEAN10001099 PE=4 SV=1
 1186 : M3WRW6_FELCA        0.42  0.65    1  108    1  107  113    2   11  114  M3WRW6     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1187 : M3X1A8_FELCA        0.42  0.67    1  108    1  107  113    2   11  113  M3X1A8     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1188 : Q8IZD7_HUMAN        0.42  0.65  110  227    1  130  130    4   12  130  Q8IZD7     Anti-thyroglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1189 : A2N0S5_HUMAN        0.41  0.66  118  229    1  113  116    4    7  114  A2N0S5     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1190 : A2N0S8_HUMAN        0.41  0.66  119  229    2  119  119    4    9  120  A2N0S8     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1191 : A2P2G3_SHEEP        0.41  0.68  110  227   20  142  125    3    9  142  A2P2G3     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1192 : A2P2H2_SHEEP        0.41  0.67  110  227   20  144  128    3   13  144  A2P2H2     VH region (Precursor) OS=Ovis aries GN=VH PE=2 SV=1
 1193 : F1D887_MACMU        0.41  0.61  110  232   12  148  140    2   20  162  F1D887     Anti-quaternary epitope monoclonal antibody heavy chain (Fragment) OS=Macaca mulatta PE=2 SV=1
 1194 : F7ANK9_XENTR        0.41  0.62  113  222    4  115  121    4   20  121  F7ANK9     Uncharacterized protein (Fragment) OS=Xenopus tropicalis PE=4 SV=1
 1195 : G1PZ95_MYOLU        0.41  0.69  110  222   20  139  124    4   15  144  G1PZ95     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1196 : G8F145_MACMU        0.41  0.67  110  219    1  111  118    4   15  119  G8F145     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_20223 PE=4 SV=1
 1197 : HV108_HUMAN         0.41  0.68  111  227    2  120  121    3    6  120  P80421     Ig heavy chain V-I region DOT OS=Homo sapiens PE=1 SV=1
 1198 : HV207_HUMAN 7FAB    0.41  0.66  110  227    1  117  120    3    5  117  P01825     Ig heavy chain V-II region NEWM OS=Homo sapiens PE=1 SV=1
 1199 : I3JIV3_ORENI        0.41  0.69    8  108    7  106  103    2    5  107  I3JIV3     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
 1200 : K7TDK7_MOUSE        0.41  0.68  118  227    1  114  117    2   10  114  K7TDK7     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1201 : M0R6U4_RAT          0.41  0.67    1  106    1  105  111    2   11  115  M0R6U4     Uncharacterized protein (Fragment) OS=Rattus norvegicus PE=4 SV=1
 1202 : A2N0T2_HUMAN        0.40  0.65  122  229    1  115  116    4    9  116  A2N0T2     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1203 : A2N0T5_HUMAN        0.40  0.67  118  229    1  114  117    4    8  115  A2N0T5     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1204 : A2N0T6_HUMAN        0.40  0.64  118  229    1  118  121    4   12  119  A2N0T6     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1205 : G1Q8L6_MYOLU        0.40  0.62  110  220    1  116  121    5   15  127  G1Q8L6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1206 : G1QG49_MYOLU        0.40  0.67  110  227   20  146  133    3   21  146  G1QG49     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1207 : G3TXG5_LOXAF        0.40  0.69  110  224    1  122  127    2   17  125  G3TXG5     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1208 : HV202_HUMAN         0.40  0.62  110  227    1  120  126    5   14  120  P01815     Ig heavy chain V-II region COR OS=Homo sapiens PE=1 SV=1
 1209 : HV206_HUMAN 1ZVO    0.40  0.61  111  227    2  129  132    4   19  129  P01824     Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1
 1210 : K7T9M5_MOUSE        0.40  0.68  118  227    1  114  117    2   10  114  K7T9M5     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1211 : L5LI02_MYODS        0.40  0.55  110  207   20  150  134    2   39  157  L5LI02     Ig heavy chain V region M315 OS=Myotis davidii GN=MDA_GLEAN10000708 PE=4 SV=1
 1212 : Q811U5_MOUSE2R0W    0.40  0.69  110  227    1  118  121    4    6  118  Q811U5     Anti-human Fc gamma receptor III 3G8 gamma heavy chain variable region (Fragment) OS=Mus musculus GN=Gm9740 PE=1 SV=1
 1213 : Q96JD1_HUMAN1PW3    0.40  0.61    8  107    7  110  104    3    4  112  Q96JD1     Amyloid lambda 6 light chain variable region PIP (Fragment) OS=Homo sapiens PE=1 SV=1
 1214 : A0N6Q7_9MURI        0.39  0.70  110  221    1  120  122    4   12  120  A0N6Q7     Rheumatoid factor RF3-2CR2A (Fragment) OS=Mus sp. GN=Ig VH PE=2 SV=1
 1215 : A2N2G8_HUMAN        0.39  0.57   12  105   10  107   99    4    6  108  A2N2G8     VLC8 protein (Fragment) OS=Homo sapiens GN=VLC8 PE=2 SV=1
 1216 : G1PYJ6_MYOLU        0.39  0.67  116  227    1  112  118    3   12  112  G1PYJ6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1217 : HV205_HUMAN         0.39  0.69  110  227    1  121  122    3    5  121  P01818     Ig heavy chain V-II region HE OS=Homo sapiens PE=1 SV=1
 1218 : K7TH57_MOUSE        0.39  0.64  118  227    1  115  118    3   11  115  K7TH57     IgA heavy chain variable region (Fragment) OS=Mus musculus PE=2 SV=1
 1219 : Q9UL74_HUMAN        0.39  0.61  119  227    1  118  121    4   15  118  Q9UL74     Myosin-reactive immunoglobulin heavy chain variable region (Fragment) OS=Homo sapiens PE=2 SV=1
 1220 : A2KUC4_HUMAN        0.38  0.59    8  107    5  108  104    3    4  112  A2KUC4     UGa8L (Fragment) OS=Homo sapiens GN=IGLV PE=4 SV=1
 1221 : A2N0S7_HUMAN        0.38  0.63  118  229    1  119  123    5   15  120  A2N0S7     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1222 : G1QDT6_MYOLU        0.38  0.59    8  106    7  103  103    4   10  105  G1QDT6     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1223 : G1QF95_MYOLU        0.38  0.63  110  232   20  154  140    2   22  159  G1QF95     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
 1224 : G3UDL4_LOXAF        0.38  0.66  110  224    1  120  125    4   15  124  G3UDL4     Uncharacterized protein (Fragment) OS=Loxodonta africana PE=4 SV=1
 1225 : HV107_HUMAN         0.38  0.66  110  227    1  125  128    4   13  125  P06326     Ig heavy chain V-I region Mot OS=Homo sapiens PE=1 SV=1
 1226 : HV2B_RABIT          0.38  0.58  115  226    5  117  118    4   11  117  P01828     Ig heavy chain V-A2 region K-25 OS=Oryctolagus cuniculus PE=1 SV=1
 1227 : G1QCT5_MYOLU        0.37  0.67  110  227    1  127  130    2   15  127  G1QCT5     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
 1228 : H0WLF1_OTOGA        0.37  0.58   11  108   10  106  102    4    9  111  H0WLF1     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=IGLV6-57 PE=4 SV=1
 1229 : IGW3_HETFR          0.37  0.64  110  230    1  118  121    2    3  118  P83907     IgW heavy chain V region W26 (Fragment) OS=Heterodontus francisci PE=2 SV=1
 1230 : A2N0T3_HUMAN        0.36  0.58  118  230    1  115  118    4    8  115  A2N0T3     VH6DJ protein (Fragment) OS=Homo sapiens GN=VH6DJ PE=2 SV=1
 1231 : F7E066_ORNAN        0.36  0.61  110  219    1  113  118    4   13  115  F7E066     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
 1232 : HV106_HUMAN         0.36  0.61  110  229    1  124  129    5   14  124  P01761     Ig heavy chain V-I region SIE OS=Homo sapiens PE=1 SV=1
 1233 : HV204_HUMAN         0.35  0.64  110  227    1  125  129    4   15  125  P01817     Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1
 1234 : A0N8U8_HETFR        0.30  0.48    4  108   20  133  120    6   21  242  A0N8U8     Variable region OS=Heterodontus francisci PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 A D              0   0  183  423   16    D      D               D            D D                             
     2    2 A I        -     0   0   32  466   12    I      I               I            I I                             
     3    3 A E        -     0   0  117  468   68    V      Q               Q            Q Q                             
     4    4 A L  E     -A   25   0A  10  482    7    L      M               M            M M                             
     5    5 A T  E     -A   24   0A  64  482    8    T      T               T            T T                             
     6    6 A Q  E     -A   23   0A  13  482    0    Q      Q               Q            Q Q                             
     7    7 A T  E    S+A   22   0A  64  482   35    S      S               S            S S                             
     8    8 A P        -     0   0   46  485    9    P      P               P            P P                             
     9    9 A V  S    S+     0   0   96  489   67    A      D               A            A A                             
    10   10 A S  E     -d  104   0B  60  491   42    S      Y               S            S S                             
    11   11 A L  E     -d  105   0B  58  494   23    L      L               L            L L                             
    12   12 A S  E     +d  106   0B  60  495   42    S      S               S            S S                             
    13   13 A A  E     -d  107   0B   0  495   58    A      A               A            A A                             
    14   14 A S    >   -     0   0   47  496   31    S      S               S            S S                             
    15   15 A V  T 3  S+     0   0   76  496   66    V      V               V            V V                             
    16   16 A G  T 3  S+     0   0   42  496    5    G      G               G            G G                             
    17   17 A E    <   -     0   0   71  496   36    E      E               E            E E                             
    18   18 A T        -     0   0   69  496   62    T      T               T            T T                             
    19   19 A V  E     - B   0  75A  11  496   36    V      V               V            V V                             
    20   20 A T  E     - B   0  74A  67  495   29    T      T               T            T T                             
    21   21 A I  E     - B   0  73A   1  494   17    I      I               I            I I                             
    22   22 A T  E     -AB   7  72A  29  494   59    T      T               T            T T                             
    23   23 A b  E     -AB   6  71A   0  495    1    C      C               C            C C                             
    24   24 A R  E     -AB   5  70A 110  495   47    R      R               R            R R                             
    25   25 A A  E     -A    4   0A  10  495   28    A      A               A            A A                             
    26   26 A S  S    S+     0   0   66  495    4    S      S               S            S S                             
    27   27 A E  S    S-     0   0  101  495   38    E      E               G            G G                             
    28   28 A N        +     0   0   83  495   45    N      N               N            N N                             
    29   29 A I    >   -     0   0    5  496   32    I      I               I            I I                             
    30   30 A Y  T 3   -     0   0  155  496   81    Y      Y               H            H H                             
    31   31 A S  T 3  S+     0   0   53  471   64    S      S               N            N N                             
    32   32 A Y    <   +     0   0   63  495   53    Y      Y               Y            Y Y                             
    33   33 A L  E     -E   90   0B   0  495    7    L      L               L            L L                             
    34   34 A A  E     -E   89   0B   0  495   71    L      A               A            A A                             
    35   35 A W  E     -EF  88  48B   1  496    0    W      W               W            W W                             
    36   36 A Y  E     -EF  87  46B   0  496    8    Y      Y               Y            Y Y                             
    37   37 A Q  E     -EF  86  45B   7  496   27    Q      Q               Q            Q Q                             
    38   38 A Q  E     -E   85   0B  21  496    4    Q      Q               Q            Q Q                             
    39   39 A K    >   -     0   0   51  495    8    K      K               K            K K                             
    40   40 A Q  T 3  S+     0   0  190  496   18    Q      Q               Q            Q P                             
    41   41 A G  T 3  S+     0   0   86  496   10    G      G               G            G G                             
    42   42 A K  S <  S-     0   0  126  495   54    K      K               K            K K                             
    43   43 A S        -     0   0   21  495   56    S      S               S            S S                             
    44   44 A P        -     0   0    4  495   10    P      P               P            P P                             
    45   45 A Q  E     -F   37   0B  74  495   32    Q      Q               Q            Q Q                             
    46   46 A F  E     +F   36   0B  25  495   41    L      L               L            L L                             
    47   47 A L  E     +     0   0B   4  495    9    L      L               L            L L                             
    48   48 A V  E     -FG  35  54B   0  496    5    V      V               V            V V                             
    49   49 A Y  E >> S+ G   0  53B  39  496   17    Y      Y               Y            Y Y                             
    50   50 A N  T 34 S-     0   0   52  496   91    N      D               N            N N                             
    51   51 A A  T 34 S+     0   0    3  496   44    A      A               A            A A                             
    52   52 A K  T <4 S+     0   0  148  496   25    K      K               K            K K                             
    53   53 A T  E  <  -G   49   0B  47  496   68    T      T               T            T T                             
    54   54 A L  E     -G   48   0B  60  496   59    L      L               L            L L                             
    55   55 A G    >   -     0   0    9  495   70    A      V               A            A A                             
    56   56 A E  T 3  S+     0   0  192  495   35    E      E               D            D D                             
    57   57 A G  T 3  S+     0   0   70  496    5    G      G               G            G G                             
    58   58 A V    <   -     0   0   25  494   10    V      V               V            V V                             
    59   59 A P    >   -     0   0   47  495    7    P      P               P            P P                             
    60   60 A S  T 3  S+     0   0  115  496   56    S      S               S            S S                             
    61   61 A R  T 3  S+     0   0   44  496    4    R      R               R            R R                             
    62   62 A F  E <   +C   75   0A   5  496    1    F      F               F            F F                             
    63   63 A S  E     -C   74   0A  55  495   23    S      S               S            S S                             
    64   64 A G  E     +C   73   0A  13  496    2    G      G               G            G G                             
    65   65 A S  E     +C   72   0A  63  496    6    S      S               S            S S                             
    66   66 A G  E     -C   71   0A  36  496   14    G      G               G            G G                             
    67   67 A S  E >   +C   70   0A  79  496    9    S      S               S            S S                             
    68   68 A G  T 3  S-     0   0   16  496   12    G      G               G            G G                             
    69   69 A T  T 3  S+     0   0   67  495   13    T      T               T            T T                             
    70   70 A Q  E <   +BC  24  67A 110  496   29    Q      Q               Q            Q Q                             
    71   71 A F  E     -BC  23  66A   2  494    5    F      F               Y            Y Y                             
    72   72 A S  E     -BC  22  65A  26  495   30    S      S               S            S S                             
    73   73 A L  E     -BC  21  64A   0  496    2    L      L               L            L L                             
    74   74 A K  E     -BC  20  63A  97  496   38    K      K               K            K K                             
    75   75 A I  E     -BC  19  62A   0  496    1    I      I               I            I I                             
    76   76 A N  S    S-     0   0   86  496   29    N      N               N            N N                             
    77   77 A S  S    S-     0   0   58  496   62    S      S               S            S S                             
    78   78 A L        -     0   0    0  496   27    L      L               L            L L                             
    79   79 A L    >   -     0   0   67  496   31    Q      Q               Q            Q Q                             
    80   80 A P  G >  S+     0   0   92  496   59    P      P               P            P P                             
    81   81 A E  G 3  S+     0   0  102  496   15    E      E               E            E E                             
    82   82 A D  G <  S+     0   0    1  496    5    D      D               D            D D                             
    83   83 A F    <   +     0   0   29  495   73    F      F               F            F F                             
    84   84 A G  E    S- H   0 105B  17  496   23    G      G               G            G G                             
    85   85 A S  E     -EH  38 104B  24  496   62    S      S               S            S S                             
    86   86 A Y  E     -EH  37 103B   0  496    0    Y      Y               Y            Y Y                             
    87   87 A Y  E     -E   36   0B   5  495    4    F      Y               Y            Y Y                             
    88   88 A b  E     -E   35   0B   0  496    0    C      C               C            C C                             
    89   89 A Q  E     -EI  34  99B   0  494   48    Q      Q               Q            . .                             
    90   90 A H  E     -E   33   0B  22  486   28    H      H               H            Q Q                             
    91   91 A H        +     0   0    0  423   89    H      H               F            H H                             
    92   92 A Y  S    S+     0   0  104  454   87    F      Y               W            F F                             
    93   93 A G  S    S-     0   0   34  421   71    G      .               S            W W                             
    94   94 A T  S    S-     0   0  104  444   88    T      G               T            S S                             
    95   95 A P  S    S+     0   0    7  441   51    .      I               P            T T                             
    96   96 A P  S    S-     0   0   55  420   76    P      P                            P P                             
    97   97 A L        -     0   0   21  151   88    W      F                            W W                             
    98   98 A T        -     0   0   40  278   41    T      T                            T T                             
    99   99 A F  B     -I   89   0B  18  277   26    F      F                            F F                             
   100  100 A G        -     0   0    3  285   38    G      G                            G G                             
   101  101 A G        -     0   0   52  300   63    G      S                            G G                             
   102  102 A G        -     0   0   11  300   41    G      G                            G G                             
   103  103 A T  E     - H   0  86B   0  360   19    T      T                            T T                             
   104  104 A K  E     -dH  10  85B  98  359   60    S      K                            K K                             
   105  105 A L  E     -dH  11  84B   4  343   39    L      L                            L L                             
   106  106 A E  E     -d   12   0B 108  326   52    E      E                            E E                             
   107  107 A I  E      d   13   0B 113  295   51    I      I                            I I                             
   108  108 A K              0   0  145  261   18    K      K                            K K                             
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30  E  E EDE                  EQ           E Q            EQ       E      
   111    2 B V        +     0   0   19  428   12  V  V VVV                  VV           V V            VV       V      
   112    3 B K  E     -J  134   0C 111  430   32  K  Q MKK                  KK           Q K            IK       Q      
   113    4 B L  E     -J  133   0C   3  452    1  L  L LLL                  LL           L L            LL       L      
   114    5 B Q  E     -J  132   0C  83  454   70  V  V VVV                  VQ           V L            VL       V      
   115    6 B E  E     +J  131   0C   5  458   22  E  E EEE                  EE           E E            EE       E      
   116    7 B S  E     +J  130   0C  69  463   14  S  S SSS                  SSS          S S            SS       S      
   117    8 B G        +     0   0   36  467    4  G  G GGG                  GGG          G G            GG       G      
   118    9 B G        +     0   0   29  718   50  G  GGGGGG GG GGG GG GG GG GGGGGGGGGGGG G GGGGGGGGGGGGGGGG GGG GGGGGGGG
   119   10 B D        -     0   0   96  725   42  G  GDGGGG DD DDD DG DD DG GGDGDDGGDGGG D GGGDGDGGDGGDGGGGDGGG DGGGGGGG
   120   11 B L  E     +n  224   0D  79  727   14  L  LLLLLL LL LLL LL LL LL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLL LLLLLLLL
   121   12 B V  E     -n  225   0D  16  729   31  V  VVVVVV VV VVV VV VV VV VVVVVVVVVVVV V VVVVVVVVVVVVLVVVVVVV VVVVVVVV
   122   13 B Q    >   -     0   0  114  730   53  Q  KKKKKK KK KKK KQ KK KQ QQKQKKKKKKKQ K KQKKKKKKKQQKKKKKKQKQ KKQQQQQK
   123   14 B P  T 3  S+     0   0   66  730    7  P  PPPLPP PP PPP PP PP PP PPPPPPPPPPPP P PPPPPPPPPPPPPPPPPPPP PPPPPPPP
   124   15 B G  T 3  S+     0   0   58  734   31  GG GGGGGG GG GGG GG GGGGG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGGGG GGGGGGGG
   125   16 B G    <   -     0   0   25  736   63  GG GGGGGG GG GGG GGGGGGGG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   126   17 B S        +     0   0   78  735   29  SS SSSSSS SS SSS SSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   127   18 B L  E     - K   0 192C  25  737   28  LL LLLLLL LL LLL LLLLLLLL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLLRRLL
   128   19 B K  E     - K   0 191C  93  735   55  KK KKKKKK KK KKK KKKKKKKK KKKKKKKKKKKK K KKKKKKKKKKKKTKKKKKKKKKKKKKKKK
   129   20 B L  E     - K   0 190C   0  740   16  LL LLLLLL LLLLLLLLLLLLLLL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLVLLLLL
   130   21 B S  E     -JK 116 189C  28  740   37  SS SSSSSS SSSSSSSSSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   131   22 B d  E     -JK 115 188C   0  740    0  CC CCCCCC CCCCCCCCCCCCCCC CCCCCCCCCCCC C CCCCCCCCCCCCCCCCGCCCCCCCCCCCC
   132   23 B A  E     -JK 114 187C  52  740   67  AA AAAAAA AAAAAAAAAAAAAAA AAAAAAAAAAAA A AAAAAAAAAAAAAAAAAAAAAAAVAAAAA
   133   24 B A  E     +J  113   0C   8  740   48  AA AAAAAA AAAAAAAAAAAAAAA AAAAAAAAAAAA A AAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   134   25 B S  E     +J  112   0C  58  740   14  SS SSSSSS SSSSSSSPSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   135   26 B G  S    S+     0   0   56  739    3  GG GGGGGG GGGGGGGGGGGGGGG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   136   27 B F  S    S-     0   0   33  740   31  FF FFFFFF FFFFFFFFFFFFFFF FFFFFFFFFFFF F FFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   137   28 B T    >   -     0   0   93  740   53  TA ATTTTA TTTTTTTTTTTTTTT TTTTTTTTTTTT T TTTTTTTTTTTTTTTTSTTTPTSTTTTTT
   138   29 B F  G >  S+     0   0    2  740   28  FF FFFFFF FFFFFFFFFFFFFFF FFFFFFFFFFFF F FFFFFFFFFFFFFFFFFFFFFFFFLFFLF
   139   30 B S  G 3  S+     0   0   57  740   55  SS SSSSSS SSSSSSSSSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSNSSSSSS
   140   31 B S  G <  S+     0   0   71  740   57  SS SSSSSS SSSSSSSSSDSSSSS SNSSSSDDSSDS S TSDSNSSSSSSSDSRSDSSSSSNSHTSHD
   141   32 B Y  S <  S-     0   0   44  738   42  YY YYYYYY YYYYYYYYYYYYYYY YYYYYYYYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYCFFCY
   142   33 B T        -     0   0   30  739   92  TD DGTYAD GGTGGGGGGYGGGGG TGAGGAYYGGYG G TGYGAGAAGGGGYTVTAGAGAGDGGGGGY
   143   34 B M  E     -OP 160 207E   0  739   49  MM MMMMMM MMMMMMMMMMMMMMM MMMMMMMMMMMM M MMMMMMMMMMMMMMMMMMMMMMMMMMMMM
   144   35 B S  E     -OP 159 206E   0  740   72  SS SSSSSS SSSSSSSSSYSSSSS SSSSSSYYSSYS S SSYSSSSSSSSSYSSSSSSSSPSSSHHSY
   145   36 B W  E     +OP 158 205E   0  740    0  WW WWWWWW WWWWWWWWWWWWWWW WWWWWWWWWWWW W WWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   146   37 B V  E     -OP 156 204E   0  740   17  VV VVVVVV VVVVVVVVVVVVVVV IVVVVVVVVVVV V VVVVVVVVVVVVVVVVVVVVVVVVVVVVV
   147   38 B R  E     -OP 155 203E  10  740   21  RR RRRRRR RRRRRRRRRRRRRRR RRRRRRRRRRRR R RRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   148   39 B Q  E     -OP 154 202E   9  740    4  QQ QQQQQQ QQQQQQQQQQQQQQQ QQQQQQQQQQQQ Q QQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
   149   40 B T    >   -     0   0    9  739   74  TT TTTTTT TTTTTTTTTTTTTTT TTSTTSTTTTTT T TTTTTTTTTTTTTTTTTTSTTTTTTAATT
   150   41 B P  T 3  S+     0   0   80  740   11  PP PPPPPP PPPPPPPPPPPPPPP PPPPPPPPPPPP P PPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   151   42 B E  T 3  S-     0   0  151  740   29  EE EDEEEE DDEDDDDDDEDDDDD EDEDDEEEDDED D EDEDEDEEDDDDEEEEEDEDEDEDDEEDE
   152   43 B K    <   +     0   0  121  740   37  KK KKKKKK KKKKKKKKKKKKKKK KKKKKKKKKKKK K KKKKKKKKRKKKKKKKKKKKKKKKKKKKK
   153   44 B R        -     0   0  113  739   42  RR RRRRRR RRRRRRRRRRRRRRR RRRRRRRRRRRR R RRRRRRRRRRRRRRRRRRRRRRRRRGGRR
   154   45 B L  E     -O  148   0E   9  740   13  LL LLLLLL LLLLLLLLLLLLLLL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   155   46 B E  E     -O  147   0E  44  739    4  EE EEEEEE EEEEEEEEEEEEEEE EEEEEEEEEEEE E EEEEEEEXEEEEEEEEEEEEEEEEEEEEE
   156   47 B W  E     +O  146   0E  15  739   11  WW WWWLWW WWWWWWWWLWWWWWL WFWLWWWWWWWL W WLWWWWWXWLLWWWWWWLWLWWWLLWWLW
   157   48 B V  E     -     0   0E   0  739   28  VV VVVVVV VVVVVVVVVVVVVVV VVVVVVVVVVVV V VVVVVVVVVVVVVVVVVVVVVVVVVVVVV
   158   49 B A  E     -O  145   0E   0  740   36  AA AAAAAA AAAAAAAAAAAAAAA AAAAAAAAAAAA A AAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   159   50 B S  E     -OQ 144 168E   0  740   94  YY YTTASY TTTTTTTTTTTTTTT YNETTETTTTTT T TTTTTTTTTTTTTTTTTTETTTYTTYYTT
   160   51 B I  E     -OQ 143 167E   4  739   18  II IIIIII IIIIIIIIIIIIIII IIIIIIIIIIII I IIIIFIIIIIIIIIIIIIIIIIIIIIIII
   161   52 B N    >   -     0   0   47  740   85  SS SSSNSS SSSNSSSSNSSSSSN SNSNSSSSSSSN S SNSSSSSSSNNSSSSSSDSNISSNNSSYS
   162   53 B N  T 3  S+     0   0   65  740   86  NS SSSSSS SSSNSSSSSDSSSSS DGNSSNDDSSDS S SSDGSSSSGSSGDSSSSSSSSSTHHSSHD
   163   54 B G  T 3  S-     0   0   65  740   68  GG GGGNGG GGGGGGGGNGGGGGN GNGNGGGGGGGN G GNGGDGGGGNNGGGGGGYGNGGGKGGGGG
   164   55 B G  S <  S+     0   0   30  740   50  GG GGGGGG GGGGGGGGGGGGGGG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGGGGGGDGGSSGG
   165   56 B G  S    S+     0   0   74  739   59  GG GSGGSG SSSSSSSSGSSSSSG GGGGSGSSSSSG S SGSSSSSSSGGSSGSSSFSGVSGDGSSGS
   166   57 B R        +     0   0  163  548   85  SS SYNS.S YYYYYYYYSYYYYYS SKYSYYYYYYYS Y YSYYYYYYYSSYYNYYYTYSYYNSDTTGY
   167   58 B T  E     -Q  160   0E  62  724   48  TT TTTTTT TTTTTTTTTTTTTTT TTTTTTTTTTTT T TTTTTTTTTTTTTTTTTTTTTTTTTIITT
   168   59 B Y  E     +Q  159   0E  53  723   87  YY YYYYYY YYYYYYYYYYYYYYY YYYYYYYYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   169   60 B Y        -     0   0   44  737    7  YY YYYYYY YYYYYYYYYYYYYYY YYYYYYYYYYYY Y YYYYYYYYYYYYYYFYCYYYYYYYYYYYY
   170   61 B P    >>  -     0   0   20  737   66  PP PPPPPP PPPPPPPPPPPPPPP PPPPPPPPPPPP P SPPPPPPPPPPPPPPPPPPPPPPSPAAPP
   171   62 B D  T 34 S+     0   0  148  739   65  DD DDDDDD DDDDDDDDDDDDDDD DGDDDDDDDDDD D DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   172   63 B T  T 34 S+     0   0   90  739   62  TT TSSTST SSSSSSSSSSSSSSS TSTSSTSSSSSS S SSSSSSSSSSSSSSSSTSTSSSTSSTTSS
   173   64 B V  T X> S+     0   0    1  740   43  VV VVVVVV VVVVVVVVVVVVVVV LVMVVMVVVVVV V VVVVVVVVVVVVVVVVVMVVVVVVVVVVV
   174   65 B K  B 3< S+l  177   0C 142  739   35  KK KKKKKK KKKKKKKKKKKKKKK KKTKKTKKKKKK K KKKKKKKKKKKKKKKRKKTKKKKKKKKKK
   175   66 B G  T 34 S+     0   0   74  739   36  GG GGGGGG GGGGGGGGGGGGGGG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   176   67 B R  T <4 S+     0   0   36  739   21  RR RRRRRR RRRRRRRRRRRRRRR RRRRRRRRRRRR R RRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   177   68 B F  E  <  -lM 174 192C   2  740   67  FF FFFFFF FFFFFFFFFFFFFFF FFFFFFFFFFFF F FFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   178   69 B T  E     - M   0 191C  79  740   38  TT TTTTTT TTTTTTTTTTTTTTT TTTTTTTTTTTT T TTTTTTTTTTTTTTTTTTTTTTTTTTTTT
   179   70 B I  E     + M   0 190C   5  740   22  II IIIIII IIIIIIIIIIIIIII VIVIIVIIIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIII
   180   71 B S  E     - M   0 189C  51  736   45  SS SSSSSS SSSSSSSSSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   181   72 B R  E     - M   0 188C  30  739   68  RR RRRRRR RRRRRRRRRRRRRRR RRRRRRRRRRRR R RRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   182   73 B D  E > > - M   0 187C  60  738    5  DD DDDDDV DDDDDDDDDDDDDDD DDDDDDDDDDDD D DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   183   74 B N  G > 5S+     0   0   48  739   59  NN NNNNNN NNNNNNNNNNNNNNN NNNNNNNNNNNN N NNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   184   75 B A  G 3 5S+     0   0   99  739   41  AA AAAAAA AAAAAAAAAAAAAAA AAAAAAAAAAAA A AAAAAAAAAAAAAAAAAAAAAAAAAPPAA
   185   76 B K  G < 5S-     0   0  111  740   54  KK KKKKRK KKKKKKKKKKKKKKK KKKKKKKKKKKK K KRKKKKKKKKKKKKKKKRKKKKKKNKKNK
   186   77 B N  T < 5 +     0   0   62  740   46  NN NNNNNN NNNNNNNNNNNNNNN NNNNNNNNNNNN N NNNNNNNNNNNNNNNNNNNNNNNNNNNNN
   187   78 B T  E   < -KM 132 182C  16  740   68  NT TTNTIT TTTTTTTTTNTTTTT TTITTINNTTNT T TTNTTTTTTTTTNNTTTTTTITTTTTTTN
   188   79 B L  E     -KM 131 181C   0  737   61  LL LLLLLL LLLLLLLLLLLLLLL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   189   80 B Y  E     -KM 130 180C  41  737   41  YY YYYYYY YYYYYYYYYYYYYYY YYYYYYYYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYYFFYY
   190   81 B L  E     -KM 129 179C   0  739    8  LL LLLLLL LLLLLLLLLLLLLLL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   191   82 B Q  E     -KM 128 178C  76  739   41  QQ QQQQQQ QQQQQQQQQQQQQQQ QQEQQEQQQQQQ Q QQQQQQQQQQQQQQQQQQEQQQQQQQQQQ
   192   83 B M  E     +KM 127 177C   0  740   11  MM MMMMMM MMMMMMMMMMMMMMM MMMMMMMMMMMM M MMMMMMMMMMMMMMMMMMMMMMMMMMMMM
   193   84 B S        +     0   0   42  740   54  SS SSSSSS SSSSSSSSSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSNSSTTSS
   194   85 B S  S    S-     0   0   68  739   23  SS SSSSSS SSSSSSSSSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   195   86 B L        -     0   0    3  740   16  LL LLLLLL LLLLLLLLLLLLLLL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   196   87 B K    >   -     0   0  102  740   70  KK KKRKRK KKKKKKKKKKKKKKK KKRKKRKKKKKK K KKRKRKRRKKKKKRRKRKRKRKKKRRRRK
   197   88 B S  G >  S+     0   0   70  740   59  SS SSSSSS SSSSSSSSSSSSSSS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   198   89 B E  G 3  S+     0   0  126  740   21  EE EEEEEE EEEEEEEEEEEEEEE EEEEEEEEEEEE E EEEEEEEEEEEEEEEEDEEEEEEEEEEEE
   199   90 B D  G <   +     0   0    2  740    3  DD DDDDDD DDDDDDDDDDDDDDD DDDDDDDDDDDD D DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   200   91 B T    <   +     0   0   32  740   32  TT TTTTTT TTTTTTTTTTTTTTT TTTTTTTTTTTT T TTTTTTTTTTTTTTTTTTTTTTTTTTTTT
   201   92 B A  E    S- R   0 223E   8  737    4  AA AAAAAA AAAAAAAAAAAAAAA AAAAAAAAAAAA A AAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   202   93 B M  E     -PR 148 222E  58  739   46  MM MMLLMM MMMMMMMMMMMMMMM MMMMMMMMMMMM M MMMMMMMMMMMVMLMMMMMMMMMMTMMTM
   203   94 B Y  E     -PR 147 221E   0  739    1  YY YYYYYY YYYYYYYYYYYYYYY YYYYYYYYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   204   95 B Y  E     -P  146   0E   7  740    4  YY YYYYYY YYYYYYYYYYYYYYY YYYYYYYYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   205   96 B d  E     -P  145   0E   0  740    0  CC CCCCCC CCCCCCCCCCCCCCC CCCCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   206   97 B V  E     -PS 144 217E   0  740   24  AA AAAAAA AATAAAAAAAAAAAA AVVAAVAAAAAA A TAAAAAAAAAAAAAVTAAAAANAVAAATA
   207   98 B R  E     -PS 143 216E  21  739   39  Rr RRRRRr rRRRRRRrRRRsrrR IRrLrrRrrRrr R RRrrrrrrrrrrrrrrrrrrryrrrrrrr
   208   99 B H  E     + S   0 214E   6  629   94   y  H   r yH.QHH.yA.Hyyy. .VyLyy.vy.wy H ..wfyygyfydfyyffakyysyyysggsy
   209  100 B E  E  >  + S   0 213E  63  676   73   R  D   R GGDRED.GEVGDDG. .ADRDDDRD.GG G GDGTRGKGTDGTGEDGTPGYGDGGDEGDD
   210  101 B Y  T >4 S-     0   0   80  702   91   Y  Y   Y SYPFAG.STWSYYSD NFFYGFGGWHYN D GRYTGNVSTWNTNAGTDYNGYGSNYNNYY
   211  102 B Y  T 34 S-     0   0  140  709   44   Y  Y   Y SyRyMHHSVYGYYSY FdYWYYLYYSYY y NFYVKWrsVFFVhWsWAFYNWFSygYYgd
   212  103 B Y  T 34 S+     0   0   39  264   90   Y  Y   Y YyLy..EY.YYY.YY Yy.........G v ....G.yy....y.y...AS..YpyYFyd
   213  104 B A  E <<  -S  209   0E   0  447   85   A  A   A AYAD..AAYAWAAYP GYSYYSRA...G G YG.VAYYAV..VA.Y..GWWY.WYYAAYW
   214  105 B M  E     +S  208   0E   0  580   59   M  M   M MFLV.FMMFMFMMFF MDMFGMMMFYFF F GLFVMFFMV.FVMFFFMLFFF.FFFMMFF
   215  106 B D  E     +     0   0E  19  696   48   D  D   D DDDADDDDDDADDDA DDDDGDDDDYDA A IADDDDDDDAADDADADDAADAPDDDDDA
   216  107 B Y  E     -S  207   0E  99  702   57   Y  Y   Y YYYYYYYYYYYYYYY SFYVYYYYVYYY Y YYYYYVYYYYYYYSYYYYYYVYYYYYYYY
   217  108 B W  E     -S  206   0E  23  731    0   W  W   W WWWWWWWWWWWWWWW WWWWWWWWWWWW W WWWWWWW WWWWWWWWWWWWWWWWWWWWW
   218  109 B G        -     0   0    0  714   13   G  G   G GGGGGGGGGGGGGGG GGGGGGGGGGGG G GGGGGGG GGGGGGGGGGGGGGGGGGGGG
   219  110 B Q        -     0   0   91  701   38   Q  Q   Q QQQQQQQQQQQQQQQ QQQAQQQQAQQQ Q QQQQQAQ QQQQQQRQQQQQAQQQQQQQQ
   220  111 B G        -     0   0   16  687   10   G  G   G GGGGGGGGGGGGGGG GGGGGGGGGGGG G GGGDGGG DGGDGGGGGGGGGGGGGGGGG
   221  112 B T  E     -R  203   0E  21  675   26   T  T   T TTTTTTTTTTTTTTT TTTTTTTTTTTT T TTTTTTT TTTTTTTTTTTTTTTTTTTTT
   222  113 B T  E     -R  202   0E  72  661   75   S  S   S STTLSTSSTSLSSTL STSTTSSSTTTL L TLTTSTT TLLTSLTLSSLLTLLFTSSTL
   223  114 B V  E     -R  201   0E   0  654   18   V  V   V VLLVVLVVLVVVVLV VVVVLVVVVLLV V LVLLVVL LVVLVVLVVVVVVVVLLIVLV
   224  115 B T  E     -n  120   0D  36  643   13   T  T   T TTTTTTTTTTTTTTT TTTTTTTTTTTT T TTTTTTT TTTTTTTTTTTTTTTTTTTTT
   225  116 B V  E     +n  121   0D   6  626    6   V  V   V VVVVVVVVVVVVVVV VVVVVVVVVVVV V VVVVVVV VVVVVVVVVVVVVVVVVVVVV
   226  117 B S        -     0   0   36  616    5   S  S   S SSSSSSSSSSSSSSS SSSSSSSSSSSS S SSSSSSS SSSSSSSSSSSSSSSSSSSSS
   227  118 B S  S    S+     0   0   84  597   20   S  S   S SSSASSSSSSASSSA SSSSSSSSSSSA A SASSSSS SAASSASASSAASA SSSSSA
   228  119 B A  S    S+     0   0   70   97   58                            A                                           
   229  120 B W        -     0   0  123   87   40                            K                                           
   230  121 B R        +     0   0  207   62   76                            T                                           
   231  122 B H              0   0  156   56   69                            T                                           
   232  123 B P              0   0  155   28   53                            P                                           
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 A D              0   0  183  423   16   D               D          DD     DDDD             DD         DD DDD 
     2    2 A I        -     0   0   32  466   12   I               I          II     IIII             III        II III 
     3    3 A E        -     0   0  117  468   68   Q               Q          QQ     QQQQ             QQQ        QQ QQQ 
     4    4 A L  E     -A   25   0A  10  482    7   M               M          LM     MMMM             MMM        MMMMMM 
     5    5 A T  E     -A   24   0A  64  482    8   T               T          TT     TTTT             TTT        TTTTTT 
     6    6 A Q  E     -A   23   0A  13  482    0   Q               Q          QQ     QQQQ             QQQ        QQQQQQ 
     7    7 A T  E    S+A   22   0A  64  482   35   S               S          SS     SSSS             SSS        SSSSSS 
     8    8 A P        -     0   0   46  485    9   P               P          PP     PPPP             PPP        PPPPPP 
     9    9 A V  S    S+     0   0   96  489   67   A               A          SS     SSSS             SSS        SSSASS 
    10   10 A S  E     -d  104   0B  60  491   42   S               S          SS     SSSS             PSS        SSSSSS 
    11   11 A L  E     -d  105   0B  58  494   23   L               L          LL     LLLL             LLL        LLLLLL 
    12   12 A S  E     +d  106   0B  60  495   42   S               S          SS     SSSS             SSS        SSSSSS 
    13   13 A A  E     -d  107   0B   0  495   58   A               A          AA     AAAA             AAA        AAAAAA 
    14   14 A S    >   -     0   0   47  496   31   S               S          SS     SSSS             SSS        SSSSSS 
    15   15 A V  T 3  S+     0   0   76  496   66   L               L          VV     VVVV             MVV        VVVLVV 
    16   16 A G  T 3  S+     0   0   42  496    5   G               G          GG     GGGG             GGG        GGGGGG 
    17   17 A E    <   -     0   0   71  496   36   E               E          DD     DDDD             EDD        DDDEDD 
    18   18 A T        -     0   0   69  496   62   T               T          RR     RRRR             TRR        RRRTTR 
    19   19 A V  E     - B   0  75A  11  496   36   V               V          VV     VVVV             VVV        VVVVVV 
    20   20 A T  E     - B   0  74A  67  495   29   T               T          TT     TTTT             TTT        TTTTTT 
    21   21 A I  E     - B   0  73A   1  494   17   I               I          II     IIII             III        IIIIII 
    22   22 A T  E     -AB   7  72A  29  494   59   E               E          TT     TTTT             TTT        TTTETT 
    23   23 A b  E     -AB   6  71A   0  495    1   C               C          CC     CCCC             CCC        CCCCCC 
    24   24 A R  E     -AB   5  70A 110  495   47   L               R          RR     RRRR             LRR        RRRLRQ 
    25   25 A A  E     -A    4   0A  10  495   28   A               A          AA     AAAA             AAA        AAAAAA 
    26   26 A S  S    S+     0   0   66  495    4   S               S          SS     SSSS             SSS        SSSSSS 
    27   27 A E  S    S-     0   0  101  495   38   E               E          QE     QQQQ             QQQ        QQQEQQ 
    28   28 A N        +     0   0   83  495   45   D               D          GN     GTGG             KSG        SGSDGG 
    29   29 A I    >   -     0   0    5  496   32   I               I          IV     IIII             III        IIIIII 
    30   30 A Y  T 3   -     0   0  155  496   81   Y               Y          SN     SSSS             YSS        SSSYSS 
    31   31 A S  T 3  S+     0   0   53  471   64   D               N          SN     SSSS             GNS        SNSDSN 
    32   32 A Y    <   +     0   0   63  495   53   I               G          YY     YYYY             NYY        YYYIYN 
    33   33 A L  E     -E   90   0B   0  495    7   L               L          LL     LLLL             LLL        LLLLLL 
    34   34 A A  E     -E   89   0B   0  495   71   A               A          AH     AAAA             ASA        NANANA 
    35   35 A W  E     -EF  88  48B   1  496    0   W               W          WW     WWWW             WWW        WWWWWW 
    36   36 A Y  E     -EF  87  46B   0  496    8   Y               Y          YY     YYYY             YYY        YYYYFY 
    37   37 A Q  E     -EF  86  45B   7  496   27   Q               Q          QQ     QQQQ             QQQ        QQQQQQ 
    38   38 A Q  E     -E   85   0B  21  496    4   Q               Q          QQ     QQQQ             QQQ        QQQQQQ 
    39   39 A K    >   -     0   0   51  495    8   K               K          KK     KKKK             KKK        KKKKKK 
    40   40 A Q  T 3  S+     0   0  190  496   18   P               P          PP     PPPP             QPP        PPPPPP 
    41   41 A G  T 3  S+     0   0   86  496   10   G               G          GG     GGGG             EGA        GGGGGG 
    42   42 A K  S <  S-     0   0  126  495   54   K               K          KK     KKKK             GKK        KKKKKK 
    43   43 A S        -     0   0   21  495   56   S               S          AA     AVAA             SAA        AVASAA 
    44   44 A P        -     0   0    4  495   10   P               P          PP     PPPP             PPP        PPPPPP 
    45   45 A Q  E     -F   37   0B  74  495   32   Q               Q          KK     KKKK             NKK        KKKQKK 
    46   46 A F  E     +F   36   0B  25  495   41   L               L          LL     LLPP             LLL        LSLLLL 
    47   47 A L  E     +     0   0B   4  495    9   L               L          LL     LLLL             LLL        LLLLLL 
    48   48 A V  E     -FG  35  54B   0  496    5   I               I          II     IIII             III        IIIIII 
    49   49 A Y  E >> S+ G   0  53B  39  496   17   Y               Y          YY     YYYY             YYY        YYYYYY 
    50   50 A N  T 34 S-     0   0   52  496   91   D               N          KA     AAYY             DDY        AAADAK 
    51   51 A A  T 34 S+     0   0    3  496   44   A               A          AA     AAAA             AAA        AAAAAA 
    52   52 A K  T <4 S+     0   0  148  496   25   S               N          SS     SSSS             ASS        SSSSSS 
    53   53 A T  E  <  -G   49   0B  47  496   68   S               S          ST     SSNN             STS        STSSST 
    54   54 A L  E     -G   48   0B  60  496   59   L               L          LL     LLLL             LLL        LLLLLL 
    55   55 A G    >   -     0   0    9  495   70   H               H          QQ     QEEE             AQQ        QQQHEQ 
    56   56 A E  T 3  S+     0   0  192  495   35   T               T          SS     SSSS             DSS        SSSTSS 
    57   57 A G  T 3  S+     0   0   70  496    5   G               G          GG     GGGG             GGG        GGGGGG 
    58   58 A V    <   -     0   0   25  494   10   V               V          VV     VVVV             VVV        VVVVVV 
    59   59 A P    >   -     0   0   47  495    7   P               P          PP     PPPP             PPP        PPPPPP 
    60   60 A S  T 3  S+     0   0  115  496   56   S               S          SS     SSSS             SSS        SSSSSS 
    61   61 A R  T 3  S+     0   0   44  496    4   R               R          RR     RRRR             RRR        RRRRRR 
    62   62 A F  E <   +C   75   0A   5  496    1   F               F          FF     FFFF             FFF        FFFFFF 
    63   63 A S  E     -C   74   0A  55  495   23   S               S          SS     SSSS             SSS        SSSSSS 
    64   64 A G  E     +C   73   0A  13  496    2   G               G          GG     GGGG             GGG        GGGGGG 
    65   65 A S  E     +C   72   0A  63  496    6   S               S          SS     SSSS             SSS        SSSSSS 
    66   66 A G  E     -C   71   0A  36  496   14   G               G          GG     GGGG             GGG        GGGGGG 
    67   67 A S  E >   +C   70   0A  79  496    9   S               S          SS     SSSS             SSS        SSSSSS 
    68   68 A G  T 3  S-     0   0   16  496   12   G               G          GG     GGGG             CGG        GGGGGG 
    69   69 A T  T 3  S+     0   0   67  495   13   T               T          TT     TTTT             TTT        TTTTTT 
    70   70 A Q  E <   +BC  24  67A 110  496   29   Q               Q          ED     DEEE             KDE        DDDQED 
    71   71 A F  E     -BC  23  66A   2  494    5   Y               Y          FF     FFFF             FFF        FFFYFF 
    72   72 A S  E     -BC  22  65A  26  495   30   S               S          TT     TTTT             STT        TTTSTT 
    73   73 A L  E     -BC  21  64A   0  496    2   L               L          LL     LLLL             LLL        LLLLLL 
    74   74 A K  E     -BC  20  63A  97  496   38   K               K          TT     TTTT             KTT        TTTKTT 
    75   75 A I  E     -BC  19  62A   0  496    1   I               I          II     IIII             III        IIIIII 
    76   76 A N  S    S-     0   0   86  496   29   N               N          SS     SSSS             SSS        SSSNSS 
    77   77 A S  S    S-     0   0   58  496   62   S               S          SS     SSSS             SSS        SSSSSS 
    78   78 A L        -     0   0    0  496   27   L               L          LL     LLLL             LLL        LLLLLL 
    79   79 A L    >   -     0   0   67  496   31   Q               Q          QQ     QQQQ             QQQ        QQQQQQ 
    80   80 A P  G >  S+     0   0   92  496   59   P               S          PP     PPPP             PPP        PPPPPP 
    81   81 A E  G 3  S+     0   0  102  496   15   E               E          EE     EEEE             EEE        EEEEEE 
    82   82 A D  G <  S+     0   0    1  496    5   D               D          DD     DDDD             DDD        DDDDDD 
    83   83 A F    <   +     0   0   29  495   73   F               V          FV     FFFF             AFF        FVFFFF 
    84   84 A G  E    S- H   0 105B  17  496   23   A               A          AA     AAAA             AAA        AAAAAA 
    85   85 A S  E     -EH  38 104B  24  496   62   S               S          VT     TTTT             ITT        TTTSTT 
    86   86 A Y  E     -EH  37 103B   0  496    0   Y               Y          YY     YYYY             YYY        YYYYYY 
    87   87 A Y  E     -E   36   0B   5  495    4   Y               F          YY     YYYY             YYY        YYYYYY 
    88   88 A b  E     -E   35   0B   0  496    0   C               C          CC     CCCC             CCC        CCCCCC 
    89   89 A Q  E     -EI  34  99B   0  494   48   Q               Q          QQ     QQQQ             QQQ        QQQQLQ 
    90   90 A H  E     -E   33   0B  22  486   28   N               Q          QH     QQQQ              RQ        QKQNQH 
    91   91 A H        +     0   0    0  423   89                   Y           S      H                G         S.SG G 
    92   92 A Y  S    S+     0   0  104  454   87                   Y           Y                       Y         YYYL Y 
    93   93 A G  S    S-     0   0   34  421   71                   D           G                       G         .N.S   
    94   94 A T  S    S-     0   0  104  444   88                               T                       T         .SSA   
    95   95 A P  S    S+     0   0    7  441   51                               P                                 SATP   
    96   96 A P  S    S-     0   0   55  420   76                               P                                 TPPR   
    97   97 A L        -     0   0   21  151   88                                                                 LRVT   
    98   98 A T        -     0   0   40  278   41                                                                 TTTC   
    99   99 A F  B     -I   89   0B  18  277   26                                                                 FFFF   
   100  100 A G        -     0   0    3  285   38                                                                 GGGG   
   101  101 A G        -     0   0   52  300   63                                                                 GPQW   
   102  102 A G        -     0   0   11  300   41                                                                 GGGP   
   103  103 A T  E     - H   0  86B   0  360   19                                                                 TTTL   
   104  104 A K  E     -dH  10  85B  98  359   60                                                                 KKRA   
   105  105 A L  E     -dH  11  84B   4  343   39                                                                 VLLI   
   106  106 A E  E     -d   12   0B 108  326   52                                                                 EEEE   
   107  107 A I  E      d   13   0B 113  295   51                                                                 IIII   
   108  108 A K              0   0  145  261   18                                                                 KKK    
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30       E  D   QE           EEE     EE        E  EE EEE   EE            E
   111    2 B V        +     0   0   19  428   12       V  V  VVV        VVVVVV   VVVV       VVVVVVVVVE   VV    VV      E
   112    3 B K  E     -J  134   0C 111  430   32       M  Q  QQQ        QQQQQQ   QQQQ       QQQQQQQQQQ   KK    QQ      Q
   113    4 B L  E     -J  133   0C   3  452    1       L  L  LLV        LLLLLL   LLLL       LLLLLLLLLL   LL    LL      L
   114    5 B Q  E     -J  132   0C  83  454   70       V  V  VQV        VVVLLL   VVVV       VVVVVVVVLV   VL    VV      V
   115    6 B E  E     +J  131   0C   5  458   22       E  E  EQE        EEEEEE   EEEE       EEEEEEEEEE   EE    EE      E
   116    7 B S  E     +J  130   0C  69  463   14       S  S  SSS        SSSSSS   SSSS       SSSSSSSSSS   SS    SS      S
   117    8 B G        +     0   0   36  467    4       G  G  GGD        GGGGGG   GGGG       GGGGGGGGGG   GG    GG      G
   118    9 B G        +     0   0   29  718   50  G GGGG GGGGGGGGGG GGGGGGGGGG  GGGGG    GGGGGGGGGGGGG   GGGGGGGG      G
   119   10 B D        -     0   0   96  725   42  G GGDG GGDGGDGGGD GGGSGGGGGG  GGGGG    GGGGGGGGGGGGG   DGGGGGGG      G
   120   11 B L  E     +n  224   0D  79  727   14  L LLLL LLLLLLLLLL LLLLLLLLLL  LLVVL    LLLVLVVVLVVLL   LLLLLLLL      L
   121   12 B V  E     -n  225   0D  16  729   31  V VVVV VVVVVVVVVV VVVVIVVVVV  VVVVV    VVVVVVVVVVVVV   VVVVVVVV      V
   122   13 B Q    >   -     0   0  114  730   53  Q KKKK QQKQQKQQQK QQQQQQQQQQ  QQQRQ    QQQQQQQQQQQQQ   KQQQQQQQ      L
   123   14 B P  T 3  S+     0   0   66  730    7  P PPPP PPPPPPPRPP PPPPPPPPPP  PPPPP    PPPPPPPPPPPPP   PPPPPPPP      P
   124   15 B G  T 3  S+     0   0   58  734   31  G GGGG GGGGGGGGGG GGGGGGGGGG  GGGGG    GGGGGGGGGGGGG   GGKGKGGG      G
   125   16 B G    <   -     0   0   25  736   63  G GGGG GGGGGGRGGG GGGGGGGGGG  GGGGR    GEGRGRRGGRRGG   GGGGGGGG      G
   126   17 B S        +     0   0   78  735   29  S SSSS SSSSSSSSSS SSSSSSSSSS  SSSSS    SSSSSSSSSSSSS   SSSSSSSS      S
   127   18 B L  E     - K   0 192C  25  737   28  L LLLL RRLRLLLRRL RRRRLLLLLL  RLLLL    RLRLLLLLLLLLL   LLLRLRLL      L
   128   19 B K  E     - K   0 191C  93  735   55  K KKKKKKKKKRKKKKK KKKKRRRRRR  KRRRK    KKKRRRRRRRRRR   RKKKKKRR      R
   129   20 B L  E     - K   0 190C   0  740   16  L LLLLLLLLLLVLLLL LLLLLLLLLL  LLLIL    LLLLLLLLLLLLL   LLLILLLL      L
   130   21 B S  E     -JK 116 189C  28  740   37  S SSSSSSSSSSSPSSS SSSSSSSSSS  SSSSS    SSSSSSSSSSSSS   SSSSSSSS      S
   131   22 B d  E     -JK 115 188C   0  740    0  C CCCCCCCCCCCCCCC CCCCCCCCCC  CCCCC    CCCCCCCCCCCCC   CCCCCCCC      C
   132   23 B A  E     -JK 114 187C  52  740   67  A AAATAAAAAVAAAAS AAAAAAAAAA  AAAAA    AEAAAAVAAAAAA   VAAAAAAA      A
   133   24 B A  E     +J  113   0C   8  740   48  A AAAAAAAAAAAAAAA AAAAAAAAAA  AAAAA    ASAAAAAAAAAAA   AAAAAAAA      A
   134   25 B S  E     +J  112   0C  58  740   14  S SSSSSSSSSSSSSSS SSSSSSSSSS  SSSSS    SNSSSSFSSSSSS   SSSSSSSS      S
   135   26 B G  S    S+     0   0   56  739    3  G GGGGGGGGGGGGGGG GGGGGGGGGG  GGGGG    GEGGGGGGGGGGG   GGGGGGGG      G
   136   27 B F  S    S-     0   0   33  740   31  F FFFFFFFFFFFFFFF FFFFFFFFFF  FFFFF    FYFFFFFFFFFFF   FFFIFFFF      F
   137   28 B T    >   -     0   0   93  740   53  T TTTIATTITTTTTTT TTTTTTTTTT  TTTTT    TETTTTTTTTTTT   TDTTTTTT      T
   138   29 B F  G >  S+     0   0    2  740   28  L FFFFFFFFFFFFFFF FFFFVFFFFF  FFFFF    FFFFFFFFFFFFF   FFFFFFFF      F
   139   30 B S  G 3  S+     0   0   57  740   55  S SSSNSSSNSSSSSSN SSSSSSSSSS  SSSDS    SPSSSSSSSSSSS   SSNSNSSS      S
   140   31 B S  G <  S+     0   0   71  740   57  H DDRRSSSRSSSDTSS SSSSSSSSST  GSSDD    SSSSSSSSSSNSS   SRTGTTDS      S
   141   32 B Y  S <  S-     0   0   44  738   42  C FYSCYFFYFYYYFFY FFFFNYYYYY  FYYYY    FHSYYYYYYYYFY   NYYFYFHY      Y
   142   33 B T        -     0   0   30  739   92  G YYGADGGGGWGYGGG GGGGYWWAAA  GEWGY    GDGGWGWGSAGSS   GWAGAGYW      D
   143   34 B M  E     -OP 160 207E   0  739   49  M MMMMMMMMMMMMMMM MMMMMMMMMM  MMMMM    MMIMMMMMMMMMM   MMMMMMMM      M
   144   35 B S  E     -OP 159 206E   0  740   72  S YYSSSHHSHSSAHHS HHHHSSSSSS  HSSSA    HSHHSHSHNHHSD   SSNHNHDS      N
   145   36 B W  E     +OP 158 205E   0  740    0  W WWWWWWWWWWWWWWW WWWWWWWWWW  WWWWW    WWWWWWWWWWWWW   WWWWWWWW      W
   146   37 B V  E     -OP 156 204E   0  740   17  V VVVVVVVVVVVVVVI VVVVVVVVVV  VVVVV    VVVVVVVVVVVVV   VVVVVVVV      V
   147   38 B R  E     -OP 155 203E  10  740   21  R RRRRRRRRRRRRRRR RRRRRRRRRR  RRRRR    RRRRRRRRRRRRR   RRRRRRRR      R
   148   39 B Q  E     -OP 154 202E   9  740    4  Q QQQQQQQQQQQQQQQ QQQQQQQQQQ  QQQQQ    QKQQQQQQQQQQQ   QQQQQQQQ      Q
   149   40 B T    >   -     0   0    9  739   74  T TTTTTAATAATAGAT AAAAAAAAAA  AAAAA    ATAAAAAAAAAAA   DAAAAGAA      A
   150   41 B P  T 3  S+     0   0   80  740   11  P PPPPPPPPPPPPPPP PPPPPPPPPP  PPPPP    PPPPPPPPPPPPP   PPPPPPPP      P
   151   42 B E  T 3  S-     0   0  151  740   29  D EEDEEEEDEGDTEED EEEEGGGGGG  EGGGT    EEEGGGGGGGGGG   GGGEGEGG      G
   152   43 B K    <   +     0   0  121  740   37  K KKKKKKKKKKKKKKM KKKKKKKKKK  KKKKK    KKKKKKKKKKKKK   EKKKKKKK      K
   153   44 B R        -     0   0  113  739   42  R RRKRRGGKGGRGGGR GGGGGGGGGG  GGGGG    GRGGGGGGGGGGG   GGGGGGGG      G
   154   45 B L  E     -O  148   0E   9  740   13  L LLLLLLLLLLLLLLL LLLLLLLLLL  LLLLL    LLLLLLLLLLLLL   LLLLLLLL      L
   155   46 B E  E     -O  147   0E  44  739    4  E EEEEEEEEEEEEEEE EEEEEEEEEE  EEEEE    EEEEEEEEEEEEE   QEEEEKEE      E
   156   47 B W  E     +O  146   0E  15  739   11  L WWWWWWWWWWWWWWW WWWWWWWWWW  WWWWW    WLWWWWWWWWWWW   WWWWWWWW      W
   157   48 B V  E     -     0   0E   0  739   28  V VVVVVVVVVVVVVVV VVVVVVVVVV  VVVVV    VVVVVVVVVVVVV   VIVVVVVV      V
   158   49 B A  E     -O  145   0E   0  740   36  A AAAAAAAAAAAAAAA AAAASAASSS  AAASA    AAAAAAAASAASA   AGAAAAAA      A
   159   50 B S  E     -OQ 144 168E   0  740   94  T TTTTTYYTYNTSYYT YYYYVNNAAA  YNNGS    YAYVNVNFYVISY   DERYRYVN      S
   160   51 B I  E     -OQ 143 167E   4  739   18  I IIIIIIIIIIIIIII IIIIIIIIII  IIIII    IIIIIIIIIIIII   IIIIIIII      I
   161   52 B N    >   -     0   0   47  740   85  Y SSSSSSSSSKTSSSS SSSSYKKSSS  SKKNS    SNSSKSKRSSWSS   SNRNRSSK      S
   162   53 B N  T 3  S+     0   0   65  740   86  H DDSSSSSSSQSYSSS SSSSSQQGGG  SQQWY    SSSYQYQYSYYGS   SPSSSSYQ      S
   163   54 B G  T 3  S-     0   0   65  740   68  G GGGGGGGGGDGDGGG GGGGGDDSSS  GDDND    GDGDDDDDTDDSA   SDKDKGDD      G
   164   55 B G  S <  S+     0   0   30  740   50  G GGGGGSSGSGGGSSG SSSSGGGGGG  SGGGG    SGSGGGGGIGGSS   GSSSSGGG      S
   165   56 B G  S    S+     0   0   74  739   59  G SSSTSSSSSSSSSGG SSSSSSSGGG  NSSGG    SGSSSSSSISNGS   QSnTnGSS      S
   166   57 B R        +     0   0  163  548   85  G YYYYYTTYTEYSTTF TTTT.EGSSS  IEESS    TSMNENENTND.T   .TaTaINE      Y
   167   58 B T  E     -Q  160   0E  62  724   48  T TTTTTILTIKTTIIT IIIITKKTTT  IKKTT    ITIKRKKKIKEtI   TITITIKK      I
   168   59 B Y  E     +Q  159   0E  53  723   87  Y SYYYYYHYYYYYYYH YYYYYYYYYY  YYYGY    YYLYYYYYYYYyY   YNYYYKYY      Y
   169   60 B Y        -     0   0   44  737    7  Y YYYYYYYYYYYYYYY YYYYYYYYYY  YYYYY    YYYYYYYYYYYYY   YYYYYYYY      Y
   170   61 B P    >>  -     0   0   20  737   66  P PPPPPAAQAVPRAAP AAAAAVVAAA  AVVAR    APAAVAVAAAAAA   ATAAAVAV      G
   171   62 B D  T 34 S+     0   0  148  739   65  D DDDDDDDDDDDDEDD DDDDDDDDDD  DDDDD    DDDDDDDDDDDDN   DPDDDDDD      D
   172   63 B T  T 34 S+     0   0   90  739   62  S SSTSSTTTTSSSTTS TTTTSSSSSS  ASSSS    TTTSSSSSSSSSS   ASSTSTSS      A
   173   64 B V  T X> S+     0   0    1  740   43  V VVVVVVVVVVVVVVV VVVVVVVVVV  VVVVV    VMVVVVVVVVVVV   VLVVVVVV      V
   174   65 B K  B 3< S+l  177   0C 142  739   35  K KKKKKKKKKKKKKKK KKKKKKKKKK  KKKKK    KEKKRKKKKKKKK   KKKKKKKK      K
   175   66 B G  T 34 S+     0   0   74  739   36  G GGGGGGGGGGGGGGG GGGGGGGGGG  GGGGG    GRGGGGGGGGGGG   GDDGDGGG      G
   176   67 B R  T <4 S+     0   0   36  739   21  R RRRRRRRRRRRRRRR RRRRRRRRRR  RRRRR    RRRRRRRRRRRRR   RKRRRRRR      R
   177   68 B F  E  <  -lM 174 192C   2  740   67  F FFFFFFFFFFFFFFF FFFFFFFFFF  FFFFF    FFFFFFFFFFFFF   FFFFFFFF      F
   178   69 B T  E     - M   0 191C  79  740   38  T TTTTTTTITTTTTTT TTTTTTTTTT  TTTTT    TITTTTTTTTTTT   SITTTATT      T
   179   70 B I  E     + M   0 190C   5  740   22  I IIIIIIIIIIIIIIV IIIIIIIIII  MIIII    IIVIIIIIIIIII   IIIIIIII      I
   180   71 B S  E     - M   0 189C  51  736   45  S SSSSSSSSSSSSSSS SSSSSSSSSS  SSSSS    SSSSSSSSSSSSS   SSSSSSSS      S
   181   72 B R  E     - M   0 188C  30  739   68  R RRRRRRRRRRRRRRR RRRRRRRRRR  RRRRR    RRRRRRRRRRRRR   RRRRRRRR      R
   182   73 B D  E > > - M   0 187C  60  738    5  D DDDDDDDDDDDDDDD DDDDDDDDDD  DDDDD    DDDDDDDDDDDDD   DDDDDDDD      D
   183   74 B N  G > 5S+     0   0   48  739   59  N NNNNNNNNNNNNNNN NNNNNNNNNN  NNNNN    NNNNNNNNNNNNN   NNDNDDNN      N
   184   75 B A  G 3 5S+     0   0   99  739   41  A AAAAAPPAPAAAPPA PPPPSAASSS  PAAAA    PTPSASASASSSA   AASPSPSA      T
   185   76 B K  G < 5S-     0   0  111  740   54  N KKKKRKKKKKKKKKG KKKKKKKKKK  KKKKK    KKKKKKKKKKKKK   KKQEQKKK      K
   186   77 B N  T < 5 +     0   0   62  740   46  N NNNNNNNNNNNSNNS NNNNNNNNNN  NNNNS    NKNNNNNNNNNNN   NNSNSNNN      N
   187   78 B T  E   < -KM 132 182C  16  740   68  T NNTTTTTTTSTTTTT TTTTTSSTTT  TSSSS    TTTTSTSTSTTTM   TTMTMTTS      T
   188   79 B L  E     -KM 131 181C   0  737   61  L LLLLLLLLLLLLLLL LLLLLLLLLL  LLLLL    LLLLLLLLLLLLL   LLLLLLLL      L
   189   80 B Y  E     -KM 130 180C  41  737   41  Y YYYYYFFYFYYYFFF FFFFYYYYYY  FYYYY    FYFYYYYYYYYYY   YYYFYFYY      Y
   190   81 B L  E     -KM 129 179C   0  739    8  L LLLLLLLLLLLLLLL LLLLLLLLLL  LLLLL    LLPLLLLLLLLLL   LLLLLLLL      L
   191   82 B Q  E     -KM 128 178C  76  739   41  Q LQQQQQQQQQQQQQQ QQQQQQQQQQ  QQQQQ    QQQQQQQQQQQQQ   QQQQQQQQ      Q
   192   83 B M  E     +KM 127 177C   0  740   11  M MMMMMMMMMMMMMMM MMMMMMMMMM  MMMMM    MMMMMMMMMMMMM   MMMMMMMM      M
   193   84 B S        +     0   0   42  740   54  S SSNSSTTSTNSDTTS TTTTNNNNNN  TNNND    TSTNNNNNNNNNS   ESNTNTNN      S
   194   85 B S  S    S-     0   0   68  739   23  S SSSSSSSSSSSSSSS SSSSSSSSSS  SSSSS    SSSSSSSSSSSSS   DKNSNSSS      S
   195   86 B L        -     0   0    3  740   16  L LLLLLLLLLLLLILL LLLLLLLLLL  LLLLL    LLLLLLLLLLLLL   LVLLLLLL      L
   196   87 B K    >   -     0   0  102  740   70  R KKKRRRRKRRKRRRK RRRRRRRRRR  RRRRR    RRRRRRRRRRRRR   RRKRKRRR      R
   197   88 B S  G >  S+     0   0   70  740   59  S SSTSSSSSSASSSSS SSSSAAAAAA  SAAAS    SSSAAAAAAAAAA   VSTSTSAA      T
   198   89 B E  G 3  S+     0   0  126  740   21  E EEEAEEEEEEEEEEE EEEEEEEEEE  EEEEE    EEEEEEEEEEEEE   EEEEEEEE      E
   199   90 B D  G <   +     0   0    2  740    3  D DDDDDDDDDDDDDDD DDDDDDDDDD  DDDDD    DDDDDDDDDDDDD   DDDDDDDD      D
   200   91 B T    <   +     0   0   32  740   32  T TTTTTTTTTTTTTTT TTTTTTTTTT  TTTTT    TTTTTTTTTTTTT   TTTTTTTT      T
   201   92 B A  E    S- R   0 223E   8  737    4  A AAAAAAAAAAAAAAA AAAAAAAAAA  AAAAA    AAAAAAAAAAAAA   AAAAAAAA      A
   202   93 B M  E     -PR 148 222E  58  739   46  T MMMMLMMMMVMTMMM MMMMVVVVVV  IVVVT    MLIVVVVVVMVVV   VLMMMIVV      V
   203   94 B Y  E     -PR 147 221E   0  739    1  Y YYYYYYYYYYYYYYY YYHYYYYYYY  YYYYY    YYYYYYYYYYYYY   YYYYYYYY      Y
   204   95 B Y  E     -P  146   0E   7  740    4  Y YYYYYYYYYYYYFYY YYYYYYYYYY  YYYYY    YYYYYYYYYYYYY   YYYYYYYY      Y
   205   96 B d  E     -P  145   0E   0  740    0  C CCCCCCCCCCCCCCC CCCCCCCCCC  CCCCC    CCCCCCCCCCCCC   CCCCCCCC      C
   206   97 B V  E     -PS 144 217E   0  740   24  A AATVAAAAAAAGAAG AAAAAAAAAA  AAAAT    AAAAASAAAAAAA   AAVAVAAA      A
   207   98 B R  E     -PS 143 216E  21  739   39  r rrrrrrrrRRrRrrr rrrrRrrKkk  rtrRT    rrrrrPrKRGrKR   TRrrRrkr      r
   208   99 B H  E     + S   0 214E   6  629   94  s yyldryyt..dHgyy yyyyGss.li  mts.D    yrdsyLy...w..   ELyi.gyv      r
   209  100 B E  E  >  + S   0 213E  63  676   73  D GQIGDGPT.EGSEGG GGDGSGG.PS  IGGRT    PGNGNGN.GGV..   GGGTGSGV      G
   210  101 B Y  T >4 S-     0   0   80  702   91  Y DATGANYDITASNNT NNANVYYPSY  TGYRS    AYHWSTW.DGYP.   DYYTDHDR      S
   211  102 B Y  T 34 S-     0   0  140  709   44  g FWtDMqYWWYFYYYr YYYYWYYFYy  YFYYF    WYYYSTn.sGyF.   IYWHGWYH      L
   212  103 B Y  T 34 S+     0   0   39  264   90  y ..wE.y...L..Y.f ..W.SPPP.y  ..P..    .Y...Ve.eLyPD   EG......      .
   213  104 B A  E <<  -S  209   0E   0  447   85  F ..YG.AAYDS..GGY GGYGGTTYYG  A.TAI    .AALPTADAGGYT   IYA.AYV.      .
   214  105 B M  E     +S  208   0E   0  580   59  F .FFF.MMFVF.FMVF VFFFLFFFMM  M.FLY    FMLWWDPLFLMFA   PFMFMFFF      .
   215  106 B D  E     +     0   0E  19  696   48  D DADADDDDGDDDDAD AADADDDDDD  DDDDM    ADDDDDDNDGDDS   RDDDDDDD      R
   216  107 B Y  E     -S  207   0E  99  702   57  Y YYVYYYYVYYYYYYY YYVYYYYYVV  YYYYL    YYYYYYYYIYVYY   YVYYYLYY      T
   217  108 B W  E     -S  206   0E  23  731    0  W WWWWWWWWWWWWWWW WWWWWWWWWW  WWWWW    WWWWWWWWWWWWW   FWWWWWWW      W
   218  109 B G        -     0   0    0  714   13  G GGGGGGGGGGGGGGG GGGGGGGGGG  GGGGS    GGGGGGGGGGGGG   GGGGGGGG      C
   219  110 B Q        -     0   0   91  701   38  Q QQAQQQQAQQQQQQQ QQAQQQQQQQ  QQQQ     QQQQQQQQQQQQQ   QAQQQAQQ      Q
   220  111 B G        -     0   0   16  687   10  G GGGGGGGGGGGGGGG GGGGGGGGGG  GGGG     GGGGGGGGGGGG    GGGGGGGG      G
   221  112 B T  E     -R  203   0E  21  675   26  T TTTTTTTTTTTVTTT TTTTTTTTTT  TTTT     TTTTTTTTTTTT    TTTTTTTT      T
   222  113 B T  E     -R  202   0E  72  661   75  T TLTVSSSTTLTMSLN LLTLLLLLLT  SLLL     LSSLLLLLMLTL    ITSTSTLL       
   223  114 B V  E     -R  201   0E   0  654   18  L LVVVVVVVLVLVVVL VVVVVVVVVV  VVVV     VVVVVVVVVVVV    VVVLVVVV       
   224  115 B T  E     -n  120   0D  36  643   13  T TTTTTTTTTTTTTTT TTTTTTTTST  ITT      TTATTTTTTTTT    TTTTTTTT       
   225  116 B V  E     +n  121   0D   6  626    6  V VVVVVVVVVVVVVVV VVVVVVVVVV  VVV      VVVVVVVVVVVV    VVVVVVV        
   226  117 B S        -     0   0   36  616    5  S SSSSSSSSSSSSSSS SSSSSSSSSS  SSS      SSSSSSSSSSSS    SSSSSSS        
   227  118 B S  S    S+     0   0   84  597   20  S SASASSSSSSSSSAS AASASSSSSS  SSS      ASSSSSSS S S    SSSSSSS        
   228  119 B A  S    S+     0   0   70   97   58       A      G            G G                      G                   
   229  120 B W        -     0   0  123   87   40              G            D S                      D                   
   230  121 B R        +     0   0  207   62   76              G            G                        G                   
   231  122 B H              0   0  156   56   69              G            S                        S                   
   232  123 B P              0   0  155   28   53              S            S                        S                   
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 A D              0   0  183  423   16  DD      D       DED   D DN         D   DDDD   DDDDDD        DED D  DD 
     2    2 A I        -     0   0   32  466   12  II      I       ILI   IIIII        I   IIII   IIIIII        ILI I  II 
     3    3 A E        -     0   0  117  468   68  QQ      Q       QQQ   QQQQQ        Q   QQQQ   QQQQQQ        QQQ Q  QQ 
     4    4 A L  E     -A   25   0A  10  482    7  MM      M       MMM   MMMMM        M   MMMM   LMMMMM        MMM M  MM 
     5    5 A T  E     -A   24   0A  64  482    8  TT      T       TTT   TTTTT        T   TTTT   TTTTTT        TTT T  TT 
     6    6 A Q  E     -A   23   0A  13  482    0  QQ      Q       QQQ   QQQQQ        Q   QQQQ   QQQQQQ        QQQ Q  QQ 
     7    7 A T  E    S+A   22   0A  64  482   35  SS      S       SSS   SSSSS        S   SSSS   SSSSSS        SSS S  SS 
     8    8 A P        -     0   0   46  485    9  PP      P       PPP   PPPPP        P   PPPP   PPPPPP        PPP P  PP 
     9    9 A V  S    S+     0   0   96  489   67  SS      S       SSS   SSSSS        S   SSSS   TSSSSS        SSS S  SS 
    10   10 A S  E     -d  104   0B  60  491   42  SS      S       SSS   SSSSS        S   SSSS   SSSSSS        TSF S  SS 
    11   11 A L  E     -d  105   0B  58  494   23  LL      L       LLL   LLLLL        L   LLLL   LLLLHL        LLL L  LL 
    12   12 A S  E     +d  106   0B  60  495   42  SS      S       SSP   SSSSS        S   SSSS   SSSSSS        SPS S  SS 
    13   13 A A  E     -d  107   0B   0  495   58  AA      A       AAA   AAAAA        A   AAAA   AAAAAA        AAA A  AA 
    14   14 A S    >   -     0   0   47  496   31  SS      S       SSS   SSSSS        S   SSSS   SSSSSS        SSS S  SS 
    15   15 A V  T 3  S+     0   0   76  496   66  VV      V       VVV   VVVVV        V   VVVV   VVVVVV        VVV V  VV 
    16   16 A G  T 3  S+     0   0   42  496    5  GG      G       GGG   GGGGG        G   GGGG   GGGGGG        GGG G  GG 
    17   17 A E    <   -     0   0   71  496   36  DD      D       DDD   DDDDD        D   DDDD   DDDDDD        DDD D  DD 
    18   18 A T        -     0   0   69  496   62  RR      R       RRR   RTRTT        R   RRKR   RRRRVR        RRR R  RR 
    19   19 A V  E     - B   0  75A  11  496   36  VV      V       VVV   VVVVV        V   VVVV   VVVVVV        VVV V  VV 
    20   20 A T  E     - B   0  74A  67  495   29  TT      T       TTT   TTTTT        T   TTTT   TTTTTT        TTT T  TT 
    21   21 A I  E     - B   0  73A   1  494   17  II      I       III   IIIII        I   IIII   IIIIII        III I  II 
    22   22 A T  E     -AB   7  72A  29  494   59  TT      T       TTT   TTTTT        T   TTTT   TTTTNT        TTT T  TT 
    23   23 A b  E     -AB   6  71A   0  495    1  CC      C       CCC   CCCCC        C   CCCC   CCCCCC        CCC C  CC 
    24   24 A R  E     -AB   5  70A 110  495   47  RR      R       RRR   RRRKR        R   RRRQ   QQRRKW        RRR R  RQ 
    25   25 A A  E     -A    4   0A  10  495   28  AA      A       AAA   AAAAA        A   AAAA   AAAAAA        AAA A  AA 
    26   26 A S  S    S+     0   0   66  495    4  SS      S       RSS   SSSSS        S   SSSS   SSSSSS        SSS S  SS 
    27   27 A E  S    S-     0   0  101  495   38  QQ      Q       QQQ   EQQQQ        Q   QQQQ   QQQQHQ        QQQ Q  QQ 
    28   28 A N        +     0   0   83  495   45  SS      S       GST   NSGGG        S   GGGG   GGGGNG        STG G  GG 
    29   29 A I    >   -     0   0    5  496   32  VI      I       III   VIIII        I   IIII   IIIIII        III I  II 
    30   30 A Y  T 3   -     0   0  155  496   81  SS      S       SSN   NGSSR        S   SSSS   STSSGS        SNS R  ST 
    31   31 A S  T 3  S+     0   0   53  471   64  NS      S       SSN   NSNNN        S   NDNS   NNNNSN        SSS N  TN 
    32   32 A Y    <   +     0   0   63  495   53  YW      Y       WYY   YNDYY        Y   DYAW   NDWDYY        WYN D  YD 
    33   33 A L  E     -E   90   0B   0  495    7  LL      L       LLL   LLLLL        L   LLLL   LLLLLL        LLF L  LL 
    34   34 A A  E     -E   89   0B   0  495   71  SA      S       ANN   NANAA        N   NSAA   AAANAA        ANA G  NA 
    35   35 A W  E     -EF  88  48B   1  496    0  WW      W       WWW   WWWWW        W   WWWW   WWWWWW        WWW W  WW 
    36   36 A Y  E     -EF  87  46B   0  496    8  YY      Y       YYY   YYYYY        Y   YYYY   YYYYYY        YYY Y  YY 
    37   37 A Q  E     -EF  86  45B   7  496   27  QQ      Q       QQQ   QQQQQ        Q   QQQQ   QQQQQQ        QQQ Q  QQ 
    38   38 A Q  E     -E   85   0B  21  496    4  QQ      Q       QQQ   QQQQQ        Q   QQQQ   QQQQQQ        QQQ Q  QQ 
    39   39 A K    >   -     0   0   51  495    8  KK      K       KKK   KKKKK        K   KKKK   KKKKKK        KKK K  KK 
    40   40 A Q  T 3  S+     0   0  190  496   18  PP      P       PPP   PPPPP        P   PPPP   PPPPPP        PPP P  PP 
    41   41 A G  T 3  S+     0   0   86  496   10  GG      G       EGG   GGGGG        G   GGGG   GGGGGG        GGG G  GG 
    42   42 A K  S <  S-     0   0  126  495   54  KK      K       KKK   KKKTK        K   KKKK   KEKKKK        KKK K  KE 
    43   43 A S        -     0   0   21  495   56  AA      A       AAV   AVASS        A   AAAA   VTAAEV        AAA A  AT 
    44   44 A P        -     0   0    4  495   10  PP      P       PPP   PPPPP        P   PPPP   PPPPPP        PPP P  PP 
    45   45 A Q  E     -F   37   0B  74  495   32  KK      Q       KKK   KKKKQ        N   KKKK   KKKKKK        KKK K  KK 
    46   46 A F  E     +F   36   0B  25  495   41  LL      V       SLL   LLLLL        L   LRLL   LLLLFL        LLL R  RL 
    47   47 A L  E     +     0   0B   4  495    9  LL      L       LLL   LLLLL        L   LLLL   LLLLLL        LLL L  LL 
    48   48 A V  E     -FG  35  54B   0  496    5  II      I       III   IIIII        I   IIIL   IIIIII        III I  II 
    49   49 A Y  E >> S+ G   0  53B  39  496   17  YY      Y       YYY   YYYYY        Y   YYYY   YYYYYY        YYY Y  YY 
    50   50 A N  T 34 S-     0   0   52  496   91  AA      A       AAA   KAAYD        A   AAAK   SARAYA        KGA A  AE 
    51   51 A A  T 34 S+     0   0    3  496   44  AA      A       AAA   AAAAA        A   AAAA   AAAAAA        AAA A  AA 
    52   52 A K  T <4 S+     0   0  148  496   25  SS      S       SSS   SSSSS        S   SSSP   SSSSSS        STS S  SS 
    53   53 A T  E  <  -G   49   0B  47  496   68  SS      S       SSS   TTSTK        S   SSNG   SGNSRT        SST S  SS 
    54   54 A L  E     -G   48   0B  60  496   59  LL      L       LLL   LLLLL        L   LLLL   LLLLLL        LLL L  LL 
    55   55 A G    >   -     0   0    9  495   70  QQ      P       QQQ   QQQQA        Q   EEQQ   QQEQAQ        EQQ Q  EQ 
    56   56 A E  T 3  S+     0   0  192  495   35  SS      S       SSS   SSSST        S   SSSS   SSASS.        SSS S  SS 
    57   57 A G  T 3  S+     0   0   70  496    5  GG      G       GGG   GEGGG        G   EGGG   GGGGGS        GGG G  GG 
    58   58 A V    <   -     0   0   25  494   10  VV      V       VVV   VVVVV        V   VVVV   VIVVIG        VVV V  VI 
    59   59 A P    >   -     0   0   47  495    7  PP      P       PPP   PPPPP        P   PPPP   PPPPPP        PPP P  PP 
    60   60 A S  T 3  S+     0   0  115  496   56  SS      S       SSS   SSSSS        S   SSSS   SSSSSS        SSS S  SS 
    61   61 A R  T 3  S+     0   0   44  496    4  RR      R       RRR   RRRRR        R   RRRM   RRRRRR        RRR R  RR 
    62   62 A F  E <   +C   75   0A   5  496    1  FF      F       FFF   FFFFF        F   FFFF   FFFFFF        FFF F  FF 
    63   63 A S  E     -C   74   0A  55  495   23  SS      S       SSS   SSSSR        S   SSSS   SSSSSS        SSS S  SS 
    64   64 A G  E     +C   73   0A  13  496    2  GG      G       GGG   GGGGG        G   GGGG   GGGGGG        GGG G  GG 
    65   65 A S  E     +C   72   0A  63  496    6  SS      S       SSS   RSSSS        S   SSSS   SSSSSS        SSS S  SS 
    66   66 A G  E     -C   71   0A  36  496   14  GG      G       GGG   GGGGG        G   GGGG   GGGGGG        GRG G  GG 
    67   67 A S  E >   +C   70   0A  79  496    9  SS      S       SSS   SSSSS        S   SSSS   SSSSSS        SSF S  SS 
    68   68 A G  T 3  S-     0   0   16  496   12  GG      G       GGG   GGGGG        G   GGGG   GGGGGG        GGG G  GG 
    69   69 A T  T 3  S+     0   0   67  495   13  TT      T       TTT   TTTTT        T   TTTT   TTTTTT        TTT T  TT 
    70   70 A Q  E <   +BC  24  67A 110  496   29  DD      D       DDD   GDDDD        D   DEDD   DDDDDD        EDE E  DD 
    71   71 A F  E     -BC  23  66A   2  494    5  FF      F       FFF   YFFFY        F   FFFF   FFFFFF        FFF F  FF 
    72   72 A S  E     -BC  22  65A  26  495   30  TT      T       TTT   TTTTS        T   TTTT   TTTTTT        TTT T  TT 
    73   73 A L  E     -BC  21  64A   0  496    2  LL      L       LLL   FLLLL        L   LLLL   LLLLLL        LLL L  LL 
    74   74 A K  E     -BC  20  63A  97  496   38  TT      T       TTT   TTTTT        T   TTTT   TTTTTT        TTT T  TT 
    75   75 A I  E     -BC  19  62A   0  496    1  II      I       III   IIIII        I   IIII   IIIIII        III I  II 
    76   76 A N  S    S-     0   0   86  496   29  SS      S       SSS   SSSSS        S   SSSS   SSSSSS        SSS S  SS 
    77   77 A S  S    S-     0   0   58  496   62  SS      S       SST   SSSGG        S   SSSS   SSSSSS        SSS S  SS 
    78   78 A L        -     0   0    0  496   27  LL      L       LLL   LLLLL        L   LLLL   LLLLLL        LLL L  LL 
    79   79 A L    >   -     0   0   67  496   31  QQ      Q       QQQ   QQQQQ        Q   QQQQ   QQQQQQ        QQQ Q  QQ 
    80   80 A P  G >  S+     0   0   92  496   59  PP      P       PPP   SPPAA        P   PPPP   PPPPPP        PPP P  PS 
    81   81 A E  G 3  S+     0   0  102  496   15  EE      E       EEE   EEEEE        E   EEEE   EEEEEE        DEE E  EE 
    82   82 A D  G <  S+     0   0    1  496    5  DD      D       DDD   DEDDD        D   DDDY   DDDDDD        DDD D  DD 
    83   83 A F    <   +     0   0   29  495   73  FF      F       FFF   VVFFF        F   FFFF   VFIFVV        FFF F  FF 
    84   84 A G  E    S- H   0 105B  17  496   23  AA      A       AAA   AAAAA        A   AAAA   AAAALA        AAA A  AA 
    85   85 A S  E     -EH  38 104B  24  496   62  TT      T       TTT   TTTSD        T   TAVT   TTTTTT        TTT T  TT 
    86   86 A Y  E     -EH  37 103B   0  496    0  YY      Y       YYY   YYYYY        Y   YYYY   YYYYYY        YYY Y  YY 
    87   87 A Y  E     -E   36   0B   5  495    4  YY      Y       YYY   YYYYF        Y   YYYY   YYYYFY        YYY Y  YY 
    88   88 A b  E     -E   35   0B   0  496    0  CC      C       CCC   CCCCC        C   CCCC   CCCCCC        CCC C  CC 
    89   89 A Q  E     -EI  34  99B   0  494   48  QQ      Q       QQQ   QQQMQ        Q   QLQQ   QQQLQQ        QQQ L  LQ 
    90   90 A H  E     -E   33   0B  22  486   28  HQ      Q       QQQ   HK QQ        Q    QQQ   RHQQQK        QQQ Q  QH 
    91   91 A H        +     0   0    0  423   89  GH      N        AT   N            S    GR    TYH H         .S. H  YY 
    92   92 A Y  S    S+     0   0  104  454   87  YN      Y        NY   Y            Y    YN    YYD           YYL N  NY 
    93   93 A G  S    S-     0   0   34  421   71  GS      I        ..   G            .     S    NSN           N.N S  SS 
    94   94 A T  S    S-     0   0  104  444   88  TY      T        RI   T            S     Y    ATS           SSS Y  DT 
    95   95 A P  S    S+     0   0    7  441   51   P      P        FT   P            T     P    PPP           ITF P  PP 
    96   96 A P  S    S-     0   0   55  420   76   P      T        PP   P            S     P    PPP           EPP P  PP 
    97   97 A L        -     0   0   21  151   88          S        LL                W                        GRR       
    98   98 A T        -     0   0   40  278   41          .        TT                T                        TTT       
    99   99 A F  B     -I   89   0B  18  277   26          F        FF                F                        FFF       
   100  100 A G        -     0   0    3  285   38          G        GG                G                        GGG       
   101  101 A G        -     0   0   52  300   63          Q        GG                E                        QQQ       
   102  102 A G        -     0   0   11  300   41          G        GG                G                        GGG       
   103  103 A T  E     - H   0  86B   0  360   19          T        TT                T                        TTT       
   104  104 A K  E     -dH  10  85B  98  359   60          R        KK                K                        KKK       
   105  105 A L  E     -dH  11  84B   4  343   39          V        VV                V                        VLV       
   106  106 A E  E     -d   12   0B 108  326   52          E        EE                E                        EEE       
   107  107 A I  E      d   13   0B 113  295   51          I        II                I                        III       
   108  108 A K              0   0  145  261   18          K        KK                K                        KKK       
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30    EEEE       QEE   QEE     EE    QE EQQ    EEE        E    E   Q EQ  E
   111    2 B V        +     0   0   19  428   12    VVVV   VVVVVVV   VVV     VVVVVVVV VVV    VEV        VVVVVV   V VV  V
   112    3 B K  E     -J  134   0C 111  430   32    QQKK   QQQQKKQ   QQQ     KKQQQQQM QQQ    QQQ        QQQQQM   Q NQ  Q
   113    4 B L  E     -J  133   0C   3  452    1    LLLL   LLLLLLL   LLL     LLLLLLLL LLL    LLL        LLLLLL   L LL  L
   114    5 B Q  E     -J  132   0C  83  454   70    VVLL   VVVVLHV   VVV     LLVVVVVV QVQ    VVV        VVVVVV   Q EV  V
   115    6 B E  E     +J  131   0C   5  458   22    EEEE   EEEEEEE   EEE     EEEEEEEE EQE    EEE        EEEEEE   E EE  E
   116    7 B S  E     +J  130   0C  69  463   14    SSSS   SSSSSSS   SSS     SSSSSSSS SSS    SSS        SSSSSS   S SS  S
   117    8 B G        +     0   0   36  467    4    GGGG   GGGGGGG   GGE     GGGGGGGG GGG    GGG        GGGGGG   G GG  G
   118    9 B G        +     0   0   29  718   50    GGGGGG GGGGGGG   GGG     GGGGGGGE GGG    GGG       GGGGGGG   G GG  G
   119   10 B D        -     0   0   96  725   42    GDGGGG GGGGGGG   GGG     GPGGGGGG GGG    GGG      GGGGGGGG   G GG  G
   120   11 B L  E     +n  224   0D  79  727   14    LLLLLL LVVLLFL   VLL     LLLVLVVL LVL    LLL      LLLVVVVL   L LL  L
   121   12 B V  E     -n  225   0D  16  729   31    VVVVVV VVVVVVV   VVV     VVVVVVVV VVV    VVV      VVVVVVVV   V VV  V
   122   13 B Q    >   -     0   0  114  730   53    QQQQQQ QQQQQQQ   QQQ     QQQQKQQQ QQQ    LQQ      QQKQQQQQ   Q QQ  Q
   123   14 B P  T 3  S+     0   0   66  730    7    PPPPPP PPPPPPP   PPP     PLPPPPPP PPP    PPP      PPPPPPPP   A PP  P
   124   15 B G  T 3  S+     0   0   58  734   31    GGGGGG GGGGKKG   GGG     GGGGGGGK KGG    GGG      GGGGGGGK   G GG  G
   125   16 B G    <   -     0   0   25  736   63    GRGGGG GRGRGGG   RGG     GGGRGRRG GRG    GGG      EGGRRRRG   E GR  G
   126   17 B S        +     0   0   78  735   29    SSSSSS SSSSSSS   SSS     SSSSPSSS SSS    SSS      SSSSSSSS   S SS  S
   127   18 B L  E     - K   0 192C  25  737   28    LLLLLL LLLLLLL   LLL     LLLLLLLL LLL    LLL      LLLLLLLL   L ML  L
   128   19 B K  E     - K   0 191C  93  735   55    RRK.KK RRRRKKR   RRR     KKRRRRRK KRR    RRR      KKRRRRRK   K KR  R
   129   20 B L  E     - K   0 190C   0  740   16    LLLLLL LLLLLLL   LLL     LLLLLLLL LLL    LLL      LLLLLLLL   L LL  L
   130   21 B S  E     -JK 116 189C  28  740   37    SSSSSS SSSSSSS   SSS     SSSSSSSS SSS    SSS      SSSSSSSS   S SS  T
   131   22 B d  E     -JK 115 188C   0  740    0    CCCCCC CCCCCCC   CCC     CCCCCCCC CCC    CCC      CCCCCCRC   C CC  C
   132   23 B A  E     -JK 114 187C  52  740   67    AAAAAA AAAAAAA   AAA     AAAAAAAA AAA    AAA      EATAAAAA   A AT  A
   133   24 B A  E     +J  113   0C   8  740   48    AAAAAA AAAAAAA   AAA     AAAAAAAA AAA    AAA      SAAAAAAA   A AT  A
   134   25 B S  E     +J  112   0C  58  740   14    SSSSSS SSSSSSS   SSS     SSSSSSSS SSS    SSS      NSSSSSSS   S SS  S
   135   26 B G  S    S+     0   0   56  739    3    GGGGGG GGGGGGG   GGG     GGGGGGGG GGG    GGG      EGGGGGGG   G GG  G
   136   27 B F  S    S-     0   0   33  740   31    FFFFFF FFFFFFF   FFF     FFFFFFFF FFF    FFF      YFFFFFFF   N FF  F
   137   28 B T    >   -     0   0   93  740   53    TBDDDD TTSTTTT   TTT     DDTTTTTT TTM    TTT      EDTTTTTT   T TT  T
   138   29 B F  G >  S+     0   0    2  740   28    FFFFFF FFLFFFV   FFF     FFFFFFFF FFF    FFF      FFFFFFFF   F FF  F
   139   30 B S  G 3  S+     0   0   57  740   55    SBSSSS SSSSNNS   SSS     SSSSSRSN SSS    SSR      PSSSSSSN   S SG  S
   140   31 B S  G <  S+     0   0   71  740   57    SBRRRR NSDSNAS   SSS     KRNSSSST TNR    SSS      SRTSSSIN   G DD  D
   141   32 B Y  S <  S-     0   0   44  738   42    YLYYYY YYYYYYN   YYY     YYYYYYYY YYY    YYY      HYYYYYYY   G AY  Y
   142   33 B T        -     0   0   30  739   92    AGWWWW WGGGAAY   GNY     WWWGSGGA AGA    DWG      DWGGGGGA   F WA  E
   143   34 B M  E     -OP 160 207E   0  739   49    MMMMMM MMMMMMM   MMM     MMMMMMMM MMM    MMM      MMMMMMMM   M MM  M
   144   35 B S  E     -OP 159 206E   0  740   72    GTSSSS NHHHNNN   HNN     SSNHNHHN NHS    NHS      SSHHHHHN   G DI  D
   145   36 B W  E     +OP 158 205E   0  740    0    WWWWWW WWWWWWW   WWW     WWWWWWWW WWW    WWW      WWWWWWWW   W WW  W
   146   37 B V  E     -OP 156 204E   0  740   17    VVVAVV AVVVVVV   VVV     VVAVVVVV VVV    VLI      VVVVVVVV   Y VA  V
   147   38 B R  E     -OP 155 203E  10  740   21    RRRRRR RRRRRRR   RRR     RRRRRRRR RRR    RRR      RRRRRRRR   R RR  R
   148   39 B Q  E     -OP 154 202E   9  740    4    QQQQQQ QQQQQQQ   QQQ     QQQQQQQQ QQQ    QQQ      KQQQQQQQ   Q QQ  Q
   149   40 B T    >   -     0   0    9  739   74    AAAAAA VAAAAAA   AAA     AAVAAAAA AAA    AAA      TAAAAAAA   A SA  A
   150   41 B P  T 3  S+     0   0   80  740   11    PPPPPP PPPPPPP   PPP     PPPPPPPP PPP    PPP      PPPPPPPP   P PP  P
   151   42 B E  T 3  S-     0   0  151  740   29    GGGGGG GGGGGGG   GGG     GGGGGGGG GGG    GGG      EGEGGGGG   G EG  G
   152   43 B K    <   +     0   0  121  740   37    KKKKKK KKEKKKK   KKK     KKKKKKKK KKK    KKK      KKKKKKKK   K KK  K
   153   44 B R        -     0   0  113  739   42    GGGGGG GGGGGGG   GGG     GGGGGGGG GGG    GGG      RGGGGGGG   Q GG  G
   154   45 B L  E     -O  148   0E   9  740   13    LLLQLL LPLLLLL   LLL     LLLLLLLL LLP    LLL      LLLLLLLL   R LL  L
   155   46 B E  E     -O  147   0E  44  739    4    EEEEEE EEEEEEE   EEE     EEEEEEEE EEE    EEE      EEEEEEEE   E EE  E
   156   47 B W  E     +O  146   0E  15  739   11    WWWWWW WWWWWWS   WWW     WWWWWWWW WWW    WWW      LWWWWWWW   L WW  W
   157   48 B V  E     -     0   0E   0  739   28    VVIIII VVVVVVV   VVV     IIVVVVVV VVV    VVV      VIVVVVVV   V VV  L
   158   49 B A  E     -O  145   0E   0  740   36    SAGGGG AAAAAAS   AAA     GGAASAAA AAS    ASA      AGSAAAAA   A AS  G
   159   50 B S  E     -OQ 144 168E   0  740   94    TNEEEE NVVVRRV   VYR     EENVSFVR RIG    YLV      AETVVVVR   T ES  E
   160   51 B I  E     -OQ 143 167E   4  739   18    IIIIII IIIIIIT   III     IIIIIIII VII    III      IIIIIIMI   I II  I
   161   52 B N    >   -     0   0   47  740   85    GKNNNN KSSWRRY   WST     HDKSSWWR RWS    SSW      NNSSSWSR   N RS  N
   162   53 B N  T 3  S+     0   0   65  740   86    TZPPPP QYYYSSS   YTN     PPQYSYYS SYG    ISN      SPIYYYYS   S TS  P
   163   54 B G  T 3  S-     0   0   65  740   68    ABDGDD DDDDKKG   DGS     DNDDSDDK KDS    PDD      DDGDDDDK   R KS  A
   164   55 B G  S <  S+     0   0   30  740   50    GGSSSS GGGGTSG   GGG     SSGGSGGS SGG    SGG      GSGGGGGS   G VS  G
   165   56 B G  S    S+     0   0   74  739   59    SSSSSS TSSSnnS   SSG     GSTSSSSn fNG    gsS      GSGSSSGn   I nS  S
   166   57 B R        +     0   0  163  548   85    .ZTTTT ENNNae.   N.S     TTENYNNa aDS    syQ      STSNNNNa   . aY  S
   167   58 B T  E     -Q  160   0E  62  724   48    TZIIII KKKKTTS   KTS     IIKKIKKT TET    TIK      TITKKKET   T TI  T
   168   59 B Y  E     +Q  159   0E  53  723   87    YBNNNN YYYYYYY   YYY     NNYYYYYY YYY    YYY      YNYYYYYF   N YY  S
   169   60 B Y        -     0   0   44  737    7    YYYYYY YYYYYYY   YYY     YYYYYYYY YYY    YYY      YYYYYYYY   Y YY  Y
   170   61 B P    >>  -     0   0   20  737   66    AVTTTT VAAAAAA   AAA     TTVAAAAA AAA    AAA      PTAAAAAA   A AA  A
   171   62 B D  T 34 S+     0   0  148  739   65    DDPPPP DDDDDDD   DNE     PPDDDDDD DDD    DAD      DPNDDDDD   D ED  N
   172   63 B T  T 34 S+     0   0   90  739   62    SSSSSS SSSSSSS   SAY     SSSSSSSS SSS    ASS      TSSSPSSS   F SS  S
   173   64 B V  T X> S+     0   0    1  740   43    VVLLLL VVVVVVV   VVV     LLVVVVVV VVV    VVV      MLVVVVVV   V VV  V
   174   65 B K  B 3< S+l  177   0C 142  739   35    KKKKKK KKKKKKK   KKK     KKKKKKKK KKK    KKK      EKKKKKKK   K KK  K
   175   66 B G  T 34 S+     0   0   74  739   36    GGDDDD GGGGDDG   GGG     DDGGGGGD GGG    GGG      RDGGGGGD   G GG  G
   176   67 B R  T <4 S+     0   0   36  739   21    RRKKKK RRRRRRR   RRR     KKRRRRRR RRR    RRR      RKRRRLRR   R RR  R
   177   68 B F  E  <  -lM 174 192C   2  740   67    FFFFFF FFFFFFF   FFF     FFFFFFFF FFF    FFF      FFFFFFFF   F FF  L
   178   69 B T  E     - M   0 191C  79  740   38    TTIIII TTTTTTT   TTT     IITTTTTT TTT    TTT      IITTTTIT   T TT  T
   179   70 B I  E     + M   0 190C   5  740   22    IIIIII IIIIIII   III     IIIIIVII IIV    III      IIIIITII   I II  I
   180   71 B S  E     - M   0 189C  51  736   45    SSSSSS SSSSSSS   SSS     SSSSSSSS SSS    SSS      SSSSSSSS   S SS  S
   181   72 B R  E     - M   0 188C  30  739   68    RRRRRR RRRRRRR   RRR     RRRRRRRR RRR    RRR      RRRRRRRR   R RR  R
   182   73 B D  E > > - M   0 187C  60  738    5    DDDDDD DDDDDDD   DDD     DNDDDDDD DDD    EDD      DDDDDDDD   D DD  D
   183   74 B N  G > 5S+     0   0   48  739   59    NNNNNN NNNNDDN   NNN     NDNNNSND DNN    NNN      NNNNNNND   N DN  N
   184   75 B A  G 3 5S+     0   0   99  739   41    AAAAAA ASSSSSS   SAA     AAASAASS SSS    AAD      TAASSSSS   A SA  A
   185   76 B K  G < 5S-     0   0  111  740   54    KKKKKK KKKKQQK   KKK     KKRKKKKQ QKK    KKK      KKKKKKKQ   K KK  K
   186   77 B N  T < 5 +     0   0   62  740   46    NNNNNN NNNNSYN   NNN     NNNNNNNS SNN    NNN      KNNNNNNS   K SN  N
   187   78 B T  E   < -KM 132 182C  16  740   68    LSTTTT STTSMMT   TTT     STSTSTTM MIT    STT      TTETTTTM   T NS  M
   188   79 B L  E     -KM 131 181C   0  737   61    LLLLLL LLLLLVL   LLL     LLLLLLLL LLL    LLL      LLLLLLLL   V VL  L
   189   80 B Y  E     -KM 130 180C  41  737   41    YYYYYY YYYYYYY   YYY     YYYYYYYY YFY    YYY      YYYYYYYY   Y YY  Y
   190   81 B L  E     -KM 129 179C   0  739    8    LLLLLL LLLLLLL   LLL     LLLLLLLL LLL    LLL      LLLLLLLL   L LL  L
   191   82 B Q  E     -KM 128 178C  76  739   41    QQQQQQ QQQQQQQ   QQQ     QQQQQQQQ QQQ    QQQ      QQQQQQQQ   E QQ  Q
   192   83 B M  E     +KM 127 177C   0  740   11    MMMMMM MMMMMMM   MMM     MMMMMMMM MMM    MMM      MMMMMMMM   M MM  M
   193   84 B S        +     0   0   42  740   54    NNSSSS NNNNNNN   NSN     SSNNNGNN NNN    SNN      SSNNNNNN   N NN  N
   194   85 B S  S    S-     0   0   68  739   23    SSKKKK SSSSNNS   SSS     KKSSSSSN NSS    SSS      SKSSSSSN   S SS  T
   195   86 B L        -     0   0    3  740   16    LLVVVV LLLLLLL   LLL     VVLLLLLL LLL    LLL      LVLLLLLL   L LL  L
   196   87 B K    >   -     0   0  102  740   70    RRRRRR RRRRKKR   RRK     RRRRRRRK KRR    RKG      RRKRRRRK   E RR  R
   197   88 B S  G >  S+     0   0   70  740   59    AVSSSS AAAATSA   AAV     SSAAAAAT TIA    AAS      SSSAAAPT   P VA  A
   198   89 B E  G 3  S+     0   0  126  740   21    EEEEEE EEEEEEE   EEE     EEEEEEEE EAE    EEQ      EEEEEEEE   E EE  E
   199   90 B D  G <   +     0   0    2  740    3    DDDDDD DDDDDDD   DDD     DDDDDDDD DDD    DDD      DDDDDDDD   D DD  D
   200   91 B T    <   +     0   0   32  740   32    TTTTTT TTTTTTT   TTT     TTTTTTTT TTT    TTM      TTTTTTTT   T TT  M
   201   92 B A  E    S- R   0 223E   8  737    4    AAAAAA AAAAAAA   AAA     AAATAAAA AAA    AAA      AAAAAAAA   A GA  A
   202   93 B M  E     -PR 148 222E  58  739   46    MLLLLL IVVVMMF   VVM     LLIVVVVM MVV    VVI      LLVVVVMM   V IV  V
   203   94 B Y  E     -PR 147 221E   0  739    1    YYYYYY YYYYYYY   YYY     YYYYYYYY YYY    FYY      YYYYYYYY   Y YY  Y
   204   95 B Y  E     -P  146   0E   7  740    4    YYYYYY YYYYCYY   YYY     YYYYYYYY YYY    YFY      YYYYYYYY   Y YY  Y
   205   96 B d  E     -P  145   0E   0  740    0    CCCCCC CCCCCCC   CCC     CCCCCCCC CCC    CCC      CCCCCCCC   C CC  C
   206   97 B V  E     -PS 144 217E   0  740   24    AAAAAA AAAAVVA   AAA     AAAAAAAV VAA    VAV      AAAAAAAV   Y TA  A
   207   98 B R  E     -PS 143 216E  21  739   39    rRRRrR tkrtrrr   rrt     RRtkRrrr rRk    RRr      rrskkrfr   T Mr  R
   208   99 B H  E     + S   0 214E   6  629   94    f.LLy. tysttsf   rwv     L.tn.pwe y.y    H.l      ellvvypg   . .y  .
   209  100 B E  E  >  + S   0 213E  63  676   73    R.HGR. SGGGGAG   EAG     HSSPGDST FEG    SDG      GEDPPRAI   . AD  .
   210  101 B Y  T >4 S-     0   0   80  702   91    VGYYSY SDWGNYE   PLN     YPSGVEGD DIS    ETW      GNDAAQVD   H YF  .
   211  102 B Y  T 34 S-     0   0  140  709   44    yWYYYy SYYFYYF   YfF     YYSFvYyY YYg    RVF      FYFAAPYY   Y YW  .
   212  103 B Y  T 34 S+     0   0   39  264   90    yGGG.y ....Y..   Nv.     GY..g.y. GGq    .S.      ........   . .S  D
   213  104 B A  E <<  -S  209   0E   0  447   85    HGYYAY .VL.AAL   WG.     YA..V.YA GDP    .G.      W....G.A   F .G  T
   214  105 B M  E     +S  208   0E   0  580   59    LGAFMF .FW.MMF   FF.     NM..LFFM FSF    KK.      FF...P.M   R EM  A
   215  106 B D  E     +     0   0E  19  696   48    FDADDD DDDDDDD   DRR     ANDDVDDD ATE    LDP      ADY..DDD   S AD  S
   216  107 B Y  E     -S  207   0E  99  702   57    MYYYYY YYYYYYY   PTF     YYYYFYYY YNY    IMV      YYYNNYCY   Y YV  Y
   217  108 B W  E     -S  206   0E  23  731    0    WWWWWW WWWWWWW   WWW     WWWWGWWW WWW    WWW      WWWWWWWW   W WW  W
   218  109 B G        -     0   0    0  714   13    GGGGGG GGGGGGG   GSG     GGGGGGGG GGG    AA       GGGGGGGG   G GG  G
   219  110 B Q        -     0   0   91  701   38    SQQQQQ QQQQQQQ   QL      QQQQQQQQ QQQ    QA       QQQQQQQQ   Q QK  Q
   220  111 B G        -     0   0   16  687   10    GGGGGG GGGGGGG   GG      GGGGGGGG GGG    G        GGGGGGGG   G GG   
   221  112 B T  E     -R  203   0E  21  675   26     TTTTT TTTTTTT   TT      TTTTTTTT TTT    F        TTTTTTTT   T TT   
   222  113 B T  E     -R  202   0E  72  661   75     LLTST LLLLSSL   L       LSLLLLLS LLL    P        LTLLLLLS   Q LT   
   223  114 B V  E     -R  201   0E   0  654   18     VVLVL VVVVVVV   V       VVVVVVVV VVV    L        VLVVVVVL   V VV   
   224  115 B T  E     -n  120   0D  36  643   13     TTTTT TTTTTTT   T       TTTTTTTT TTT    K        TTTTTTTT   T TT   
   225  116 B V  E     +n  121   0D   6  626    6     VVVVV VVV VVV   V       VVVVVVVV VVV    L        VVVVVVVV   V VV   
   226  117 B S        -     0   0   36  616    5     SSSSS SSS SSS   S       SSSSSSSS SSS    S        SSSSSSSS   S SS   
   227  118 B S  S    S+     0   0   84  597   20     TASSS SSS SSS   S       ASSSSSSS ASS    A        ASSSSSSS   S AS   
   228  119 B A  S    S+     0   0   70   97   58                     G                  G               V               
   229  120 B W        -     0   0  123   87   40                     S                                  D               
   230  121 B R        +     0   0  207   62   76                                                        P               
   231  122 B H              0   0  156   56   69                                                        N               
   232  123 B P              0   0  155   28   53                                                        S               
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 A D              0   0  183  423   16   D       DDDDD    D E    DD  DD      D      DDDD    DDDDD     DD    DD
     2    2 A I        -     0   0   32  466   12   II      IIIII    I L    II  III     I      IIII    IIIII     II    II
     3    3 A E        -     0   0  117  468   68   QQ      QQQQQ    V V    QQ  VQQ     Q      MTTT    QQQQQ     QQ    QV
     4    4 A L  E     -A   25   0A  10  482    7   MM      MMLMM    M M    MM  LMM     M      MMMM    MMMMM     LL    MM
     5    5 A T  E     -A   24   0A  64  482    8   TT      TTTTT    T T    TT  TST     T      TTTT    TTTTT     TT    TT
     6    6 A Q  E     -A   23   0A  13  482    0   QQ      QQQQQ    Q Q    QQ  QQQ     Q      QQQQ    QQQQQ     QQ    QQ
     7    7 A T  E    S+A   22   0A  64  482   35   SS      SSSSS    S S    SS  SSS     S      SSSS    SSSSS     SS    ST
     8    8 A P        -     0   0   46  485    9   PP      PPPPP    P P    PP  PPP     P      PPPP    PPPPP     PP    PP
     9    9 A V  S    S+     0   0   96  489   67   SS      SSSSA    S S    SS  ASS     S      SSSS    SSSSS     SS    SS
    10   10 A S  E     -d  104   0B  60  491   42   SS      PTSSS    L S    SS  SSS     S      SSYS    TSTSS     SS    SS
    11   11 A L  E     -d  105   0B  58  494   23   LL      LLLLL    L L    LL  MLL     L      LLLL    LLQLV     MM    LV
    12   12 A S  E     +d  106   0B  60  495   42   SS      SSSSS    S A    SS  YSS     S      SPSP    SSPSS     YY    SS
    13   13 A A  E     -d  107   0B   0  495   58   AA      AAAAA    A A    AA  AAA     A      AVKV    AAAAA     AA    AA
    14   14 A S    >   -     0   0   47  496   31   SS      SSSSS    S S    SS  SSS     S      SSSS    SSSSS     SS    SA
    15   15 A V  T 3  S+     0   0   76  496   66   VV      VVVVL    T V    VV  LVV     V      PSPR    VVVVV     LL    VV
    16   16 A G  T 3  S+     0   0   42  496    5   GG      GGGGE    G G    GG  GGG     G      GGGG    GGGGG     GG    GG
    17   17 A E    <   -     0   0   71  496   36   DD      DDDDE    D D    DD  EDD     D      DDED    DDDDD     EE    DG
    18   18 A T        -     0   0   69  496   62   RR      SRRRI    R R    RR  RRT     R      RRRR    RRRRR     RR    RT
    19   19 A V  E     - B   0  75A  11  496   36   VV      VVVVV    V V    VV  VVV     V      VVVV    VVVVV     VV    VV
    20   20 A T  E     - B   0  74A  67  495   29   TT      TTTTT    T T    TT  TTT     T      TTTT    ATTTT     TT    TT
    21   21 A I  E     - B   0  73A   1  494   17   II      IIIII    I F    II  III     I      IIII    IIIII     II    II
    22   22 A T  E     -AB   7  72A  29  494   59   TT      TTTTT    S T    TT  TTT     T      TTTT    TTTTT     TT    TK
    23   23 A b  E     -AB   6  71A   0  495    1   CC      CCCCC    C C    CC  CCC     C      CCCC    CCCCC     CC    CC
    24   24 A R  E     -AB   5  70A 110  495   47   RR      QRRRQ    R R    RQ  KRR     R      RIRR    RRRRR     KK    RQ
    25   25 A A  E     -A    4   0A  10  495   28   AA      AAAAA    M A    AA  AAA     A      AAAA    AAAAA     AA    AA
    26   26 A S  S    S+     0   0   66  495    4   SS      SSSSS    S S    SS  SSS     S      SSSS    SRSSS     SS    SS
    27   27 A E  S    S-     0   0  101  495   38   QQ      QQQQQ    Q Q    QQ  QQQ     Q      QEQQ    QQQQQ     QQ    QE
    28   28 A N        +     0   0   83  495   45   GG      DSSSD    G S    GD  DGS     G      NDGN    NGSGD     DD    GN
    29   29 A I    >   -     0   0    5  496   32   II      IIVII    I I    II  III     I      IVII    IIIII     II    II
    30   30 A Y  T 3   -     0   0  155  496   81   SS      RSYSG    S S    RS  NSG     N      NSSN    SSNRS     NN    NY
    31   31 A S  T 3  S+     0   0   53  471   64   SS      NSNNN    S S    ND  SSS     N      SSSS    SSINH     NN    NS
    32   32 A Y    <   +     0   0   63  495   53   WY      SWYYW    Y Y    DY  YYN     Y      WYYW    WWWDW     YY    EL
    33   33 A L  E     -E   90   0B   0  495    7   LL      LLVLL    L L    LL  LLL     L      LLLL    LLLLL     LL    LL
    34   34 A A  E     -E   89   0B   0  495   71   AA      IAANA    A N    GI  SNA     S      AHNA    AAATA     SS    AA
    35   35 A W  E     -EF  88  48B   1  496    0   WW      WWWWW    W W    WW  WWW     W      WWWW    WWWWW     WW    WW
    36   36 A Y  E     -EF  87  46B   0  496    8   YY      YYFYY    Y Y    YY  FYY     Y      YYYY    YYYYY     LL    YY
    37   37 A Q  E     -EF  86  45B   7  496   27   QQ      QQQQQ    Q Q    QQ  QQQ     Q      QQQQ    QQQQQ     QQ    QQ
    38   38 A Q  E     -E   85   0B  21  496    4   QQ      QQQQQ    Q Q    QQ  QQQ     Q      QQQQ    QQQQQ     QQ    QQ
    39   39 A K    >   -     0   0   51  495    8   KK      KKKKK    K K    KK  KKK     K      KKKK    KKKKK     KK    KK
    40   40 A Q  T 3  S+     0   0  190  496   18   PP      PPPPP    P P    PL  PPP     P      PQPP    PPPPS     PP    PP
    41   41 A G  T 3  S+     0   0   86  496   10   GG      GGGGG    G G    GG  GGG     G      GGGG    GEEGG     GG    WG
    42   42 A K  S <  S-     0   0  126  495   54   KK      KKKKK    K K    KK  KKK     K      QQQK    KKKTK     KK    KQ
    43   43 A S        -     0   0   21  495   56   AA      AAAAS    A A    AA  SAV     A      AASA    AAAAA     SS    DP
    44   44 A P        -     0   0    4  495   10   PP      PPPPP    P P    PP  PPP     P      PPPP    PPPPP     PP    PP
    45   45 A Q  E     -F   37   0B  74  495   32   KK      KKKKQ    E K    KN  KKK     K      KKKK    KKKKK     KK    KK
    46   46 A F  E     +F   36   0B  25  495   41   LL      FLSLL    L L    RL  TLL     P      LLRP    VSLRL     TT    LL
    47   47 A L  E     +     0   0B   4  495    9   LL      LLLLL    L L    LL  LLL     L      LLLL    LLLLL     LL    LL
    48   48 A V  E     -FG  35  54B   0  496    5   II      IIIII    I I    II  III     I      IIII    IIIII     II    II
    49   49 A Y  E >> S+ G   0  53B  39  496   17   YY      YYYYY    Y Y    YY  YYY     Y      YRYY    YYYYY     YY    YY
    50   50 A N  T 34 S-     0   0   52  496   91   AY      DDDAG    A A    AD  RYA     Y      KYGR    KAKGS     RR    SD
    51   51 A A  T 34 S+     0   0    3  496   44   AA      AAAAA    A A    AA  AAA     A      AAAA    SAAAA     AA    AA
    52   52 A K  T <4 S+     0   0  148  496   25   SS      ESSST    S S    SS  NNS     S      SNSS    SSSTS     NN    SS
    53   53 A T  E  <  -G   49   0B  47  496   68   SS      NSTSS    T S    ST  RST     S      STNI    SSTSS     RR    ND
    54   54 A L  E     -G   48   0B  60  496   59   LL      LLLLL    L L    LL  LLL     L      LLLL    LLLLL     LL    LL
    55   55 A G    >   -     0   0    9  495   70   EQ      EEQQA    Q Q    QE  VAQ     E      EEQQ    EQEQE     VV    LA
    56   56 A E  T 3  S+     0   0  192  495   35   SS      ISSSD    S S    ST  DSS     T      SSSS    SSTSN     DD    MS
    57   57 A G  T 3  S+     0   0   70  496    5   GG      GGGGG    G G    GG  GRE     G      GGGG    GGGGG     GG    GG
    58   58 A V    <   -     0   0   25  494   10   VV      VVVVV    V V    VV  VVV     V      VVVV    VVVVV     VV    VV
    59   59 A P    >   -     0   0   47  495    7   PP      PPPTP    P P    PP  PPP     P      PPPP    PPPPP     PP    PP
    60   60 A S  T 3  S+     0   0  115  496   56   SS      SSSSS    S S    SS  SSS     S      SSSS    SSSSS     SS    SS
    61   61 A R  T 3  S+     0   0   44  496    4   RR      RRNRR    R R    RR  RRR     R      RRRR    RRRRR     RR    QR
    62   62 A F  E <   +C   75   0A   5  496    1   FF      FFFFF    F F    FF  FFF     F      FFFF    FFFFF     FF    FF
    63   63 A S  E     -C   74   0A  55  495   23   SS      RSTSS    S S    SS  SSS     S      SSSS    SSSSS     SS    SS
    64   64 A G  E     +C   73   0A  13  496    2   GG      GGGGG    G G    GG  GGG     G      GGGG    GGGGG     GG    GG
    65   65 A S  E     +C   72   0A  63  496    6   SS      SSSSS    S S    SS  SSS     S      SSSS    SSSSS     SS    SS
    66   66 A G  E     -C   71   0A  36  496   14   GG      GGGGR    G G    GG  GGG     G      GGVG    GGGGG     GG    GG
    67   67 A S  E >   +C   70   0A  79  496    9   SS      SSSSS    S S    SS  SSS     S      SSSS    SSSSS     SS    PY
    68   68 A G  T 3  S-     0   0   16  496   12   GG      GGGGG    G G    GG  GGG     G      GGGG    GGGGG     GG    GG
    69   69 A T  T 3  S+     0   0   67  495   13   TT      TTTTT    T T    TT  QTT     T      TTTT    TTTTT     QQ    TT
    70   70 A Q  E <   +BC  24  67A 110  496   29   DD      DEDDQ    D D    EE  DED     D      DEDD    DDEEE     DD    DE
    71   71 A F  E     -BC  23  66A   2  494    5   FY      FFFFY    F F    FY  YFF     Y      YFFF    FFFFF     YY    YF
    72   72 A S  E     -BC  22  65A  26  495   30   TT      ATITS    T T    TT  STT     T      TTTT    TTTTT     SS    TT
    73   73 A L  E     -BC  21  64A   0  496    2   LL      LLLLL    L L    LF  LLL     L      FLLL    LLLLL     LL    LL
    74   74 A K  E     -BC  20  63A  97  496   38   TT      STTTK    T T    TT  TTT     T      TTTT    TTTTT     TT    TT
    75   75 A I  E     -BC  19  62A   0  496    1   II      IIIII    I I    II  III     I      IIII    IIIII     II    II
    76   76 A N  S    S-     0   0   86  496   29   SS      SSSSS    S S    SS  SSS     S      SNSS    SSNNS     SS    SS
    77   77 A S  S    S-     0   0   58  496   62   SS      SSSSR    C S    NS  SSS     S      SSSS    SSSSS     SS    SG
    78   78 A L        -     0   0    0  496   27   LL      LLLLL    L L    LL  LLL     L      MLLL    LLLLL     LL    LV
    79   79 A L    >   -     0   0   67  496   31   QQ      QQQQQ    Q Q    QQ  EQQ     Q      EEEE    ZQQQQ     EE    QQ
    80   80 A P  G >  S+     0   0   92  496   59   PP      PPPPV    S P    PP  YPP     P      PPPP    PPPPP     YY    PC
    81   81 A E  G 3  S+     0   0  102  496   15   EE      EDEEE    E E    EE  EEE     E      EEEE    BEDEE     EE    EE
    82   82 A D  G <  S+     0   0    1  496    5   DD      DDDDD    D D    DD  DDE     D      DDDD    BDDDD     DD    DD
    83   83 A F    <   +     0   0   29  495   73   FF      FFFSI    F F    FI  MFV     I      AVFV    FFFFF     MM    AA
    84   84 A G  E    S- H   0 105B  17  496   23   AA      AAAAG    A A    AA  GAA     A      AAAA    AAAAA     GG    AA
    85   85 A S  E     -EH  38 104B  24  496   62   TT      TTTTI    T T    TT  ITT     T      TTTT    TTTTT     II    TT
    86   86 A Y  E     -EH  37 103B   0  496    0   YY      YYYYY    Y Y    YY  YYY     Y      YYYY    YYYYY     YY    YY
    87   87 A Y  E     -E   36   0B   5  495    4   YY      YYYYY    Y Y    YY  YYY     Y      YYYF    YYYYF     YY    YY
    88   88 A b  E     -E   35   0B   0  496    0   CC      CCCCC    C C    CC  CCC     C      CCCC    CCCCC     CC    CC
    89   89 A Q  E     -EI  34  99B   0  494   48   QQ      QQQQQ    Q Q    LQ  LQQ     Q      QQLQ    QQQLQ     LL    QQ
    90   90 A H  E     -E   33   0B  22  486   28   QQ      QQQQQ    Q Q    QQ  QQK     Q       QQQ    QQQQQ     KK     G
    91   91 A H        +     0   0    0  423   89   AH      YY.SA    Y S    H.  .GS     Y         G     Y..A     ..     G
    92   92 A Y  S    S+     0   0  104  454   87   NS      YNYYS    Y Y    NY  YNN     N         Y     NYYH     YY     Y
    93   93 A G  S    S-     0   0   34  421   71   SS      .SNSS    S .    SD  DSK     N               SSS.     DD      
    94   94 A T  S    S-     0   0  104  444   88   FT      N STA    F S    YD  GNI     S               YRSS     EE      
    95   95 A P  S    S+     0   0    7  441   51   PP      L YLP    P T    PL  FPT     P               PYFV     FF      
    96   96 A P  S    S-     0   0   55  420   76   PP      P PIP    P P    PP  P P     P                PPP     PP      
    97   97 A L        -     0   0   21  151   88   TT      Y Y.     . I     Y  L R                      YWL     LL      
    98   98 A T        -     0   0   40  278   41   VV      T TT     T T     T  T                        TTT     TT      
    99   99 A F  B     -I   89   0B  18  277   26   LL      F FF     F F     F  F                        FFF     FF      
   100  100 A G        -     0   0    3  285   38    H      G GG     G G     G  G                        GGG     GG      
   101  101 A G        -     0   0   52  300   63    T      Q QQ     Q Q     Q  A                        QQG     AA      
   102  102 A G        -     0   0   11  300   41    Q      G GG     G G     G  G                        GGG     GG      
   103  103 A T  E     - H   0  86B   0  360   19    T      T TT     T T     T  T                        TTT     TT      
   104  104 A K  E     -dH  10  85B  98  359   60    K      K KR     K R     K  K                        KKT     KK      
   105  105 A L  E     -dH  11  84B   4  343   39           L VL     V L     V  L                        LVV     LL      
   106  106 A E  E     -d   12   0B 108  326   52           E QE     E E     E  E                        DED     EE      
   107  107 A I  E      d   13   0B 113  295   51           I II     I I     I  L                        IVI     LL      
   108  108 A K              0   0  145  261   18           K KK     K K     K  K                        KKK     KK      
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30  E   E   E        E    EQQ   Q   EEEEE EEEQQE              Q QQ  Q EE  
   111    2 B V        +     0   0   19  428   12  E   V   V     VVVV    VVV   V   VEEVV VVVVVV             VV VV  V VE  
   112    3 B K  E     -J  134   0C 111  430   32  Q   K   L     QQQQ    QQQ   Q   QQQQQ QQQEKK             QH QQ  Q QQ  
   113    4 B L  E     -J  133   0C   3  452    1  L   L   L     LLLL   LLLL  LL   LLLLL LLLLLL             LL LL  LLLL  
   114    5 B Q  E     -J  132   0C  83  454   70  V   L   V     VVVV   VVQQ  EV   VVVVV VVVVVE             VV QQ  VVVV  
   115    6 B E  E     +J  131   0C   5  458   22  E  EE   E     EEEE   EEEE  QE   EEEEE EEEEQE             EE EE  EEEE  
   116    7 B S  E     +J  130   0C  69  463   14  S  SS   S     SSSS   SSSS  SS   SSSSS SSTSAS             SS SS  SSSS  
   117    8 B G        +     0   0   36  467    4  G  GG   G     GGGG G GGGG  GG   GGGGG GGGGGG     G       GGGGG  GGGG  
   118    9 B G        +     0   0   29  718   50  G  GGGGGG     GGGG G GGGG  GG   GGGGG GGGGGG    GGGG     GGGGG  GGGG  
   119   10 B D        -     0   0   96  725   42  G  GGGGGA     GGGG G GGGE  GG   DGGGG GDGGGG    GGGG     GGGGG  GGGG  
   120   11 B L  E     +n  224   0D  79  727   14  L  LLLLLL     LVLV V LVLL  VV   LLLLL LLLVVL    LLLL     LVLLL  VLLL  
   121   12 B V  E     -n  225   0D  16  729   31  V  VVVVVV     VVVV V VVVV  VV   VVVVV VVIVVV    VVVV     VVVVV  VVVV  
   122   13 B Q    >   -     0   0  114  730   53  Q  QQQQQQ     QQKQ Q KQQQ  QQ   QQQQQ QKQZQQ    QQQQ     QQQQQ  QQQQ  
   123   14 B P  T 3  S+     0   0   66  730    7  P  PPPPPP     PPPP P PPAP  PP   PPPPP PPPPPP    PPPP     PPPAP  PPPP  
   124   15 B G  T 3  S+     0   0   58  734   31  G  GGGGGG     GGGG G GGGG  GG   GGGGG GGGGGG    GKGG     GGGGG  GGGG  
   125   16 B G    <   -     0   0   25  736   63  G  GGGGEG     GRGG R GRGG  KR   GGGGG GGGRRG    GGGG     GKRGG  RGGG  
   126   17 B S        +     0   0   78  735   29  S  SSSSSS     SSSS S SSSS  SS   SSSSS SSSSSS    SSSS     SSSSS  SSSS  
   127   18 B L  E     - K   0 192C  25  737   28  L  MLLLLL     LLLL L LLLL  LL   LLLLL LLLLLM    LLLL     LLLLL  LLLL  
   128   19 B K  E     - K   0 191C  93  735   55  R  KKKRKR     RRRR R RRTK  RR   RRRMR RRRRRK    RKRR     RRRRR  RRRR  
   129   20 B L  E     - K   0 190C   0  740   16  L  LLLLLL     LLLL L LLLL  LL   LLLLL LLLLLL    LLLL     LLLLL  LLLL  
   130   21 B S  E     -JK 116 189C  28  740   37  S  SSSSSS     SSSF S SSSS  SS   SSSSS SSSSSS    SSSS     SSSSS  SSSS  
   131   22 B d  E     -JK 115 188C   0  740    0  C  CCCCCC     CCCC C CCCC  CC   CCCCC CCCCCC    CCCC     CCCCC  CCCC  
   132   23 B A  E     -JK 114 187C  52  740   67  A  VAAAEG     AAAA A AAAA  AA   AAAAA AVAAIV    AAAA     AEAAA  AAAA  
   133   24 B A  E     +J  113   0C   8  740   48  A  AAATSA     VAAA A AAAA  AA   AAAAA AAAAAA    TATT     VAAAA  AAAA  
   134   25 B S  E     +J  112   0C  58  740   14  S  SSSSNS     SSSS S SSSS  SS   SSSSS SSSSSS    SSSS     SSSSS  SSST  
   135   26 B G  S    S+     0   0   56  739    3  G  GGGGEG     GGGG G GGGG  GG   GGGGG GGGGGG    GGGG     GGGGG  GGGG  
   136   27 B F  S    S-     0   0   33  740   31  F  FFFFYF     FFFF F FFPL  FF   FFFFF FIFFFF    FFFF     FFFRN  FFFF  
   137   28 B T    >   -     0   0   93  740   53  T  TDDTET     TTTT T TTMT  TT   TTTTT TTTTTT    TTTT     TTTTI  TTTT  
   138   29 B F  G >  S+     0   0    2  740   28  F  FFFFFF     FFFF F FFSF  FF   FFFFF FFVFFF    FFFF     FFFGD  FFFF  
   139   30 B S  G 3  S+     0   0   57  740   55  S  SSSTPS     TSSD S SSST  RS   NSSSS SSSSSS    TNTT     TSDSR  SSSS  
   140   31 B S  G <  S+     0   0   71  740   57  S  NGRDSS     TSNG H NHSN  NN   DDNSS DGBNNN    DTDD     TTDTL  SSSS  
   141   32 B Y  S <  S-     0   0   44  738   42  Y  YYYYHY     YYAY Y AYAY  YY   YYYYY YYHYYY    YYYY     YYYYY  YYYY  
   142   33 B T        -     0   0   30  739   92  N  WWWYDV     EGWA A WPVS  GG   ERRHD YDSAGW    YAYY     EGADA  GEWW  
   143   34 B M  E     -OP 160 207E   0  739   49  M  MMMMMM     MMMM M MMMM  MM   MMMMM MMMMMM    MMMM     MMMMM  MMMM  
   144   35 B S  E     -OP 159 206E   0  740   72  N  NSSSSN     NHSH H SHSG  HH   NNNNN EQSHHN    SNSS     NSHGA  HNDH  
   145   36 B W  E     +OP 158 205E   0  740    0  W  WWWWWW     WWWW W WWWW  WW   WWWWW WWWWWW    WWWW     WWWWW  WWWW  
   146   37 B V  E     -OP 156 204E   0  740   17  V  VVVVVV     VVVV V VVFF  VV   VVVVV VVVVVV    VVVV     VVVFY  VVVV  
   147   38 B R  E     -OP 155 203E  10  740   21  R  RRRRRR     RRRR R RRRR  RR   RRRRR RRRRRR    RRRR     RRRRR  RRRC  
   148   39 B Q  E     -OP 154 202E   9  740    4  Q  QQQQKQ     QQQQ Q QQQP  QQ   QQQQQ QQQQQQ    QQQQ     QQQQQ  QQQQ  
   149   40 B T    >   -     0   0    9  739   74  A  SAAPTS     AAAA A AAAG  AA   AAAAA AAAPAS    PAPP     AAAAA  AAAA  
   150   41 B P  T 3  S+     0   0   80  740   11  P  PPPPPP     PPPP P PPPP  PP   PPPPP PPPPPP    PPPP     PPPPA  PPPP  
   151   42 B E  T 3  S-     0   0  151  740   29  G  EGGGEE     GGGG G GGGG  GG   GGGGG GGGGGE    GGGG     GGGGG  GGGG  
   152   43 B K    <   +     0   0  121  740   37  K  KKKKKK     KKKK K KKKV  KK   KKKKK KKKKKK    KKKK     KKKKK  KKKK  
   153   44 B R        -     0   0  113  739   42  G  GGGARG     GGGG G GGED  GG   AGGGG GGAGGG    AGAA     GGGEQ  GGGG  
   154   45 B L  E     -O  148   0E   9  740   13  L  LLLLLL     LLLL L LLQR  LL   FLLLL LLLLLL    LLLL     LLLRR  LLLL  
   155   46 B E  E     -O  147   0E  44  739    4  E  EEEEEE     EEEE E EQEE  EE   EEEEE EQZEEE    EEEE     EDEEE  EEEE  
   156   47 B W  E     +O  146   0E  15  739   11  W  WWWWLW     WWWW W WWFA  WW   WWWWW WKWWWW    WWWW     WWWSL  WWWW  
   157   48 B V  E     -     0   0E   0  739   28  V  VIILVV     VVVV V VVVV  VV   VVVVV VVVVVV    LVLL     VVVVV  VVLV  
   158   49 B A  E     -O  145   0E   0  740   36  A  AGGGAS     SAGS A GAAA  AA   SAAAS GASAAA    GAGG     SASAA  AACS  
   159   50 B S  E     -OQ 144 168E   0  740   94  L  EEEFAS     YVRL V RFRA  GV   YYYIL FYAVVE    FRFF     YLGAI  VYRL  
   160   51 B I  E     -OQ 143 167E   4  739   18  I  IIIIII     IIII I IIII  II   ITTII IFIIII    IIII     IIIIA  IIMI  
   161   52 B N    >   -     0   0   47  740   85  S  RNNRNN     SSKS A KSRS  SS   NSSWS RNYSWR    RRRR     SSSNH  SSNS  
   162   53 B N  T 3  S+     0   0   65  740   86  N  LPPNSW     SYSG S SYWW  SP   GYYNP NDRYYL    NSNN     SYWWL  YSPS  
   163   54 B G  T 3  S-     0   0   65  740   68  G  KDDKDN     SDKD D KDSS  DD   GGGDS KAGBNK    KKKK     SDNDS  DDDD  
   164   55 B G  S <  S+     0   0   30  740   50  G  SSSAGG     GGTG G AGGG  GE   GDDGG ALGGGS    ASAA     GGSSG  GGGG  
   165   56 B G  S    S+     0   0   74  739   59  S  gSSnGE     fSdG N dTGD  RN   GggSG nSTBSh    nnnn     fSGAL  SsSs  
   166   57 B R        +     0   0  163  548   85  .  aTTtSN     tNtS N tNTN  KS   TppQS tA.BRa    tatt     tTSR.  NyTy  
   167   58 B T  E     -Q  160   0E  62  724   48  T  TIITTL     KKTT D TIST  KQ   AIIKT AQTKTT    TTTT     KQITL  KITI  
   168   59 B Y  E     +Q  159   0E  53  723   87  Y  HNNEYY     YYDY Y DEYY  KY   YHSYY EGYYYH    EYEE     YYGYT  YSHY  
   169   60 B Y        -     0   0   44  737    7  Y  YYYYYY     YYYY Y YHYY  YY   YYYYY YYYYYY    YYYY     YYYYY  YYYY  
   170   61 B P    >>  -     0   0   20  737   66  A  ATTSPA     AAAA I AAAV  VG   AAAAA AAAAGA    SASS     AAAAA  AAAA  
   171   62 B D  T 34 S+     0   0  148  739   65  N  EPPADD     DDAD D AENS  DD   SAADD ADDBDE    ADAA     DGDSD  DANA  
   172   63 B T  T 34 S+     0   0   90  739   62  S  SFSSTS     SSPS S PSSS  SS   SSSSS SASSSS    SSSS     SSSSS  SSSS  
   173   64 B V  T X> S+     0   0    1  740   43  V  VLLVMV     VVVV L VVVV  VV   VVVVV VVVVVV    VVVV     VVVVV  VVVV  
   174   65 B K  B 3< S+l  177   0C 142  739   35  K  KKKKEK     KKKK K KREK  KK   KKKKK KKKKKK    KKKK     KKKRK  KKKK  
   175   66 B G  T 34 S+     0   0   74  739   36  G  GDDGRG     GGGG G GGGG  GG   GGGGG GGGGGG    GDGG     GGGGG  GGGG  
   176   67 B R  T <4 S+     0   0   36  739   21  R  RKKRRR     RRRR R RRRR  RR   RRRRR RRRRRR    RRRR     RRRRR  RRRR  
   177   68 B F  E  <  -lM 174 192C   2  740   67  F  FFFFFF     FFFF F FFFF  FF   FFFFF FFFFFF    FFFF     FFFFF  FFFF  
   178   69 B T  E     - M   0 191C  79  740   38  T  TIITIT     TTTT T TTTT  TT   ITTTT TTTTTT    TTTT     TTTTT  TTTT  
   179   70 B I  E     + M   0 190C   5  740   22  I  IIIIII     IIII I IIII  II   TIIII IIIIII    IIII     IIIIV  IIII  
   180   71 B S  E     - M   0 189C  51  736   45  S  SSSSSS     SSSS S SSSS  SS   SSSSS SSSSSS    SSSS     SSSSS  SSSS  
   181   72 B R  E     - M   0 188C  30  739   68  K  RRRRRR     RRRR R RRRR  RR   RRRRR RKRRRR    RRRR     RRRRR  RRRR  
   182   73 B D  E > > - M   0 187C  60  738    5  D  DDDDDD     DDDD D DDDD  DD   DDDDD DDDDDD    DDDD     GDDDD  DDDD  
   183   74 B N  G > 5S+     0   0   48  739   59  N  DNNNNN     NNDN N DNNN  KN   NNNNN DNDBND    NDNN     NNNNN  NNNN  
   184   75 B A  G 3 5S+     0   0   99  739   41  G  SAASTG     ASSS S SSAA  SS   AAAAA SASSSS    SSSS     ASAAA  SAAA  
   185   76 B K  G < 5S-     0   0  111  740   54  K  KKKQKD     KKKK N KKKK  KK   KKKKK KKRKKK    QQQQ     KKKKK  KKKK  
   186   77 B N  T < 5 +     0   0   62  740   46  N  SNNSKN     DNNN N NNNN  NN   NNNNN NDBBRS    SSSS     DNNKN  NNNN  
   187   78 B T  E   < -KM 132 182C  16  740   68  S  STTITT     STTS T TITT  TT   MTTTM SSTTTS    IMII     STSTT  TTMT  
   188   79 B L  E     -KM 131 181C   0  737   61  L  VLLLLL     LLLL L LLMV  LV   LLLLV LLVLLV    LLLL     LLLVV  LLLL  
   189   80 B Y  E     -KM 130 180C  41  737   41  Y  YFYYYY     FYYY Y YFYY  YY   YYYHY YYYYYY    YYYY     FYYYY  YYYY  
   190   81 B L  E     -KM 129 179C   0  739    8  L  LLLLLL     LLLL L LLLL  LL   LLLLL LLLLML    LLLL     LLLLL  LLLL  
   191   82 B Q  E     -KM 128 178C  76  739   41  Q  QQQQQQ     QQQQ Q QQQQ  QQ   QQQQQ QQQQZQ    QQQQ     QQQQQ  QQQQ  
   192   83 B M  E     +KM 127 177C   0  740   11  M  MMMMMM     MMMM L MMMM  MM   MMMMM MMMMMM    MMMT     MMMMM  MMMM  
   193   84 B S        +     0   0   42  740   54  S  NSSNSN     HNNN S NNNN  NN   NSSNS SNBNNN    NNNN     HTNNH  NSNS  
   194   85 B S  S    S-     0   0   68  739   23  S  NKKTSN     SSSS S SSKS  SS   SSSSS GSSSSN    TNTT     SSSSS  SSSS  
   195   86 B L        -     0   0    3  740   16  L  LVVLLL     LLLL L LLLL  LL   LLLLL LLLLLL    LLLL     LLLLL  LLLL  
   196   87 B K    >   -     0   0  102  740   70  R  RRRRRR     RRKR R KRKK  RR   RRRRR KRRRRR    RKRR     RRRKK  RRRR  
   197   88 B S  G >  S+     0   0   70  740   59  A  ASSASV     AATA I TIPP  AA   AAAAA TAAATA    ATAA     AVAPP  AAAA  
   198   89 B E  G 3  S+     0   0  126  740   21  E  EEEEEE     EEEE E EAEQ  EE   EEEQE EEEEEE    EEEE     EEEEE  EDEE  
   199   90 B D  G <   +     0   0    2  740    3  D  DDDDDD     DDDD D DDDD  DD   DDDDD DDDBDD    DDDD     DDDDD  DDED  
   200   91 B T    <   +     0   0   32  740   32  T  TTTSTT     TTTT T TTTT  TT   TTTST TTTTTT    STSS     TTTTT  TTTT  
   201   92 B A  E    S- R   0 223E   8  737    4  A  GAAAAA     AAAA A AAAA  AA   AAAAA AAAAAA    AAAA     AAAAA  AAAA  
   202   93 B M  E     -PR 148 222E  58  739   46  V  ILLTLM     VVVL V VVVV  VL   VVVMV VVVVVI    TMTT     VVLVV  VVMV  
   203   94 B Y  E     -PR 147 221E   0  739    1  Y  YYYYYY     YYYY Y YYYY  YY   YYYHY YYYYYY    YYYY     YYYYY  YYYY  
   204   95 B Y  E     -P  146   0E   7  740    4  Y  YFYYYF     YYYY Y YYTY  YY   YYYYY YYYYYY    YYYY     YYYTY  YYYY  
   205   96 B d  E     -P  145   0E   0  740    0  C  CCCCCC     CCCC C CCCC  CC   CCCCC CCCCCC    CCCC     CCCCC  CCCC  
   206   97 B V  E     -PS 144 217E   0  740   24  A  TAAAAA     AATA A NAAA  AA   TAAAA TAAAAS    AVAA     AAAGN  AAAA  
   207   98 B R  E     -PS 143 216E  21  739   39  r  rRrrrk     rktk r yRlv  kk   tRRrr RPRrrT    RnRR     rkkaR  krRR  
   208   99 B H  E     + S   0 214E   6  629   94  v  ..lymf     faiy v s.sd  as   n.Yrv ...yl.    .dYY     fvlg.  sk..  
   209  100 B E  E  >  + S   0 213E  63  676   73  A  ..LPAT     GAPD T SEGG  GS   GDTDA H..GT.    .GGG     GGLG.  QGDD  
   210  101 B Y  T >4 S-     0   0   80  702   91  L  .NRYWD     VTTR T GISW  GH   YTQKL T.DBA.    VTTT     VYWTA  GLTT  
   211  102 B Y  T 34 S-     0   0  140  709   44  L  .wYYFI     HFYF H YYFW  FF   WQQFL YWLYF.    lFYY     HyFWY  YWVQ  
   212  103 B Y  T 34 S+     0   0   39  264   90  L  gv...L     ..V. . LGY.  ..   .VV.L ..AR..    r.YY     .aG.G  .GRV  
   213  104 B A  E <<  -S  209   0E   0  447   85  A  VG.A.P     ..T. T SDQ.  ..   .QQ.A TQAASG    A.GG     .GE.N  .PGQ  
   214  105 B M  E     +S  208   0E   0  580   59  E  PFFM.F     F.V. F RSV.  .L   ALL.E FFAFFF    M.MM     FIL.P  FSRL  
   215  106 B D  E     +     0   0E  19  696   48  D  DDDDAE     DDDD D DTDD  DD   SEEHD KERNDA    DAGD     DDLDT  DGNE  
   216  107 B Y  E     -S  207   0E  99  702   57  M  YYVYYK     YYYI I LNYY  IS   YVVTM TYLYYY    YYYY     YYNSY  YTLV  
   217  108 B W  E     -S  206   0E  23  731    0  W  WWWWWW     WWWW W WWWW  WW   WWWWW WWFWWW    WWWW     WWWWW  WWWW  
   218  109 B G        -     0   0    0  714   13  A  GGGGGG     GGGG G GGGG  GG   GSSTA SGGGGG    GGGG     GGGGG  GGTA  
   219  110 B Q        -     0   0   91  701   38     QQAQQQ     QQQQ Q QQQQ  QQ   QGGK   QKQQQ    QQQQ     QQQQK  QWPG  
   220  111 B G        -     0   0   16  687   10     GVGGGG     GGGG G GGGG  GG    SSG   GGGGG    GGGG     GGGGG  GGDS  
   221  112 B T  E     -R  203   0E  21  675   26     TTTTTT     TTTT T TTTT  TT    CCR   TTTVT    TTTT     TTTTT  TSSC  
   222  113 B T  E     -R  202   0E  72  661   75     TTTSLL     LLLM M  LQQ  ML    VVI   LTLLL    SLSS     LLLQL  LFAV  
   223  114 B V  E     -R  201   0E   0  654   18     LLVVVV     VVVV V  VVV  VV    VVL   VVVVV    VVVV     VVVVV  VLLV  
   224  115 B T  E     -n  120   0D  36  643   13     TTTTTT     TTTT T  TTT  TT    SS    TTTTT    TTTT     TTTTT  TGTS  
   225  116 B V  E     +n  121   0D   6  626    6     VVVVVV     VVVV V  VVV  VV    SS    VVVVV    VVVV     VVVVV  VT S  
   226  117 B S        -     0   0   36  616    5     SSSSSS     SSSS S  SSS  SS    SS    SSSS     SSSS     SSSSS  SA S  
   227  118 B S  S    S+     0   0   84  597   20     SSSSAS     SSSS S  SSS  SS          SSSS     SASS     SSSSS  SS    
   228  119 B A  S    S+     0   0   70   97   58          V          G       A                              AG          
   229  120 B W        -     0   0  123   87   40          D          S                                      SS          
   230  121 B R        +     0   0  207   62   76          P          R                                       R          
   231  122 B H              0   0  156   56   69          N                                                             
   232  123 B P              0   0  155   28   53          S                                                             
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    1 A D              0   0  183  423   16  D DDDDDD D     D   D     D       D D D           DDDDD    D      D  DD
     2    2 A I        -     0   0   32  466   12  PIIIIIIIII     I  II     I       I III           IIIII  I I    F IIIII
     3    3 A E        -     0   0  117  468   68  VRQQQQQQQQ     M  ZQ     Q      EQ QQQ           QQQQQ  Q Q    E QQVQQ
     4    4 A L  E     -A   25   0A  10  482    7  LMMMMMMMMM     M  MM     M      MM MMM           MMMMM  L M    MLMMLMM
     5    5 A T  E     -A   24   0A  64  482    8  TTTTTTTTTT     T  TT     T      TT ITT           TTTTT  T T    TTTTSTT
     6    6 A Q  E     -A   23   0A  13  482    0  QQHQQQQQQQ     Q  QQ     Q      QQ QQQ           QQQQQ  Q Q    QQQQQQQ
     7    7 A T  E    S+A   22   0A  64  482   35  TSSSSSSSSS     S  SS     S      TP TSS           SSSSS  S S    TTSSSSS
     8    8 A P        -     0   0   46  485    9  PPPPPPPPPP     P  PP     P      PP PPP           PPPPP  P P    PPPPPPP
     9    9 A V  S    S+     0   0   96  489   67  SSPSSSSSSS     S  SS     S      SS SSS           SSSSS  A S    SSVSASS
    10   10 A S  E     -d  104   0B  60  491   42  SSSSSSSSSS     S  SS     S      SS SSS           SSSSS  S S    SPISSSS
    11   11 A L  E     -d  105   0B  58  494   23  VLLLLLLLLL     L  LL     L      VL LLL           LLLLL  L L    VVLLLLL
    12   12 A S  E     +d  106   0B  60  495   42  SSSSSSSSSS     S  SS     S      SS PSS           SSSSS  A S    SSSPSSS
    13   13 A A  E     -d  107   0B   0  495   58  EAAAAAAAAA     A  AA     A      EA AAA           AAAAA  A A    EAAAGAA
    14   14 A S    >   -     0   0   47  496   31  PSSSSSSSSS     S  SS     S      PS SSS           SSSSS  S S    PASSSSS
    15   15 A V  T 3  S+     0   0   76  496   66  VTLVVVLLVV     P  VV     V      VV VVV           VVVVV  L V    VVLTSVV
    16   16 A G  T 3  S+     0   0   42  496    5  GGGGGGGGGG     G  GG     G      GG GGG           GGGGG  G G    GGGGGGG
    17   17 A E    <   -     0   0   71  496   36  GDEDDDDDDD     D  DD     D      GD DDD           DDDDD  D D    GGEDEDD
    18   18 A T        -     0   0   69  496   62  TRTTTRTTRR     R  RR     R      TR TTR           RRRRR  T R    TTSRRRR
    19   19 A V  E     - B   0  75A  11  496   36  VVVVVVVVVV     V  VV     V      VV VVV           VVVVV  V V    VVVVVVV
    20   20 A T  E     - B   0  74A  67  495   29  TTTTTTTTTT     T  TT     T      TT TTT           TTTTT  S T    TTTTTTT
    21   21 A I  E     - B   0  73A   1  494   17  IIIIIIIIII     I  II     I      II IIV           IIIII  I I    IIIIIII
    22   22 A T  E     -AB   7  72A  29  494   59  KTTTTTTTTT     T  TT     T      KS KTT           TTTTT  T T    KKTTSTT
    23   23 A b  E     -AB   6  71A   0  495    1  CCCCCCCCCC     C  CC     C      CC CCC           CCCCC  C C    CCCCCCC
    24   24 A R  E     -AB   5  70A 110  495   47  QRKRRRRRRQ     R  RR     R      QQ KRR           QQQQR  R R    QQQQKRR
    25   25 A A  E     -A    4   0A  10  495   28  AAAAAAAAAA     A  AA     A      AA AAA           AAAAA  A A    ATSAAAA
    26   26 A S  S    S+     0   0   66  495    4  SSSSSSSSSS     S  GS     S      SS SGS           SSSSG  S S    SSSSSSS
    27   27 A E  S    S-     0   0  101  495   38  EQQQQQQQQQ     Q  QQ     Q      QQ QQQ           QQQQH  Q Q    QQQQEQQ
    28   28 A N        +     0   0   83  495   45  DGSGGGGGGD     N  SD     G      SS GSG           DDDDN  S G    SSSGNGG
    29   29 A I    >   -     0   0    5  496   32  IIIIIIIIII     I  VI     I      II III           IIIII  I I    IIIIVII
    30   30 A Y  T 3   -     0   0  155  496   81  YSSSSNSSSS     N  NT     S      YY SYN           NSIRT  N S    YYYGYSS
    31   31 A S  T 3  S+     0   0   53  471   64  SSTNSHKKNN     S  KN     N      SN NNK           HDKKN  K S    SSTSSND
    32   32 A Y    <   +     0   0   63  495   53  LYWYYYYYEY     W  YY     W      YY VVE           YYYHF  W Y    YYYYNWY
    33   33 A L  E     -E   90   0B   0  495    7  LLLLLLLLLL     L  LV     L      LL LLL           LLLLL  L L    LLLLLLL
    34   34 A A  E     -E   89   0B   0  495   71  AAAAASNNSN     A  NN     A      SN NAS           NNNNS  A A    SAANHAS
    35   35 A W  E     -EF  88  48B   1  496    0  WWWWWWWWWW     W  WW     W      WW WWW           WWWWW  W W    WWWWWWW
    36   36 A Y  E     -EF  87  46B   0  496    8  YYYYYYYYYY     Y  YF     Y      YY YYY           YYYYY  Y Y    YYYYYYY
    37   37 A Q  E     -EF  86  45B   7  496   27  QQQQQQQQQQ     Q  QQ     Q      QQ QQQ           QQQDQ  Q Q    QQQQQQQ
    38   38 A Q  E     -E   85   0B  21  496    4  QQQQQQQQQQ     Q  QQ     Q      QQ QQQ           QQQQQ  Q Q    QQQQQQQ
    39   39 A K    >   -     0   0   51  495    8  KKKKKKKKKK     K  KR     K      KK KKK           GKTKK  Q K    KKKKKKK
    40   40 A Q  T 3  S+     0   0  190  496   18  PPPPPPPPPP     P  PP     P      PP PPP           PPPPP  A P    PPPPPPP
    41   41 A G  T 3  S+     0   0   86  496   10  GGGGGGGGGG     G  GG     G      GG GGG           KGGGG  G G    GGGGGGG
    42   42 A K  S <  S-     0   0  126  495   54  QKKKKKKKQK     Q  KQ     K      QK NKK           KKKKK  K K    QQEKQKK
    43   43 A S        -     0   0   21  495   56  PASAAASSAA     A  AA     A      PA APA           AAAAA  A A    PPHSAAA
    44   44 A P        -     0   0    4  495   10  PPPPPPPPPP     P  PP     P      PP PPP           PPPPP  P P    PPPPPPP
    45   45 A Q  E     -F   37   0B  74  495   32  KKKKKKKKTK     K  KK     K      KK QKT           KKKRT  K K    KKKKRKK
    46   46 A F  E     +F   36   0B  25  495   41  LLLLPPLLLL     L  VV     L      LF LLL           ILLLL  L L    LLLLLLL
    47   47 A L  E     +     0   0B   4  495    9  LLLLLLLLLL     L  LL     L      LL LLL           LLLLL  L L    LLLLLLL
    48   48 A V  E     -FG  35  54B   0  496    5  IITIIIIIII     I  II     I      IT III           IIIII  I I    IIIIIII
    49   49 A Y  E >> S+ G   0  53B  39  496   17  YYYYYYYYYY     Y  FY     Y      YY YYY           YYYYY  Y Y    YYYYYYY
    50   50 A N  T 34 S-     0   0   52  496   91  SAGAYYYDAD     K  AG     R      ER DGA           DDEGA  S A    EEAYDRA
    51   51 A A  T 34 S+     0   0    3  496   44  AAAAAATTAA     A  AA     A      AA ATA           AAAAV  A A    AAAAAAA
    52   52 A K  T <4 S+     0   0  148  496   25  SSSSSSSSSS     S  SS     S      SS TSS           SSSSS  S S    SSSSSSS
    53   53 A T  E  <  -G   49   0B  47  496   68  TTTSNSNNSN     S  SI     N      KS NNS           NNNTN  T S    KTNYNNS
    54   54 A L  E     -G   48   0B  60  496   59  LLLLLLLLLL     L  LL     L      LL LLL           LLLLL  L L    LLLLLLL
    55   55 A G    >   -     0   0    9  495   70  AQQQEEEAQE     E  KE     E      AQ GAQ           EEQEQ  Q Q    AAAQAEQ
    56   56 A E  T 3  S+     0   0  192  495   35  SSSSSTTTST     S  ST     T      SR FTT           TSATV  S S    SSDSSTS
    57   57 A G  T 3  S+     0   0   70  496    5  GGGGGGGGGG     G  GG     G      GA GGG           GGGGG  G G    GGGGGGG
    58   58 A V    <   -     0   0   25  494   10  VVVVVVVVVV     V  VV     V      VM VVV           VVVVV  V V    VVIIVVV
    59   59 A P    >   -     0   0   47  495    7  PPPPPPPPPP     P  PP     P      PP PPS           PPPPP  P P    PPPPPPP
    60   60 A S  T 3  S+     0   0  115  496   56  SSSSSSSSSS     S  SS     S      SS SSS           SSSSS  S S    SSSSASS
    61   61 A R  T 3  S+     0   0   44  496    4  RRRRRRRRRR     R  RR     R      RQ RRR           RRRRR  R R    RRRRRRR
    62   62 A F  E <   +C   75   0A   5  496    1  FFFFFFFFFF     F  FF     F      FF FFF           FFFFF  F F    FFFFFFF
    63   63 A S  E     -C   74   0A  55  495   23  KSKSSSSRSS     S  SS     S      SS SRS           SSSSS  K S    SSSSSSS
    64   64 A G  E     +C   73   0A  13  496    2  GGGGGGGGGG     G  GG     G      GG GGG           GGGGG  G G    GGGGGGG
    65   65 A S  E     +C   72   0A  63  496    6  SSSSSSSSSS     S  SS     S      SS SSS           SGSSS  S S    SSSSSSS
    66   66 A G  E     -C   71   0A  36  496   14  GGGGGGGGGG     G  GG     G      GG GGG           GGGGG  G G    GGGGRGG
    67   67 A S  E >   +C   70   0A  79  496    9  SSSSSSSSSS     S  SS     S      SY FSS           FSSSS  S S    SSSSSSS
    68   68 A G  T 3  S-     0   0   16  496   12  GGEGGGGGGG     G  GG     G      GG GGG           GGGGG  G G    GGGGGGG
    69   69 A T  T 3  S+     0   0   67  495   13  TTTTTTTTTT     T  TT     T      TR KTT           TATTA  T T    TTTTTAT
    70   70 A Q  E <   +BC  24  67A 110  496   29  QEDDEDDDDD     D  DD     D      ED DDD           DHDDE  D D    EQQDADD
    71   71 A F  E     -BC  23  66A   2  494    5  FFFFFYYFFF     Y  FF     F      FF FYF           FFYFF  F F    FFFFYFF
    72   72 A S  E     -BC  22  65A  26  495   30  TTTTTTSSTT     T  TT     T      TT TST           TTTTT  T T    TTSTTTT
    73   73 A L  E     -BC  21  64A   0  496    2  LLLLLLLLLF     F  LF     L      LL LLL           FFFLL  L L    LLLLLLL
    74   74 A K  E     -BC  20  63A  97  496   38  TTTTTTTTTT     T  TT     T      TT ATT           TTTTT  T T    TTKTTTT
    75   75 A I  E     -BC  19  62A   0  496    1  IIIIIIIIII     I  II     I      II III           IIIII  I I    IIIIIII
    76   76 A N  S    S-     0   0   86  496   29  SSSSSSSSSS     S  SS     S      SS SSS           SSSSS  S S    SSNDSSS
    77   77 A S  S    S-     0   0   58  496   62  DCSSSSGGSS     S  GS     S      DS SGS           GSSTS  G S    DGNCSSS
    78   78 A L        -     0   0    0  496   27  LLLLLLLLLL     M  LL     L      LL LLL           LLLLL  L L    LVLLLLL
    79   79 A L    >   -     0   0   67  496   31  EQEQQQQQQQ     E  LQ     Q      EQ QEQ           QQQQQ  Q Q    EQQQEQQ
    80   80 A P  G >  S+     0   0   92  496   59  CSAPPPAAPP     P  PP     P      CP PAP           PPPPP  A P    CCPPPPP
    81   81 A E  G 3  S+     0   0  102  496   15  DEEEEEEEEE     E  EE     E      AE EEE           EEEEE  E E    ADEEEEE
    82   82 A D  G <  S+     0   0    1  496    5  DDDDDDDDDD     D  DD     D      DD DDD           DDDDD  D D    DDDDDDD
    83   83 A F    <   +     0   0   29  495   73  AFSFFIIVVI     A  FI     I      AF VVV           IIIIF  V F    AAVFAIF
    84   84 A G  E    S- H   0 105B  17  496   23  AAGAAAAAAA     A  AA     A      AA AGA           AAAGA  A A    AAAAAAA
    85   85 A S  E     -EH  38 104B  24  496   62  TTITTTDDTT     T  TT     T      TT TNT           TTTNT  T T    TTNTHTT
    86   86 A Y  E     -EH  37 103B   0  496    0  YYYYYYYYYY     Y  YY     Y      YY YYY           YYYYY  Y Y    YYYYYYY
    87   87 A Y  E     -E   36   0B   5  495    4  YYYYYYYYYY     Y  YY     Y      YY YYY           YYYYY  Y Y    YYYYYYY
    88   88 A b  E     -E   35   0B   0  496    0  CCCCCCCCCY     C  CC     C      CC CCC           CCCCC  C C    CCCCCCC
    89   89 A Q  E     -EI  34  99B   0  494   48  QQQQQQELLQ     Q  QQ     Q      QQ QQQ           QQQQQ  Q Q    QAQEQQQ
    90   90 A H  E     -E   33   0B  22  486   28  NQQQQQQQQQ     Q  QQ     Q       Q HQQ           QQQQQ  Q Q     GQQQQQ
    91   91 A H        +     0   0    0  423   89  NYYHYY YD         S.     H         VGD           ....N  H Y     GCS HH
    92   92 A Y  S    S+     0   0  104  454   87   YDNNN  Y         YY     D         YSY           YYYYY  H N     YYY DN
    93   93 A G  S    S-     0   0   34  421   71   SNSSN  T         TD     N         GSS           DDQDN  S S     SSG NS
    94   94 A T  S    S-     0   0  104  444   88   YSNAS  T         TT     S         TYY           TYSNF  A N      NT SY
    95   95 A P  S    S+     0   0    7  441   51   PPPPP  P          L     P         PPP           LLLVS  P P      PP PP
    96   96 A P  S    S-     0   0   55  420   76   P PP              P     P         P             PPPPF    P      PP PP
    97   97 A L        -     0   0   21  151   88   T ..              L     T         T             RWYI.    .      .T T.
    98   98 A T        -     0   0   40  278   41   V ..              T     V         V             TTTTT    .      .V V.
    99   99 A F  B     -I   89   0B  18  277   26   L ..              F     L         I             FFFFF    .      .L L.
   100  100 A G        -     0   0    3  285   38   H ..              G     Q         Q             GGGGG    .      .Q Q.
   101  101 A G        -     0   0   52  300   63   T ..              G     A         S             QQQQG    .      .G A.
   102  102 A G        -     0   0   11  300   41   Q ..              G     R         M             GGGGG    .      .S R.
   103  103 A T  E     - H   0  86B   0  360   19   T TT              T     T         T             TTTTT    .      T  TT
   104  104 A K  E     -dH  10  85B  98  359   60   K VV              K     Q         K             KKKRK    T      V  QV
   105  105 A L  E     -dH  11  84B   4  343   39     LL              V                             LVLVV    V      I   L
   106  106 A E  E     -d   12   0B 108  326   52     HH              D                             EEQED    Q      Q   H
   107  107 A I  E      d   13   0B 113  295   51     TT              I                             IIINN    M      V   T
   108  108 A K              0   0  145  261   18     RR              K                             KK KK               R
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30            EQEEE     QEQQ  QQEE E  E   EEEEEE             D E EE       
   111    2 B V        +     0   0   19  428   12            VVVVV     VVVVV VVVV E  V   LVVVVVVV        V  V VMVE       
   112    3 B K  E     -J  134   0C 111  430   32            QQQKK     HQQKQ QQQQ Q  K   QQQKKKQQ        Q  Q QQQQ       
   113    4 B L  E     -J  133   0C   3  452    1            LLLLL     LLLLL LLLLLL  L   LLLLLLLL        L  L LLLL       
   114    5 B Q  E     -J  132   0C  83  454   70            VVVEE     KVQLV VVVVVV  V   VVLEEEVV        V  V VVVV       
   115    6 B E  E     +J  131   0C   5  458   22            EDEEE     EEEEE EEEEEE  E   EEEEEEEE        E  E EEEE       
   116    7 B S  E     +J  130   0C  69  463   14            SSSSS     TSSSS SSSSSS  S   SSSSSSSS        S  S SSSS       
   117    8 B G        +     0   0   36  467    4            GGGGG     GGGGG GGGGGG  G   GGGGGGGG        G  G GGGG       
   118    9 B G        +     0   0   29  718   50            GGGGG GG  GGGGG GGGGGG  G   GGGGGGGGGGG     G  G GGGG       
   119   10 B D        -     0   0   96  725   42            GGGGG GG  GGGGT GGGSGG  N   GGGGGGGGGGG     G  D GGGG       
   120   11 B L  E     +n  224   0D  79  727   14            LLLLL LL  LVLVL VVLLLL  L   LLLLLLLLLLL     V  L LLLL       
   121   12 B V  E     -n  225   0D  16  729   31            VVVVV VV  VVVVV VVVVVV  G   VVVVVVQQVVV     V  R VVVV       
   122   13 B Q    >   -     0   0  114  730   53            QEQQQ QQ  QQQQQ QQPQPQ  Q   QQQQQQQQQQQ     Q  Q QPPQ       
   123   14 B P  T 3  S+     0   0   66  730    7            PPPPP PP  PPPPP PPPPPP  P   PPPPPPPPPPP     P  P PPPP       
   124   15 B G  T 3  S+     0   0   58  734   31            GGGGG GG  GGKGG GGGGGG  G   GGGGGGGGGGG     G  G GGGG       
   125   16 B G    <   -     0   0   25  736   63            GGGGG GG  RRGRG RRGGGG  G   GSGGGGGGGGG     R  G GGGG       
   126   17 B S        +     0   0   78  735   29            SSSSS SS  SSSSS SSSSSS  S   C.SSSSSSSSS     S  S SSSS       
   127   18 B L  E     - K   0 192C  25  737   28            LLLMM LL  LLMLL LLLLLL  L   LLLMMMLLLLL     LL L LLLL       
   128   19 B K  E     - K   0 191C  93  735   55            RRRKK RR  KRKRR RRRTRR  R   KRRKKKRRRRR     RR R RRRR       
   129   20 B L  E     - K   0 190C   0  740   16            LLLLL LL  LLLLL LLLLLL  L   LLLLLLLLLLL     LL L LLLL       
   130   21 B S  E     -JK 116 189C  28  740   37            SSSSS SS  SSSSS SSSASS  S   SFSSSSSSSSS     SF S SSPS       
   131   22 B d  E     -JK 115 188C   0  740    0            CCCCC CC  CCCCC CCCCCC  C   CCCCCCCCCCC     CC C CCCC       
   132   23 B A  E     -JK 114 187C  52  740   67            ASAVV AA  VAAEA AASAAA  V   AAAVVVEKAAA     AA K AAAA       
   133   24 B A  E     +J  113   0C   8  740   48            TAAAA TT  AAAAA AAGAAA  A   AAAAAAAGTTT     AA A AAAA       
   134   25 B S  E     +J  112   0C  58  740   14            SSSSS SS  SSSSS SSSGSS  S   SSSSSSTSSSS     SS S SSSS       
   135   26 B G  S    S+     0   0   56  739    3            GGGGG GG  GRGGG GGG.GG  G   GGGGGGGGGGG     GG G GGGG       
   136   27 B F  S    S-     0   0   33  740   31            FFFFF FF  FFFFF FFFFFF  F   FFFFFFFFFFF     FF F FFFF       
   137   28 B T    >   -     0   0   93  740   53            TTTTT TT  TTNTT TTTTTT  T   TTTTTTTDTTT     PT S TTTS       
   138   29 B F  G >  S+     0   0    2  740   28            FFFFF FF  FFFSL FFFFFF  F   FFFFFFFFFFF     FF F FFFF       
   139   30 B S  G 3  S+     0   0   57  740   55            SSSSS TT  SSNRS SSSSSS  D   SSSSSSSSTTT     NS S GSSR       
   140   31 B S  G <  S+     0   0   71  740   57            NAYNN DD  SNIDR TTSDSS  D   NSTNNNSSDDD     TD s SSGS       
   141   32 B Y  S <  S-     0   0   44  738   42            YNYYY YY  YYNYY YYYYYY  Y   YSYYYYFFYYY     YY y YYYY       
   142   33 B T        -     0   0   30  739   92            WDNWW YY  WGAGD AASWYW  G   REVWWWARYYY     GY G TWWP       
   143   34 B M  E     -OP 160 207E   0  739   49            MMMMM MM  MMMMM MMMMMM  M   MMMMMMMLMMM     MM M MMIM       
   144   35 B S  E     -OP 159 206E   0  740   72            FNNNN SS  YHNNN HHDSSH  S   SNSNNNFGSSS     HS S HSSN       
   145   36 B W  E     +OP 158 205E   0  740    0            WWWWW WW  WWWWW WWWWWW  W   WWWWWWWWWWW     WW W WWWW       
   146   37 B V  E     -OP 156 204E   0  740   17            VVVVV VV  IVVVV VVVAVV  V   VVVVVVVVVVV     VI V VVAV       
   147   38 B R  E     -OP 155 203E  10  740   21            RRRRR RR  RRRRR RRRRRR  R   RRRRRRRRRRR     RR R RRRR       
   148   39 B Q  E     -OP 154 202E   9  740    4            QQQQQ QQ  QQQQQ QQQQQQ  Q   QQQQQQQQQQQ     QQ Q QQQQ       
   149   40 B T    >   -     0   0    9  739   74            AAVSS PP  AAAAA AAAAAA  A   AAASSSAAPPP     AA A AAAA       
   150   41 B P  T 3  S+     0   0   80  740   11            PPTPP PP  PPPPP PPPPPP  P   PPPPPPPPPPP     PP P PPPP       
   151   42 B E  T 3  S-     0   0  151  740   29            GGGEE GG  GGGGG GGGGGG  G   GGGEEEGEGGG     GG G GGGG       
   152   43 B K    <   +     0   0  121  740   37            KKKKK KK  KKRKK KKKKKK  K   KKKKKKKKKKK     KK K KKKK       
   153   44 B R        -     0   0  113  739   42            GGGGG AA  GGGGG GGGGGG  G   GGGGGGGGAAA     GG G GGKG       
   154   45 B L  E     -O  148   0E   9  740   13            LLLLL LL  LLLLL LLLLLL  P   LLLLLLLLLLF     LL L LLLL       
   155   46 B E  E     -O  147   0E  44  739    4            EEEEE EE  EEEEE EEEEEE  Q   EEZEEEEEEEE     EE E EEEE       
   156   47 B W  E     +O  146   0E  15  739   11            WWWWW WW  WWWWW WWWWWW  W   WWWWWWYPWWW     WW W WWWW       
   157   48 B V  E     -     0   0E   0  739   28            VLVVV LL  VVIVI VVVVVV  V   VVVVVVVVLLL     VV V ILVV       
   158   49 B A  E     -O  145   0E   0  740   36            SSSAA GG  SAAES AAASSA  S   SSGAAAAAGGG     AS A SGSA       
   159   50 B S  E     -OQ 144 168E   0  740   94            SFAEE FF  SARVY VVYDVY  S   YVAEEEEIFFF     GY I REDL       
   160   51 B I  E     -OQ 143 167E   4  739   18            IIIII II  IIIII IIIIII  I   IIIIIIIIIII     TI I IIII       
   161   52 B N    >   -     0   0   47  740   85            SGGRR RR  NSRLG SSSRSS  T   NSZRRRTSRRR     TS Y SNSS       
   162   53 B N  T 3  S+     0   0   65  740   86            GGTLL NN  TNSSG YYSSGG  G   STGLLLDLNNN     YS T SPGS       
   163   54 B G  T 3  S-     0   0   65  740   68            SSAKK KK  DDYDS DDADDG  D   DDLKKKGDKKK     DS S SDDG       
   164   55 B G  S <  S+     0   0   30  740   50            SGGSS AA  GGSGG AGSSSS  S   GGSSSSGGAAA     GG S GGSR       
   165   56 B G  S    S+     0   0   74  739   59            SSDhh nn  GSnSN NNNSRT  S   TRVhnhGSnnn     RS G GSSd       
   166   57 B R        +     0   0  163  548   85            ST.ae tt  SNeSV YYTTY.  N   .TSaaaS.ttt     IA N TTIn       
   167   58 B T  E     -Q  160   0E  62  724   48            TIQTT TT  TKTKI KKITT.  I   ATZTTTTTTTT     KI A ITTT       
   168   59 B Y  E     +Q  159   0E  53  723   87            YYYHH EE  YFYYS YYYYNY  Y   YYSHHHYYEEE     DY Y SNYY       
   169   60 B Y        -     0   0   44  737    7            YYYYY YY  YYYYY YYYYYY  Y   YYYYYYYYYYY     YY Y YYYY       
   170   61 B P    >>  -     0   0   20  737   66            PAAAA SS  PAVAS AAAAAA  T   AAAAAAAASSS     AA A AAAA       
   171   62 B D  T 34 S+     0   0  148  739   65            DDDEE AA  DDDDD DDNAAD  D   DDBEEEDDAAA     DD D ENAT       
   172   63 B T  T 34 S+     0   0   90  739   62            SSSSS SS  SSSSS SSSSSS  S   SSSSSSAASSS     SS S SASS       
   173   64 B V  T X> S+     0   0    1  740   43            VVVVV VV  VVVVV VVVVVV  V   VVVVVVVVVVV     VV V VVVV       
   174   65 B K  B 3< S+l  177   0C 142  739   35            KKKKK KK  KKKKK KKKKKK  K   KKKKKKQKKKK     KK K KKKK       
   175   66 B G  T 34 S+     0   0   74  739   36            GGGGG GG  GGDGG GGGGGG  G   GGGGGGGGGGG     GG G GGGG       
   176   67 B R  T <4 S+     0   0   36  739   21            RRRRR RR  RRRRR RRRRRR  R   RRRRRRRRRRR     RR R RRRH       
   177   68 B F  E  <  -lM 174 192C   2  740   67            FFFFF FF  FFFFF FFFFFF  F   FFFFFFFFFFF     FF F FFFF       
   178   69 B T  E     - M   0 191C  79  740   38            TTTTT TT  TTTTT TTTTTT  T   TTTTTTTTTTT     TT T TTTT       
   179   70 B I  E     + M   0 190C   5  740   22            IIIII II  IIIII IIIIII  I   IIIIIIIIIII     II I IIII       
   180   71 B S  E     - M   0 189C  51  736   45            SSSSS SS  SFSSS SSSSSS  S   SSSSSSSSSSS     SS S SSSS       
   181   72 B R  E     - M   0 188C  30  739   68            RRRRR RR  RRRRK RRIRRR  R   RRRRRRRRRRR     RR K RRRR       
   182   73 B D  E > > - M   0 187C  60  738    5            DNNDD DD  DDDDD DDDDDD  D   DDDDDDDDDDD     DD D DDDD       
   183   74 B N  G > 5S+     0   0   48  739   59            NBDDD NN  NNDNN NNNNNN  N   NNDDDDNNNNN     NN N NNNN       
   184   75 B A  G 3 5S+     0   0   99  739   41            ASSSS SS  ASSSA SSASTA  A   AASSSSGGSSS     SA A TAAA       
   185   76 B K  G < 5S-     0   0  111  740   54            KKKKK QQ  EKQMR KKKRKK  K   KKKKKKQQQQQ     KK N KKKK       
   186   77 B N  T < 5 +     0   0   62  740   46            NNNSS SS  NNSNN NNDNNN  N   NNNSSSSSSSS     NN S NNNN       
   187   78 B T  E   < -KM 132 182C  16  740   68            TSTSS II  TMMTS TTTTTM  T   SSTSSSTTIII     TT L TTTS       
   188   79 B L  E     -KM 131 181C   0  737   61            LLLVV LL  VMLLL LLLLLL  L   LL.VVVVLLLL     LL V LLLL       
   189   80 B Y  E     -KM 130 180C  41  737   41            YYYYY YY  YDYYY YYYYYD  Y   YY.YYYYYYYY     YY N SFYY       
   190   81 B L  E     -KM 129 179C   0  739    8            LLLLL LL  LLLLL LLLLLL  L   LL.LLLLLLLL     LL L LLLL       
   191   82 B Q  E     -KM 128 178C  76  739   41            QQNQQ QQ  QQQQQ QQQQQE  Q   QQ.QQRQQQQQ     QQ Q QQQQ       
   192   83 B M  E     +KM 127 177C   0  740   11            MMMMM MM  MMMMM MMMMMM  M   MMMMMMMMMMM     MM M MMMM       
   193   84 B S        +     0   0   42  740   54            NSNNN NN  NNNNN NNSNNS  N   NNNNNNNDNNN     NN N SKNG       
   194   85 B S  S    S-     0   0   68  739   23            SSSNI TT  SSNSS SSSSSS  W   SSSNNNSSTTT     SS S SSSS       
   195   86 B L        -     0   0    3  740   16            PLLLL LL  LLLLL LLLLLL  L   LLLLLLLLLLL     LL L LLLL       
   196   87 B K    >   -     0   0  102  740   70            RRRRR RR  RRKRR RRRRRR  T   RRRRRRKKRRR     RR K RRRR       
   197   88 B S  G >  S+     0   0   70  740   59            AAAAA AA  SATAA AAAVAT  R   AAAAAPAAAAA     LA T AAAS       
   198   89 B E  G 3  S+     0   0  126  740   21            EEEEE EE  EEEEE EEEEEQ  E   EEEEEEEEEEE     EE E EEED       
   199   90 B D  G <   +     0   0    2  740    3            DDDDD DD  DDDDD DDDDDD  D   DDDDDDDDDDD     DD D DDDD       
   200   91 B T    <   +     0   0   32  740   32            TTTTT SS  TTTTT TTTKTT  T   TTTTTTTPSSS     TT T SMTT       
   201   92 B A  E    S- R   0 223E   8  737    4            AAAGG AA  AAAAA AAAAAA  A   AAAGGGGAAAA     AA A AAAA       
   202   93 B M  E     -PR 148 222E  58  739   46            VVVII TT  TVITV VVVLVV  L   VVVIIITTTTT     VV L VVLL       
   203   94 B Y  E     -PR 147 221E   0  739    1            YYYYY YY  YYYYY YYYYYY  F   YYYYYYYYYYY     YY Y YYYY       
   204   95 B Y  E     -P  146   0E   7  740    4            YYYYY YY  YYYFF YYYYYY  Y   YYYYYYYYYYY     YY Y YYYY       
   205   96 B d  E     -P  145   0E   0  740    0            CCCCC CC  CCCCC CCCCCC  C   CCCCCCCCCCC     CC C CCCC       
   206   97 B V  E     -PS 144 217E   0  740   24            AAATT AA  AAVAA AAAVAA  A   AAATTTAVAAA     AA A AAAA       
   207   98 B R  E     -PS 143 216E  21  739   39            rRrTT Rr  KkRkr kkrrrr  i   rekTTTkrRRr     kk r rrkr       
   208   99 B H  E     + S   0 214E   6  629   94            r.w.. Da  .v.ly sspvil  s   yiv...cn.Da     lh e rgqt       
   209  100 B E  E  >  + S   0 213E  63  676   73            G.L.. GP  .GGYG QQGQPG  S   PGS...GDDGP     AH D GVTQ       
   210  101 B Y  T >4 S-     0   0   80  702   91            RGY.. NY  .TLYD GGNAMW  E   CVA...GIDTY     GH S IVSQ       
   211  102 B Y  T 34 S-     0   0  140  709   44            FWY.. YY  .YWyf YYLSYF  Y   VHY...CWWYY     PF W YWYV       
   212  103 B Y  T 34 S+     0   0   39  264   90            ..Y.. ..  ...hv ......  .   .......A...     .. . ....       
   213  104 B A  E <<  -S  209   0E   0  447   85            K.YGG ..  D..GR ......  C   ..YGGG.FY..     .. A ...Q       
   214  105 B M  E     +S  208   0E   0  580   59            ALGFF FF  CFFML FF..L.  F   .PFFFFIIFFC     .. A .A.L       
   215  106 B D  E     +     0   0E  19  696   48            FLSAA DD  SDADD DD..RP  L   .GBAAADVDDD     DD A HS.E       
   216  107 B Y  E     -S  207   0E  99  702   57            SNVYY YY  LYYVS YP.YTI  L   .FYYYYAAVVY     YY A CY.V       
   217  108 B W  E     -S  206   0E  23  731    0            WWWWW WW  WWWWW WWWWWW  W   WWWWWWWWWWW     WW W WWWW       
   218  109 B G        -     0   0    0  714   13            SGGGG GG  IGGGG GG GS       GGGGGGGGGGG     GG G LGGA       
   219  110 B Q        -     0   0   91  701   38            SQQQQ QQ  HQQQQ QQ QE       RRZQQQRRAAQ     LQ   LQKG       
   220  111 B G        -     0   0   16  687   10            GGGGG GG  IGGGG GG  G       GGGGGGGGGGG     GG   S  S       
   221  112 B T  E     -R  203   0E  21  675   26            GTTTT TT  QTTTT TT  T         TTTTTTTTT     TT   G  C       
   222  113 B T  E     -R  202   0E  72  661   75            ALLLL TT  LLTTL LL            LLLLSSTTT     LL   F  V       
   223  114 B V  E     -R  201   0E   0  654   18            QV VV LL  LVVVV VV            VVVVVVVVL     VV   I  V       
   224  115 B T  E     -n  120   0D  36  643   13            PT TT TT  DTTTT TT            TPTTTTTTT     TT   T  S       
   225  116 B V  E     +n  121   0D   6  626    6            VV VV VV  VVVVV VV            VVVVVVVVV     VV   L  S       
   226  117 B S        -     0   0   36  616    5            AS    SS  LSSSS SS            S SSSSSSS     S    T  S       
   227  118 B S  S    S+     0   0   84  597   20            PS    SS  DSSSS SS            S AASSSSS     S               
   228  119 B A  S    S+     0   0   70   97   58                      A                                                 
   229  120 B W        -     0   0  123   87   40                      R                                                 
   230  121 B R        +     0   0  207   62   76                                                                        
   231  122 B H              0   0  156   56   69                                                                        
   232  123 B P              0   0  155   28   53                                                                        
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    1 A D              0   0  183  423   16  DDDDDD     DDD   DDDDD  DD      DDDD  DD              DDDEED    DEDE  
     2    2 A I        -     0   0   32  466   12  TIIIII     III  VIIIII  II      IIII  II              IIIIII    IIII  
     3    3 A E        -     0   0  117  468   68  QQQQQQ     QQQ  EQQQQK  VQ      VQQQ  QQ              QKQQVQ    QQQV  
     4    4 A L  E     -A   25   0A  10  482    7  MMMMMM     MMM  LMMMMM  LM      MMVL  MM              MMMMLM    MMMM  
     5    5 A T  E     -A   24   0A  64  482    8  TTTTTT     TTT  TTTTTT  TT      TTTT  TT              TTTTTT    TTTT  
     6    6 A Q  E     -A   23   0A  13  482    0  QQQQQQ     QQQ  QQQQQQ  QQ      QQQQ  QQ              ZQQQQQ    QQQQ  
     7    7 A T  E    S+A   22   0A  64  482   35  SSSSSS     SSS  TSSSSS  ST      TTSS  ST              SSSSSS    TSSS  
     8    8 A P        -     0   0   46  485    9  PPPPPP     PPP  PPPPPP  PT      PPPP  QP              PPPPPS    TPPP  
     9    9 A V  S    S+     0   0   96  489   67  SSSSSS     SSS  ASSSSS  AS      SSST  SP              SSASGS    SSSA  
    10   10 A S  E     -d  104   0B  60  491   42  SSSSSS     SSS  STSSSS  IS      SSSS  SS              SSSSTS    SLST  
    11   11 A L  E     -d  105   0B  58  494   23  QLIVLL     VLV  VLLLLM  ML      VLLL  LL              LMLLLL    LLLL  
    12   12 A S  E     +d  106   0B  60  495   42  SSSSSS     SSS  ESSSSY  SS      SSSS  SS              SYSSSS    SSPS  
    13   13 A A  E     -d  107   0B   0  495   58  AAAAAA     AAA  AAAVAA  AA      AAAA  AA              AAAALA    AAAL  
    14   14 A S    >   -     0   0   47  496   31  SSSSSS     SSS  ASSSSS  SS      ASSS  SS              SSSSSS    SSSS  
    15   15 A V  T 3  S+     0   0   76  496   66  VVIVVV     VVV  VVVVVL  PL      VVVV  LL              VLLPPL    LPLP  
    16   16 A G  T 3  S+     0   0   42  496    5  GGGGGG     GGG  GGGGGG  GG      GGGG  GG              GGEGGG    GGGG  
    17   17 A E    <   -     0   0   71  496   36  DDEDDD     DDD  GDDDDE  ED      GDDD  DD              BEEDED    DDDE  
    18   18 A T        -     0   0   69  496   62  RTRRRK     RRR  TRRRRR  KR      TRRR  RT              RRIRRR    RRRT  
    19   19 A V  E     - B   0  75A  11  496   36  VVVVVV     VVV  VVVVVV  VV      VVVV  VV              VVVVAV    VVVA  
    20   20 A T  E     - B   0  74A  67  495   29  TTTTTT     TTT  TTTTTT  TT      TSTT  AT              TTTTTT    TTTT  
    21   21 A I  E     - B   0  73A   1  494   17  IIIIII     III  IIIIII  MI      IIII  II              IIIILI    IIII  
    22   22 A T  E     -AB   7  72A  29  494   59  TTSTTT     TTT  KTITTS  TS      KTTT  TT              TTTTSS    STTS  
    23   23 A b  E     -AB   6  71A   0  495    1  CCCCCC     CCC  CCCCCC  CC      CCCC  CC              CCCCCC    CCCC  
    24   24 A R  E     -AB   5  70A 110  495   47  QRRRRR     RRR  QRRQQK  RR      QKRQ  KR              RKQRRR    RRRR  
    25   25 A A  E     -A    4   0A  10  495   28  AAAAAA     AAA  AAAAAA  AA      AAAA  AA              AAAAAA    AAAT  
    26   26 A S  S    S+     0   0   66  495    4  SSSSSS     SSS  SSSSSS  SS      SSSS  SS              SSSSSS    SSSS  
    27   27 A E  S    S-     0   0  101  495   38  QQQQQQ     QQQ  QQQQQQ  SQ      EEQQ  HQ              ZQQQQQ    QQQQ  
    28   28 A N        +     0   0   83  495   45  SGGGGG     SSS  BSGNDD  SD      NDGG  NG              TDDNSD    DNDS  
    29   29 A I    >   -     0   0    5  496   32  LIIIII     III  IIIVII  VI      IIII  II              IIIVVI    IAIV  
    30   30 A Y  T 3   -     0   0  155  496   81  SSNSSS     SSS  YNRNSN  sS      YFSS  NS              SNGNsS    SNGS  
    31   31 A S  T 3  S+     0   0   53  471   64  NNKSNS     SNS  STNAIS  sN      SDNN  SN              SSNTsN    NKNS  
    32   32 A Y    <   +     0   0   63  495   53  YYWYYW     WYW  YWDYFY  YY      LAEN  YN              YYWWYY    YWYY  
    33   33 A L  E     -E   90   0B   0  495    7  LLLLLL     LLL  LLLLLL  LL      LLLL  LL              LLLLLL    LLLL  
    34   34 A A  E     -E   89   0B   0  495   71  NNAANA     AAA  SATNNT  HN      ASSA  AH              BSSAAN    NTRA  
    35   35 A W  E     -EF  88  48B   1  496    0  WWWWWW     WWW  WWWWWW  WW      WWWW  WW              WWWWWW    WWWW  
    36   36 A Y  E     -EF  87  46B   0  496    8  YYYYYY     YYY  YYYYYF  YY      YYYY  YY              YFYYYY    YYFY  
    37   37 A Q  E     -EF  86  45B   7  496   27  QQQQQQ     QQQ  QQQQQQ  QQ      QQQQ  QQ              ZQQQQQ    QQQQ  
    38   38 A Q  E     -E   85   0B  21  496    4  QQQQQQ     QQQ  QQQQQQ  QQ      QQQQ  QQ              ZQQQQQ    QQQQ  
    39   39 A K    >   -     0   0   51  495    8  KKKKKK     KKK  KKKKKK  KK      KKKK  KK              KKKKKK    KKKK  
    40   40 A Q  T 3  S+     0   0  190  496   18  PPPPPP     PPP  PPPPPP  SP      PPPP  QP              PPPPPP    PPPP  
    41   41 A G  T 3  S+     0   0   86  496   10  GGGGGG     GGG  GGGGGG  GD      GGGG  GG              GGGGGD    DGGG  
    42   42 A K  S <  S-     0   0  126  495   54  KKKKKK     KKK  QKKLKK  AG      QKQK  KS              KKKKQG    GKKQ  
    43   43 A S        -     0   0   21  495   56  IAAAAA     AVA  PAAAAS  ST      PAAV  AS              ASSVAT    TPSA  
    44   44 A P        -     0   0    4  495   10  PPPPPP     PPP  PPPPPP  PV      PPPP  PP              PPPPPV    VPPP  
    45   45 A Q  E     -F   37   0B  74  495   32  KKKKKK     KKK  KKKKKK  KK      KKTK  KK              BKQKRK    KKRR  
    46   46 A F  E     +F   36   0B  25  495   41  LLLLLP     LLL  LLELLT  LL      LLLL  LL              LTLLLL    LPLL  
    47   47 A L  E     +     0   0B   4  495    9  LLLLLL     LLL  LLLLLL  WV      LLLL  LL              LLLLLL    LRML  
    48   48 A V  E     -FG  35  54B   0  496    5  IIIIII     III  IMIIIL  II      IIII  II              IIIIII    IIII  
    49   49 A Y  E >> S+ G   0  53B  39  496   17  YYYYYY     YYY  YYYYYY  YY      YYYY  YY              YYYYYY    YYYY  
    50   50 A N  T 34 S-     0   0   52  496   91  RYQARK     KAK  KKAGDR  SY      DYAS  AY              ARGRGY    YEGG  
    51   51 A A  T 34 S+     0   0    3  496   44  AAAAAA     AAA  AAAAAA  TT      AAAA  AA              AAAAAT    TAAA  
    52   52 A K  T <4 S+     0   0  148  496   25  SNNSSS     SSS  SSSSSN  SS      SNSS  SS              SNTSSS    SSTS  
    53   53 A T  E  <  -G   49   0B  47  496   68  SRKSNS     NTN  TSNTKR  NR      DSSS  NS              BRSTSR    RKNS  
    54   54 A L  E     -G   48   0B  60  496   59  LLLLLL     LLL  LLLRLL  LL      LLLL  LL              LLLLRL    LLLR  
    55   55 A G    >   -     0   0    9  495   70  QEEQQQ     QQQ  AEQEEV  AH      AEQQ  AH              HVAQAH    HQAA  
    56   56 A E  T 3  S+     0   0  192  495   35  SSSSTS     SSS  SSSAAD  SS      SDSS  SS              SDDTTS    STNT  
    57   57 A G  T 3  S+     0   0   70  496    5  GGGGGG     GGG  GGGGGG  GG      GGGG  GG              GGGGGG    GGGG  
    58   58 A V    <   -     0   0   25  494   10  IVVVVV     VVV  VVVVVV  VV      VVVV  VV              VVVVIV    VVVI  
    59   59 A P    >   -     0   0   47  495    7  PPPPPP     PPP  SPPPPP  PP      PPPP  PP              PPPPPP    PPPP  
    60   60 A S  T 3  S+     0   0  115  496   56  SSSSPS     SSS  SSSSSS  AS      SSSS  SS              SSSSDS    SSSD  
    61   61 A R  T 3  S+     0   0   44  496    4  RRRRRR     RRR  RRRRRR  RR      RRRR  RR              RRRRRR    RRRR  
    62   62 A F  E <   +C   75   0A   5  496    1  FFFFFF     FFF  FFFFFF  FF      FFFF  FF              FFFFFF    FFFF  
    63   63 A S  E     -C   74   0A  55  495   23  SSSSSS     SSS  KISSSS  SS      SSSS  SR              SSSSSS    SSSS  
    64   64 A G  E     +C   73   0A  13  496    2  GGGGGG     GGG  GGGGGG  GG      GGGG  GG              GGGGGG    GGGG  
    65   65 A S  E     +C   72   0A  63  496    6  SSSSSS     SSS  SSSSTS  SS      SSSS  SS              SSSSSS    SSSS  
    66   66 A G  E     -C   71   0A  36  496   14  GGGGRG     GGG  GGGGGG  GG      GGGG  GR              GGRGGG    GGRG  
    67   67 A S  E >   +C   70   0A  79  496    9  SSASSS     SSS  SSASSS  SS      YSSS  SS              SSSSSS    SSSS  
    68   68 A G  T 3  S-     0   0   16  496   12  GGGGGG     GGG  GGGGGG  GG      GGGG  GG              GGGGGG    GGGG  
    69   69 A T  T 3  S+     0   0   67  495   13  TTTTTT     TTT  TTTTTQ  TT      TTTT  TT              TQTTTT    TTST  
    70   70 A Q  E <   +BC  24  67A 110  496   29  DDDEDD     DDD  EEEDDD  SD      EQDD  DD              BDQDDD    DDDD  
    71   71 A F  E     -BC  23  66A   2  494    5  FFFFFF     FFF  FFFFFF  YY      FFFF  YF              FYYFFY    YFYF  
    72   72 A S  E     -BC  22  65A  26  495   30  TTTTTT     TTT  TTTTTS  SS      TSTT  ST              TSSTTS    STST  
    73   73 A L  E     -BC  21  64A   0  496    2  LLLLLL     LLL  LLLFFL  LL      LLLR  LL              FLLLLL    LLLL  
    74   74 A K  E     -BC  20  63A  97  496   38  TTTTTT     TTT  TTTTTT  TT      TKTT  TT              TTKTTT    TTTT  
    75   75 A I  E     -BC  19  62A   0  496    1  IIIIII     III  IIIIII  II      IIII  II              IIIIII    IIII  
    76   76 A N  S    S-     0   0   86  496   29  SSSSSS     SSS  SSSSSS  SS      SSSS  SN              SSSSSS    SSNS  
    77   77 A S  S    S-     0   0   58  496   62  SSSSSS     SSS  DSSSSS  SN      GSSS  SG              SSRSRN    NSSS  
    78   78 A L        -     0   0    0  496   27  LLLLLL     LLL  LLLLLL  ML      VLLL  VL              LLLLLL    LLLL  
    79   79 A L    >   -     0   0   67  496   31  QQEQQQ     QQQ  ZQQQQE  EG      QEQQ  EQ              ZEQEEE    EEEE  
    80   80 A P  G >  S+     0   0   92  496   59  PPPPPP     PPP  CPPPPY  AP      CAPP  AA              PYVPPP    QPSP  
    81   81 A E  G 3  S+     0   0  102  496   15  EEEEKE     EEE  ADEEEE  EE      EEEE  EE              ZEEEEE    EEEE  
    82   82 A D  G <  S+     0   0    1  496    5  DDDDDD     DDD  DDDDDD  DD      DDDD  DD              BDDDDD    DDDD  
    83   83 A F    <   +     0   0   29  495   73  FFVFIF     FVF  AFFIIM  AI      AAIV  IV              FMIACI    IAMF  
    84   84 A G  E    S- H   0 105B  17  496   23  AAAAAA     AAA  AAAAAG  AA      AGAA  AG              AGGAAA    AGAA  
    85   85 A S  E     -EH  38 104B  24  496   62  TTTTTT     TTT  TTTTTI  TT      TITT  TI              TIITVT    TTIV  
    86   86 A Y  E     -EH  37 103B   0  496    0  YYYYYY     YYY  YYYYYY  YY      YYYY  YY              YYYYYY    YYYY  
    87   87 A Y  E     -E   36   0B   5  495    4  YYYYYY     YYY  YYYYYY  YY      YFYY  YY              YYYYYY    FYYY  
    88   88 A b  E     -E   35   0B   0  496    0  CCCCCC     CCC  CCCCCC  CC      CCCC  CC              CCCCCC    CCCC  
    89   89 A Q  E     -EI  34  99B   0  494   48  QQQMQQ     IQQ  QQLQQL  QQ      QHLQ  QQ              ZLLQQQ    QHLQ  
    90   90 A H  E     -E   33   0B  22  486   28  QQQQQQ     QKQ   QQQQQ  QQ      GQQR  QQ              ZQQQQQ    QQQE  
    91   91 A H        +     0   0    0  423   89  GYYHYY     HHY   .Q..Y  ..      GGDT  LS              SYAS..    GYH   
    92   92 A Y  S    S+     0   0  104  454   87  YNDNDS     SNS   YNYFD  YY      YYYY  SS              YDYSYY    NNN   
    93   93 A G  S    S-     0   0   34  421   71  SSSSNS     SSS   N.NDE  HS      YNTN  DS              .ESNGS    .SE   
    94   94 A T  S    S-     0   0  104  444   88  YDSYLY     TAT   SSNNF  SK      SPTA  FL              SFALSN    TNY   
    95   95 A P  S    S+     0   0    7  441   51  PPPPPP     PPP   DYWLP  YL      SPPP  PP              SPPPSL    LPP   
    96   96 A P  S    S-     0   0   55  420   76   PPPPN     PPP   SPPPL  PP      SPFP  PF              P PPPP    PPP   
    97   97 A L        -     0   0   21  151   88   ... .     ...   KRPL.  RP      A.T.  T.              T ..LL    Y .   
    98   98 A T        -     0   0   40  278   41   .T. .     ...   MSTTT  TT      T.V.  VT              T ..TT    T T   
    99   99 A F  B     -I   89   0B  18  277   26   . . .     ...   FFFFF  FF      Y.L.  IV              F ..FF    F     
   100  100 A G        -     0   0    3  285   38   . . .     ...   GGGGG  GG       .Q.  QS              G ..GG    G     
   101  101 A G        -     0   0   52  300   63   . . .     ...   QQQGA  GG       .A.  AG              Z ..GA    G     
   102  102 A G        -     0   0   11  300   41   . . .     ...   GGGGG  GG       .I.  MK              G ..GG    G     
   103  103 A T  E     - H   0  86B   0  360   19   T T T     TTT   TTTTT  TT       TTT  TQ              T TTTT    T     
   104  104 A K  E     -dH  10  85B  98  359   60   V V V     VVV   KKKKK  KK       VKV  KK              R   KK    K     
   105  105 A L  E     -dH  11  84B   4  343   39   L L L     LIL   VVVVL  LL       I L   L              L   VL    L     
   106  106 A E  E     -d   12   0B 108  326   52   H Q H     HQH   EEEDE  EE       H Q   E              Z   EE    E     
   107  107 A I  E      d   13   0B 113  295   51   T T       TAT   VIVFL  II             M              I   IL    I     
   108  108 A K              0   0  145  261   18   R Q       RRR   KKKKK  K              K              K   KK    K     
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30        EEEEE    E      E   QQDQEE    EE  EEQQEEEEEEEEE        QQ     DD
   111    2 B V        +     0   0   19  428   12        VVVVV    V      VV  VVVVVE    VV  VVVVVVVVVVVVVV       VV     IV
   112    3 B K  E     -J  134   0C 111  430   32        QQKKK    Q      QQ  QQQQQQ    QQ  QQQQQKKKKKKKKQ       QQ     QQ
   113    4 B L  E     -J  133   0C   3  452    1        LLLLL    L      LL  LLLLLL    LL  LLLLLLLLLLVLLL      MLL     LL
   114    5 B Q  E     -J  132   0C  83  454   70        VVVVV    V      VV  VVVVVV    VV  VVVVLVVVVVVEEV      LQQL    VV
   115    6 B E  E     +J  131   0C   5  458   22        EEEEE    E      EE  QEEQEE    EE  EEQEEEEEEEEEEE      EEEE    EE
   116    7 B S  E     +J  130   0C  69  463   14        SSSSS    S      SS  SSSSSS    SS  SSSSSSSSSSSSSS      SSSS    SS
   117    8 B G        +     0   0   36  467    4        GGGGG    G      GG  GGGGGG    GG  GGGGGGGGGGGGGG      GGGG    GG
   118    9 B G        +     0   0   29  718   50        GGGGG   GG      GG  GGGGGG    GG  GGGGGGGGGGGGGG      GGGG    GR
   119   10 B D        -     0   0   96  725   42        GDGGG   GG      DG  GGDGGG    GG  GGGGGGGGGGGGGG      GGGG    DD
   120   11 B L  E     +n  224   0D  79  727   14        LLLLL   LL      MV  VLLVLL    LL  LLVVLLLLLLLLLL      LLLV    VV
   121   12 B V  E     -n  225   0D  16  729   31        VVVVV   VV      VV  VVRVVV    AV  AVVVVVVVVVVVVQ      VVVV    RR
   122   13 B Q    >   -     0   0  114  730   53        QQQQQ   QK      KQ  QNQQ.Q    QQ  QQQQQQQQQQQQQQ      KQQQ    QQ
   123   14 B P  T 3  S+     0   0   66  730    7        PPPPP   PP      PP  PPPPQP    PP  PPPPPPPPPPPPPP      PAAP    PP
   124   15 B G  T 3  S+     0   0   58  734   31        GGGGG   KG      GG  GGGGPG    GG  GGGGGGGGGGGGGG      GGGG    GG
   125   16 B G    <   -     0   0   25  736   63        GRGGG   GG      GR  RGGRGG    GG  GGRRGGGGGGGGMG      GGGK    GG
   126   17 B S        +     0   0   78  735   29        CSSSS   SS      SS  SSSSGS    SA  SSSSSSSSSSSSSS      SSSS    SS
   127   18 B L  E     - K   0 192C  25  737   28        LLLLL   LL      LL  LRLLLL    LL  LLLLLLLLLLLMVL      LLLL    LL
   128   19 B K  E     - K   0 191C  93  735   55        KRRRR   KR      RR  RRRRRR    RR  RRRRRRRRRRRKKR      RRRR    KH
   129   20 B L  E     - K   0 190C   0  740   16        LLLLL   LL      LL  LLLLLL    LV  LLLLLLLLLLLLLL      LLLL    LL
   130   21 B S  E     -JK 116 189C  28  740   37        SSSSS   SS      SS  SSSSSS    SS  SSSSSSSSSSSSSS      SSSS    SS
   131   22 B d  E     -JK 115 188C   0  740    0        CCCCC   CC      CC  CCCCCC    CC  CCCCCCCCCCCCCC      CCCC    CC
   132   23 B A  E     -JK 114 187C  52  740   67        AAAAA   AV      VA  AVKAAA    AV  AAASAAAAAAAVAK      AAAA    KK
   133   24 B A  E     +J  113   0C   8  740   48        AATTT   AG      AA  AAAAAA    AA  AAASATTTTTTATG      GAAA    AA
   134   25 B S  E     +J  112   0C  58  740   14        SSSSS   SS      SS  SSSSSS    SS  SSSSSSSSSSSSST      SSSS    SS
   135   26 B G  S    S+     0   0   56  739    3        GGGGG   GG      GG  GGGGGG    GG  GGGGGGGGGGGGGG      GGGG    GG
   136   27 B F  S    S-     0   0   33  740   31        FFFFF   FF      FF  FFFFFF    FF  FFFFFFFFFFFFFF      FRRF    FF
   137   28 B T    >   -     0   0   93  740   53        TNTTT   TT      TT  STSTTT    TT  TTTITTTTTTTTTT      TAAT    TT
   138   29 B F  G >  S+     0   0    2  740   28        FFFFL   FF      FF  FLFFFF    FF  FFFFFFFFFFFFFF      FTSF    FF
   139   30 B S  G 3  S+     0   0   57  740   55        SHSSS   NS      SS  GNSSSS    SS  SSSSSSSSSSSSSS      SSSR    SS
   140   31 B S  G <  S+     0   0   71  740   57        NEDDD   FN      SR  NDsTSS    DD  DSRSSDDDDADNDS      SggN    SS
   141   32 B Y  S <  S-     0   0   44  738   42        YYFFF   YY      YY  FYyYSY    HY  HYYYSFFFFFFYYF      YyyY    YY
   142   33 B T        -     0   0   30  739   92        LNYYY   AY      YD  GYGGGW    YG  YDTAAYYYYYYWWN      GGGG    YS
   143   34 B M  E     -OP 160 207E   0  739   49        MMMMM   MM      ML  MVMMMM    MM  MMIMMMMMMMMMMM      FMMM    MM
   144   35 B S  E     -OP 159 206E   0  740   72        SHEEE   NN      YH  HISHNH    DA  DHHYSEEEEEENEF      SGGH    SH
   145   36 B W  E     +OP 158 205E   0  740    0        WWWWW   WW      WW  WWWWWW    WW  WWWWWWWWWWWWWW      WWWW    WW
   146   37 B V  E     -OP 156 204E   0  740   17        VLVVV   VV      AV  VVVVVV    VV  VVVVVVVVVVVVVI      VFFV    VV
   147   38 B R  E     -OP 155 203E  10  740   21        RRRRR   RR      RR  RRRRRR    RR  RRRRRRRRRRRRRR      RRRR    RR
   148   39 B Q  E     -OP 154 202E   9  740    4        QQQQQ   QQ      QQ  QQQQQQ    QQ  QQQQQQQQQQQQQQ      QQQQ    QQ
   149   40 B T    >   -     0   0    9  739   74        AGPST   AA      AP  AAAAAA    AA  AAAAAPPPPPTSAA      AVVA    AT
   150   41 B P  T 3  S+     0   0   80  740   11        PPPPP   PP      PP  PPPPPP    PT  PPPPPPPPPPPPPP      PPPP    PP
   151   42 B E  T 3  S-     0   0  151  740   29        GGGGG   GG      GG  GGGGGG    GG  GGGGGGGGGGGEGG      GGGG    GG
   152   43 B K    <   +     0   0  121  740   37        KKKKK   KK      KK  KKKKKK    KK  KKKKKKKKKKKKKK      KKKK    KK
   153   44 B R        -     0   0  113  739   42        GGRRR   GG      GG  GGGGGG    GG  GGGGGRRRRRRGGG      GEEG    GG
   154   45 B L  E     -O  148   0E   9  740   13        LPLLL   LL      LL  LLLLLL    LL  LLLLLLLLLLLLLL      LRRL    LL
   155   46 B E  E     -O  147   0E  44  739    4        EEEEE   EE      QE  EEEEEE    EE  EEEEEEEEEEEEEE      EEEE    EE
   156   47 B W  E     +O  146   0E  15  739   11        WWWWW   WW      WW  WWWWWW    WW  WWWWWWWWWWWWWH      WFFW    WW
   157   48 B V  E     -     0   0E   0  739   28        VVIII   VV      VV  VVVVVV    VV  VAVVVIIIIIIIVV      VVVV    IV
   158   49 B A  E     -O  145   0E   0  740   36        SSAAA   AS      SA  AAAAAS    GS  SSAAAAAAAAAAAA      SAAA    SA
   159   50 B S  E     -OQ 144 168E   0  740   94        YTAAA   RY      HV  TYIVVL    RS  RYVIWAAAAAAEEE      AAAG    EL
   160   51 B I  E     -OQ 143 167E   4  739   18        IISSS   II      II  IIIIII    II  IIMIKSSSSSSIII      IIII    II
   161   52 B N    >   -     0   0   47  740   85        NTRRR   RN      NW  SSYSWS    RS  RSSWYRRRRRRRRS      SRRS    SY
   162   53 B N  T 3  S+     0   0   65  740   86        SWNNN   SS      KF  HPTYSS    NQ  NYYDENNNNNSLNS      SWWS    NS
   163   54 B G  T 3  S-     0   0   65  740   68        DNKKK   KD      DD  DSSDDD    KP  KNBDNKKKKKKKKG      SSSD    DD
   164   55 B G  S <  S+     0   0   30  740   50        GGGAV   SG      GG  GGQGGG    AS  AGGGGAAAAAASAG      SGGG    GG
   165   56 B G  S    S+     0   0   74  739   59        TGnny   nS      SS  SSANSs    ng  nGBSNnnnfnhhnS      SKKR    SS
   166   57 B R        +     0   0  163  548   85        .Sttt   aS      SN  QS.YQy    tn  tSBDDtttttrav.      YEEK    SS
   167   58 B T  E     -Q  160   0E  62  724   48        AVTTT   AT      TK  KT.KKI    TT  TTKQKTTTTTTTAT      TTTK    TT
   168   59 B Y  E     +Q  159   0E  53  723   87        YLEEE   YY      SY  YYYYYY    EY  ENHHHEEEEEEHYY      FWWK    YY
   169   60 B Y        -     0   0   44  737    7        YYYYY   YY      YY  HYYYYY    YY  YYYYYYYYYYYYYY      YYYY    YY
   170   61 B P    >>  -     0   0   20  737   66        AASSS   AA      AA  TAAAAA    AL  AAAAASSSSSSAGA      TKVV    AA
   171   62 B D  T 34 S+     0   0  148  739   65        DDAAA   DD      DD  DEDDDA    AD  ADDDDAAAAAAEKD      DDDD    DE
   172   63 B T  T 34 S+     0   0   90  739   62        SSSSS   SS      AS  SSSSSS    SP  SSSSSSSSSSSSSA      SSSS    SS
   173   64 B V  T X> S+     0   0    1  740   43        VVVVV   VV      VV  VVVVVV    VV  VVVVVVVVVVVVLV      VVVV    VV
   174   65 B K  B 3< S+l  177   0C 142  739   35        KKKKK   RK      KR  KKKKKK    KK  KKNKNKKKKKKKKK      KKKK    KK
   175   66 B G  T 34 S+     0   0   74  739   36        GGGGG   DG      GG  GGGGGG    GG  GGGGGGGGGGGGGG      GGGG    GS
   176   67 B R  T <4 S+     0   0   36  739   21        RRRRR   RR      RR  RRRRCR    RR  RRRRRRRRRRRRRR      RRRR    RR
   177   68 B F  E  <  -lM 174 192C   2  740   67        FFFFF   FF      FF  FFFFFF    FF  FFFFFFFFFFFFFF      FFFF    FF
   178   69 B T  E     - M   0 191C  79  740   38        TAIII   TT      TT  TTTTTT    TT  TTTTTIIIIFITTT      TTTF    TT
   179   70 B I  E     + M   0 190C   5  740   22        IIVVV   II      II  IIIITI    II  IIIIIVVVVVVILI      VIII    II
   180   71 B S  E     - M   0 189C  51  736   45        SSSSS   SS      SS  SSSSSS    SS  SSSSSSSSSSSSSS      SSSS    SS
   181   72 B R  E     - M   0 188C  30  739   68        RRRRR   RR      RR  RRKRRR    RR  RRRRRRRRRRRRRR      KRRR    RR
   182   73 B D  E > > - M   0 187C  60  738    5        DDDDD   DD      DD  DDDDDD    DD  DDNDNDDDDDDDDD      DDDD    DD
   183   74 B N  G > 5S+     0   0   48  739   59        NNTTT   DN      NN  NRNNNN    DN  DNDNDTTTTTTDDT      NNNN    NN
   184   75 B A  G 3 5S+     0   0   99  739   41        AASSS   SS      AS  SAASAA    SA  SASSSSSSSSSSSG      AAAS    GA
   185   76 B K  G < 5S-     0   0  111  740   54        KQQQQ   QK      KK  KKNKKK    KK  KKKKKQQQQQQKKQ      KKKK    NN
   186   77 B N  T < 5 +     0   0   62  740   46        NKSSS   SS      NK  NNSNNN    NN  NNNNNSSSSSSSSS      STSN    SS
   187   78 B T  E   < -KM 132 182C  16  740   68        STIII   ME      TM  TSLTTT    TT  TSTTTIIIIIVSIT      STTT    LQ
   188   79 B L  E     -KM 131 181C   0  737   61        LLLLL   LL      LL  LVVLLL    LL  LLLLLLLLLLLVVL      LVVL    LL
   189   80 B Y  E     -KM 130 180C  41  737   41        YYYYY   YY      YY  YSNYYY    YY  YYYFYYYYYYYFYY      YYYY    HH
   190   81 B L  E     -KM 129 179C   0  739    8        LLLLL   LL      LL  LLLLLL    LL  LLLLLLLLLLLLLL      LLLL    LL
   191   82 B Q  E     -KM 128 178C  76  739   41        HQQQQ   QQ      QQ  QEQEQQ    QQ  QQNQLQQQQQQQQQ      QQQQ    QQ
   192   83 B M  E     +KM 127 177C   0  740   11        MLMMM   MM      MM  MMMMMM    MI  MMMMMMMMMMMMMM      MMML    MM
   193   84 B S        +     0   0   42  740   54        NNNNN   NN      NY  NSNNSS    SN  SNNDNNNNNNNNNN      NNNN    NN
   194   85 B S  S    S-     0   0   68  739   23        NIAAA   NN      SS  SSSSNS    SS  SSSSSAAAAAANNS      SSSS    SS
   195   86 B L        -     0   0    3  740   16        LLLLL   LL      LL  LLLLLL    LL  LLLLLLLLLLLLIL      LLLL    LL
   196   87 B K    >   -     0   0  102  740   70        RRRRR   KR      RR  RRKRRK    KR  KRRRQRRRRRRRRK      RKKR    KK
   197   88 B S  G >  S+     0   0   70  740   59        APAAA   TA      AA  ARTTAA    TA  TAPPAAAAAAAASA      APPA    AT
   198   89 B E  G 3  S+     0   0  126  740   21        EEEEE   EE      EE  EEEEEE    EE  EEEEZEEEEEEEEE      EEEE    EE
   199   90 B D  G <   +     0   0    2  740    3        DDDDD   DD      DD  DDDDDD    DD  DDDDBDDDDDDDDD      DDDD    DD
   200   91 B T    <   +     0   0   32  740   32        TTTTT   TS      TT  TTTTMT    TT  TTTTTTTTTTTTTT      TTTT    TT
   201   92 B A  E    S- R   0 223E   8  737    4        AAAAA   AA      AA  AAAAAA    AA  AAAGAAAAAAAGGA      AAAA    AA
   202   93 B M  E     -PR 148 222E  58  739   46        VFIII   MV      VV  VMLLML    VV  VVVVLIIIIITIIT      VVVV    TL
   203   94 B Y  E     -PR 147 221E   0  739    1        YYYYY   YY      YY  YYYYYY    YY  YYYYYYYYYYYHYY      YYYY    YY
   204   95 B Y  E     -P  146   0E   7  740    4        YYYYY   YY      YY  FYYYYY    YY  YYYFYYYYYYYYYY      YYYY    YY
   205   96 B d  E     -P  145   0E   0  740    0        CCCCC   CC      CC  CCCCCC    CC  CCCCCCCCCCCCCC      CCCC    CC
   206   97 B V  E     -PS 144 217E   0  740   24        TAAAA   VA      AA  AAAAAA    AA  AAAAAAAAAATTSV      AAAA    AA
   207   98 B R  E     -PS 143 216E  21  739   39        rkrrr   rs      kr  krrkrr    rr  rgrrrrrrrrrTrk      kavk    rk
   208   99 B H  E     + S   0 214E   6  629   94        ynssy   sf      sy  ynesrp    vr  vltassbysyn.st      kppf    dl
   209  100 B E  E  >  + S   0 213E  63  676   73        PGTSG   QD      PN  RDDQDP    HG  HSASPSSPRDS.EA      GVVA    KG
   210  101 B Y  T >4 S-     0   0   80  702   91        CNWYS   AF      RI  YASGNC    IR  IPMCTYYHYYY.NA      DGGA    NR
   211  102 B Y  T 34 S-     0   0  140  709   44        VWYWY   WY      Rh  AFWYFH    FF  FWFFFWWWWWF.WI      WFFY    LF
   212  103 B Y  T 34 S+     0   0   39  264   90        ....W   ..      .p  ......    N.  S.........G...      ...Y    L.
   213  104 B A  E <<  -S  209   0E   0  447   85        ...YY   ..      .T  Y.A...    FK  F..G.YYYY.YG..      ...G    IY
   214  105 B M  E     +S  208   0E   0  580   59        .FFFF   F.      .V  G.AF..    FA  FVFPFFFFFFFFF.      L..M    RF
   215  106 B D  E     +     0   0E  19  696   48        .DDDD   A.      PD  DDADLR    LF  LQADADDDDDDAVD      GDDD    EL
   216  107 B Y  E     -S  207   0E  99  702   57        .SVVV   YY      LY  YIAHTC    TS  TKHYHVVVVVVYYA      NYYV    FY
   217  108 B W  E     -S  206   0E  23  731    0        WWWWW   WW      WW  WWWWWW    WW  WWWWYWWWWWWWWW      WWWW    WW
   218  109 B G        -     0   0    0  714   13        GGGGG   GG      TG  GGGGTN    NS  NPGGGGGGGGGGGG      GGGG     S
   219  110 B Q        -     0   0   91  701   38        RQAAA   QQ      QQ  RQ QKD    AS  A QQQAAAAAAQQR      QQQQ     L
   220  111 B G        -     0   0   16  687   10        GGGGG   GG      DG  GG GGK    NG  N GGGGGGGGGGGG      GGGG     N
   221  112 B T  E     -R  203   0E  21  675   26         TTTT   TT      ST  TT T T    AG  A TTTTTTTTTTTT      TTTT     V
   222  113 B T  E     -R  202   0E  72  661   75         LTTT   LL      VL  LM L F     A  S LPLTTTTTTLLS      LQQT     S
   223  114 B V  E     -R  201   0E   0  654   18         VVVV   VV       V  VV V T     P  V VVVVVVVVVVVV      VVVV     V
   224  115 B T  E     -n  120   0D  36  643   13         TTTT   TT       T  TT T T     P    TTTTTTTTTTTT      TTTT     T
   225  116 B V  E     +n  121   0D   6  626    6         VVVV   VV       V  VV V L     V    VV VVVVVVVVV      VVVV     V
   226  117 B S        -     0   0   36  616    5         SSSS   SS       S  SS S T     A    SS SSSSSS SS      SSSS     T
   227  118 B S  S    S+     0   0   84  597   20         SSSS   AS       S  SS S S     P    SS SSSSSS SS      SSSS      
   228  119 B A  S    S+     0   0   70   97   58                 V               A                               A      
   229  120 B W        -     0   0  123   87   40                 D               G                               S      
   230  121 B R        +     0   0  207   62   76                 P               Q                                      
   231  122 B H              0   0  156   56   69                 N               R                                      
   232  123 B P              0   0  155   28   53                 S                                                      
## ALIGNMENTS  421 -  490
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    1 A D              0   0  183  423   16      D  D  DD   DDDEDD  D  DE      D D         DDDDDDDDD DDE D       DD
     2    2 A I        -     0   0   32  466   12      II I  II   IIIIII  I  II  I   III         IIIVIIIII III I       II
     3    3 A E        -     0   0  117  468   68      QV Q  QT   QQVVQQ  Q  QV  V   QQQ         QQQQQQQQQ QQV K       QQ
     4    4 A L  E     -A   25   0A  10  482    7      ML M  MM   MMMMMM  M  ML  L   MMM         MMMMMMMMM MMM M       MM
     5    5 A T  E     -A   24   0A  64  482    8      TS T  TT   TTTTTT  T  TT  T   TTS         TTTTTTTTT TTT T       TT
     6    6 A Q  E     -A   23   0A  13  482    0      QQ Q  QQ   QQQQQQ  Q  QQ  Q   QQQ         QQQQQQQQQ QQQ Q       QQ
     7    7 A T  E    S+A   22   0A  64  482   35      SS S  SS   SSTSTS  T  TS  S   SSS         SSSSTTTST SSS S       SS
     8    8 A P        -     0   0   46  485    9      PP P  PP   PPPPTP  I  TP  P   PPP         PPPPTTTTP PPP P       PP
     9    9 A V  S    S+     0   0   96  489   67      DA S  SS   SSAVSS  S  SA  A   SSS         SSSSSSSSS SSA S       SS
    10   10 A S  E     -d  104   0B  60  491   42      IS S  SY   SSSTSS  S  ST  S   SSS         SSSSSSSSS SST S       SS
    11   11 A L  E     -d  105   0B  58  494   23      LL V  LL   VLVLLL  L  LL  L   LLL         LVVLLLLLL LLL L       LL
    12   12 A S  E     +d  106   0B  60  495   42      SS S  SS   SSSSSP  S  SS  S   SSS         SSSSSSSSS SSS S       SS
    13   13 A A  E     -d  107   0B   0  495   58      AG A  AK   AAAVAA  A  AL  R   AAA         AAAAAAAAA AAV A       AA
    14   14 A S    >   -     0   0   47  496   31      SS S  SS   SSASSS  S  SS  S  SSSS         SSSSSSSSS SSS S       SS
    15   15 A V  T 3  S+     0   0   76  496   66      LP V  QP   VVVPLL  L  LP  A  LVVL         VVVVLLLLL LVP L       VV
    16   16 A G  T 3  S+     0   0   42  496    5      GG G  GG   GGGGGG  G  GG  G  KGGR         GGGGGGGGG GGG G       GG
    17   17 A E    <   -     0   0   71  496   36      EE D  EE   DDGEDE  D  DE  E  DGDD         DDDDDDDDD DDE E       DD
    18   18 A T        -     0   0   69  496   62      ST R  RR   RRTRRR  R  RR  T  PRTT         RRRRRRRRR RRR R       RT
    19   19 A V  E     - B   0  75A  11  496   36      VV V  VV   VVVAVV  V  VA  V  VVVV         VVVVVVVVV VVA V       VV
    20   20 A T  E     - B   0  74A  67  495   29      TT T  ST   TTTTTT  T  TT  T  TTTT         TTTITTTTT TTT S       TT
    21   21 A I  E     - B   0  73A   1  494   17      II I  LI   IIILII  I  IL  I  IIII         IIIIIIIII IIL L       II
    22   22 A T  E     -AB   7  72A  29  494   59      TT T  TT   TTNSSS  S  SS  S  TTTT         TSTTSSSSS STS T       TT
    23   23 A b  E     -AB   6  71A   0  495    1      CC C  CC   CCCCCC  C  CC  C  CCCC         CCCCCCCCC CCC C       CC
    24   24 A R  E     -AB   5  70A 110  495   47      QK Q  KR   RRQRRR  R  RR  R  QRQQ         RRRRSRRRR RRW R       RR
    25   25 A A  E     -A    4   0A  10  495   28      SA A  AA   AAAAAA  A  AA  A  AAAA         AAAAAAAAA AAA A       AA
    26   26 A S  S    S+     0   0   66  495    4      SS S  SS   SSSSSS  S  SS  T  SSSS         SSSSSSSSS SSS S       SS
    27   27 A E  S    S-     0   0  101  495   38      QG Q  EQ   QQQQQQ  Q  QQ  E  QQQQ         QQQQQQQQQ QQQ Q       QQ
    28   28 A N        +     0   0   83  495   45      SS G  GG   GGNSDG  D  DS  S  SGGG         GSGSSDDDD GSS E       SE
    29   29 A I    >   -     0   0    5  496   32      IV V  II   IIIIII  I  IV  L  IIII         IIISIIIII III I       II
    30   30 A Y  T 3   -     0   0  155  496   81      YY S  SS   SSDsNS  N  SS  t  GSSS         SSSVGSSSN SSS S       SY
    31   31 A S  T 3  S+     0   0   53  471   64      SD N  NS   NDSsNN  N  NN  q  SNNS         SSSDNNNNN KNS G       K.
    32   32 A Y    <   +     0   0   63  495   53      NY A  YS   YDWYYN  Y  YY  Y  ANEW         WWAYYYYYY WYN Y       WS
    33   33 A L  E     -E   90   0B   0  495    7      LL L  LL   LLLLLL  L  LL  L  LLLL         LLLLLLLLL LLL L       LL
    34   34 A A  E     -E   89   0B   0  495   71      AH A  HN   AAAANA  S  NA  H  ANNA         AAANBNNNN ANA S       AS
    35   35 A W  E     -EF  88  48B   1  496    0      WW W  WW   WWWWWW  W  WW  W  WWWW         WWWWWWWWW WWW W       WW
    36   36 A Y  E     -EF  87  46B   0  496    8      YY Y  YY   YHYYYY  Y  YY  Y  YYYY         YYYYYYYYY YYY L       YY
    37   37 A Q  E     -EF  86  45B   7  496   27      QQ Q  QQ   QQQQQQ  Q  QQ  Q  QQQQ         QQQQQQQQR QQQ Q       QQ
    38   38 A Q  E     -E   85   0B  21  496    4      QQ Q  QQ   QQQQQQ  Q  QQ  Q  QQQQ         QKQQQQQQQ QQQ Q       QP
    39   39 A K    >   -     0   0   51  495    8      KK K  KK   KKKKKK  K  KK  K  KKKK         KKKKKKKKK KKK K       KK
    40   40 A Q  T 3  S+     0   0  190  496   18      PP P  PP   PPPPPP  P  PP  P  PPPP         PPPPPPPPP PPP P       PP
    41   41 A G  T 3  S+     0   0   86  496   10      GG G  GG   GGGSDG  D  DG  G  GGGG         GGGGDDDDD GGG D       GG
    42   42 A K  S <  S-     0   0  126  495   54      EQ K  QQ   KKQGGK  G  GQ  Q  KKKK         KKKKGGGGG KKQ G       KN
    43   43 A S        -     0   0   21  495   56      HA T  AS   AAPSTS  T  TA  A  STSS         AAPATTTTT AAA T       VP
    44   44 A P        -     0   0    4  495   10      PP P  PP   PPPPVP  V  VP  P  PPPP         PPAPVVVVV PPP V       PP
    45   45 A Q  E     -F   37   0B  74  495   32      KR K  KK   KKKRKQ  K  KR  R  NKKK         KKKKKKKKK KNR K       KK
    46   46 A F  E     +F   36   0B  25  495   41      LL L  LR   LLVLLL  L  LL  L  LLPL         PLLLLLLLL PLL R       LL
    47   47 A L  E     +     0   0B   4  495    9      LL L  LL   LLLLLL  L  LL  L  LLLL         LLLLLLLLL LLL L       LL
    48   48 A V  E     -FG  35  54B   0  496    5      II I  II   IIIIII  I  II  I  IIII         IIIIIIIII III I       II
    49   49 A Y  E >> S+ G   0  53B  39  496   17      YY Y  NY   YYYYYY  Y  YY  Y  YYYY         YYYFYYYYY YYY Y       YY
    50   50 A N  T 34 S-     0   0   52  496   91      AG D  NG   YARGYG  Y  YD  E  YAYA         KKADYYYYY EAG A       AG
    51   51 A A  T 34 S+     0   0    3  496   44      AV A  AA   AATATA  T  TT  A  AAAA         VAATTTTTT AAA A       AI
    52   52 A K  T <4 S+     0   0  148  496   25      SS T  NS   SSSSST  S  SS  T  KSSS         SSSSSSSSS SSS S       SN
    53   53 A T  E  <  -G   49   0B  47  496   68      NN T  TN   SSTTRS  R  RY  N  GSRN         SSSNSRRRR KST T       TI
    54   54 A L  E     -G   48   0B  60  496   59      LL L  LL   LLLRLL  L  LR  L  LLLL         LLLLLLLLL LLR L       LL
    55   55 A G    >   -     0   0    9  495   70      AE Q  QQ   QQAAHA  H  HA  A  VQEQ         EQQQHHHHH HQA H       QE
    56   56 A E  T 3  S+     0   0  192  495   35      DC S  SS   SSSTSD  S  ST  S  DSTS         SSSSSSSSS SST S       SD
    57   57 A G  T 3  S+     0   0   70  496    5      GG G  GG   GGGGGG  G  GG  G  GGGG         GGGGGGGGG GGG G       GG
    58   58 A V    <   -     0   0   25  494   10      IV V  VV   VVVIVV  V  VI  V  VIVV         IVVVVVVVV VVI V       VV
    59   59 A P    >   -     0   0   47  495    7      PP P  PP   PPPPPP  P  PP  P  PPPP         PPPPPPPPP PPP P       PP
    60   60 A S  T 3  S+     0   0  115  496   56      SA S  SS   SSSASS  S  SA  S  SSSS         SSSSSSSSS SSA K       SQ
    61   61 A R  T 3  S+     0   0   44  496    4      RR R  RR   RRRRRR  R  RR  R  RRRR         RRRRRRRRR RRR R       RR
    62   62 A F  E <   +C   75   0A   5  496    1      FF F  FF   FFFFFF  F  FF  F  FFFF         FFFFFFFFF FFF F       LF
    63   63 A S  E     -C   74   0A  55  495   23      SS S  SS   SSKSSS  S  SS  S  SSRR         SSSSSSSSS SSS S       SS
    64   64 A G  E     +C   73   0A  13  496    2      GG G  GG   GGGGGG  G  GG  G  GDGG         GGGGGGGGG GGG G       GG
    65   65 A S  E     +C   72   0A  63  496    6      SS S  SS   SSSSSS  S  SS  S  SSSS         SSSGSSSSS SSS S       SS
    66   66 A G  E     -C   71   0A  36  496   14      GG G  GV   GERGGG  G  GG  G  GGGG         EGGRGGGGG GGG R       GG
    67   67 A S  E >   +C   70   0A  79  496    9      SS S  SS   SSSSSS  S  SS  S  TSSS         SSSSSSSSS SSS S       SS
    68   68 A G  T 3  S-     0   0   16  496   12      GG G  EG   GGGGGG  G  GG  G  GGGG         GGGGGGGGG GGG G       GG
    69   69 A T  T 3  S+     0   0   67  495   13      TT T  TT   TTTTTT  T  TT  T  TTTK         TTTTTTTTT TTT S       TT
    70   70 A Q  E <   +BC  24  67A 110  496   29      QD D  DD   DEEEDQ  D  DD  D  DDDD         EEDDDDDDD DDE D       DQ
    71   71 A F  E     -BC  23  66A   2  494    5      YY Y  FF   YFFFYF  Y  YF  F  FYFF         FFYFYYYYY FFF Y       FF
    72   72 A S  E     -BC  22  65A  26  495   30      ST T  TT   TTTTSS  S  ST  T  TTTT         TTTTSSSSS STT S       TS
    73   73 A L  E     -BC  21  64A   0  496    2      LL L  LL   LLLLLL  L  LL  L  LLLL         LLLLLLLLL LLL L       LL
    74   74 A K  E     -BC  20  63A  97  496   38      KT T  TT   TTTTTK  T  TT  T  TTTT         TTTTTTTTT TTT T       TK
    75   75 A I  E     -BC  19  62A   0  496    1      II I  II   IIIIII  I  II  I  IIII         IIIIIIIII III I       II
    76   76 A N  S    S-     0   0   86  496   29      SS S  SS   SSSSSS  T  SS  S  SSSS         SSSSSSSSS SSS S       SS
    77   77 A S  S    S-     0   0   58  496   62      SS S  SS   SSDSNS  N  NS  S  SSGG         SSSSBNNNN NGS S       SS
    78   78 A L        -     0   0    0  496   27      LL L  LL   LLLLLP  L  LL  L  LLLL         LLLLLLLLL LLL L       LL
    79   79 A L    >   -     0   0   67  496   31      QE Q  EE   QQEQEH  E  EE  E  EQEQ         QQQQZEEEE EQQ E       QQ
    80   80 A P  G >  S+     0   0   92  496   59      PP P  PP   PPCSQP  Q  QP  P  PPTA         PPPPPQQQQ PAS S       PA
    81   81 A E  G 3  S+     0   0  102  496   15      EE E  EE   EEAEED  E  EE  E  EEDE         EEEDZEEEE DEE D       EE
    82   82 A D  G <  S+     0   0    1  496    5      DD D  DD   DDDDDD  D  DD  D  DDDD         DDDDBDDDD DDD D       DD
    83   83 A F    <   +     0   0   29  495   73      VA F  GF   FFAFIT  V  IF  A  IFVF         FFFFIIIII FFF F       VI
    84   84 A G  E    S- H   0 105B  17  496   23      AG A  AA   AAAAAA  A  AA  G  AAGA         AAAAAAAAS GAA A       AA
    85   85 A S  E     -EH  38 104B  24  496   62      NH T  TT   TTTVTM  T  TV  E  TANT         TTTTTTTTT ITI D       TA
    86   86 A Y  E     -EH  37 103B   0  496    0      YY Y  YY   YYYYYY  Y  YY  Y  YYYY         YYYYYYYYY YYY Y       YY
    87   87 A Y  E     -E   36   0B   5  495    4      YY Y  FF   YYYYFY  F  FY  Y  YYYY         YYYYYFFFF YYH Y       YY
    88   88 A b  E     -E   35   0B   0  496    0      CC C  CC   CCCCCC  C  CC  C  CCCC         CCCCCCCCC CCC C       CC
    89   89 A Q  E     -EI  34  99B   0  494   48      QQ Q  QL   QQQQQQ  Q  QQ  Q  QQQQ         QTQQQQQQQ QQQ L       QQ
    90   90 A H  E     -E   33   0B  22  486   28      QQ Q  QQ   QQSQQQ  Q  QH  Q  QQQQ         QQQQQQQQQ QQQ Q       KQ
    91   91 A H        +     0   0    0  423   89      GG Y  GC   YYY.GG  G  G   S  HSDY         YHYS.GGGG YSY Y       HG
    92   92 A Y  S    S+     0   0  104  454   87      YY N  YY   NNYYKY  N  N   K  NDYN         NNNYYNNYN NYN A       DR
    93   93 A G  S    S-     0   0   34  421   71      SE S  SS   SSSN.S  T  .   S  NSSS         SSSTS.... SSS S       SY
    94   94 A T  S    S-     0   0  104  444   88      YW Y  YF   YY NTD  L  T   S  NTYW         VYVNKSMMA YAW D       AY
    95   95 A P  S    S+     0   0    7  441   51      PL P  PP   PP WLP  P  L   P  PPPP         PPPPLLLLL PLP P       AP
    96   96 A P  S    S-     0   0   55  420   76      PP P  PP   PP PPP  Y  P      PPPP         PPPEPPPPP PTP W       HP
    97   97 A L        -     0   0   21  151   88      .. .  TT   .. PRT  .  L      ...T         ...VRRRRR .FL .       ..
    98   98 A T        -     0   0   40  278   41      .T .  VV   .. TTV  T  T      ...V         ...TTTTTT .GT T       ..
    99   99 A F  B     -I   89   0B  18  277   26      .V .  II   .. FFI  F  F      ...L         ...FFFFFF .PF F       ..
   100  100 A G        -     0   0    3  285   38      .L .  QQ   .. GGQ  G  G      ...Q         ...GGGGGG .GG G       ..
   101  101 A G        -     0   0   52  300   63      .Q .  AA   .. QGA  G  A      ...V         ...GGGGGG .TG G       ..
   102  102 A G        -     0   0   11  300   41      .G .  MM   .. GGM  G  G      ...L         ...GGGGGG .KG G       ..
   103  103 A T  E     - H   0  86B   0  360   19      TT T  TT   TT TTA  T  T      .TTT         TTTTTTTTT TVT T       TA
   104  104 A K  E     -dH  10  85B  98  359   60      VE V  KK   VV RKT  K  K      TVVK         VVVTKKKKK VDK K       VV
   105  105 A L  E     -dH  11  84B   4  343   39      IL L       LL VLT  L  L      VLLI         LLLVLLLLL LIV L       II
   106  106 A E  E     -d   12   0B 108  326   52      Q          HH EEQ  E  E      EQQE         HHHDEEEEE Q E E       QQ
   107  107 A I  E      d   13   0B 113  295   51      V          T  IIE  I  L                   TTTIIIIII A I I       SV
   108  108 A K              0   0  145  261   18                 R  KKR  K  K                   QRRKKKKKK Q K K       Q 
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30  DDD   E EE            E QQ  DD QE    DD EED DD         E     QQQEE D  
   111    2 B V        +     0   0   19  428   12  IIV   V VV  VVV      VV VV  VI VV    IIVVVVVII         V     VVVVV I  
   112    3 B K  E     -J  134   0C 111  430   32  QQQQ  Q KK  QQQ      QQ QQ  QQ QQ    PPQQQQQQQ         Q     QQQQQQQ  
   113    4 B L  E     -J  133   0C   3  452    1  LLLL  L LL  LLL      LL LL  LL LL    LLLLLLLLL         L   L LLLLLLL  
   114    5 B Q  E     -J  132   0C  83  454   70  VVVV  V VE  VVV      VV QQ  VV VV    VVLLVVVVV         V   E QQLVVVV  
   115    6 B E  E     +J  131   0C   5  458   22  EEEE  E EE  EEE      EE EQ  EE QE    EEEEEEEEE         E   Q EQEEEEE  
   116    7 B S  E     +J  130   0C  69  463   14  SSSS  S SS  SSS      SS SS  SS SS    SSSSSSSSS         S   S SSSSSSS  
   117    8 B G        +     0   0   36  467    4  GGGG  G GG  GGG      GG GG  GG GG    GGGGGGGGG         G   G GGGGGGG  
   118    9 B G        +     0   0   29  718   50  GGGG  G GG  GGG      GG GG  GG GG    GGGGGGGGG         G   G GGGGGGG  
   119   10 B D        -     0   0   96  725   42  DDDG  G GG  GGG      GG GG  DD GG    DVGGGGGDD         D   G GGGGGDD  
   120   11 B L  E     +n  224   0D  79  727   14  VVLL  L LL  LLL      LL LL  VV VL    LVLLLLLVV         L   V LLLLLLV  
   121   12 B V  E     -n  225   0D  16  729   31  RRKV  A VV  QQQ      VV VV  RR VV    RRVVVVQRR         V   V VVVVVRR  
   122   13 B Q    >   -     0   0  114  730   53  QQQQ  Q QQ  QQQ      KK QQ  QQ PH    QQQQQKQQQ         K   Q QQKQQQQ  
   123   14 B P  T 3  S+     0   0   66  730    7  PPPP  P PP  PPP      PP AA  PP PP    PPPPPPPPP         P   P ATPPPPP  
   124   15 B G  T 3  S+     0   0   58  734   31  GGGG  G GG  GGG      GG GG  GG GG    GGGGGGGGG         G   G GGGGKGG  
   125   16 B G    <   -     0   0   25  736   63  GGGG  G GR  GGG      GG GG  GG RG    GGGGGGGGG         G   R GGGGGGG  
   126   17 B S        +     0   0   78  735   29  SSSS  S SS  SSS      SS SS  SS SS    SSSSSSSSS         S   S SSSFSSS  
   127   18 B L  E     - K   0 192C  25  737   28  LLLL  L LM  LLL      VL LL  LL LL    LLLLLLLLL         L   L LLLLLLL  
   128   19 B K  E     - K   0 191C  93  735   55  KKSR  R RK  RRR      RR RR  KK RR    KKRRRRRKK         R   R RRRRKRK  
   129   20 B L  E     - K   0 190C   0  740   16  LLLL  L LL  LLL      LL LL  LL LL    LLLLLLLLL         L   L LLLLLLL  
   130   21 B S  E     -JK 116 189C  28  740   37  SSSS  S SS  SSS      SS SS  SS SS    SSSSSSSSS         S   S SSSSSSS  
   131   22 B d  E     -JK 115 188C   0  740    0  CCCC  C CC  CCC      CC CC  CC CC    CCCCCCCCC         C   C CCCCCCC  
   132   23 B A  E     -JK 114 187C  52  740   67  KKKA  A AV  KKK      AA AV  KK AA    KKAAAAKKK         V   A AAAVAKK  
   133   24 B A  E     +J  113   0C   8  740   48  AAAV  A TA  GAA      AA AA  AA AA    AAAAAAGAA         A   A AAAVAAA  
   134   25 B S  E     +J  112   0C  58  740   14  SSSS  S SS  TTT      SS SS  SS SS    SSSSSSTSS         S   S SSSSSSS  
   135   26 B G  S    S+     0   0   56  739    3  GGGG  G GG  GGG      GG GG  GG GG    GGGGGGGGG         G   G GGGGGGG  
   136   27 B F  S    S-     0   0   33  740   31  FFLF  F FF  FFF      FF FR  FF FF    FFFFFFFFF         F   I RRFFFLF  
   137   28 B T    >   -     0   0   93  740   53  TTTT  T TT  DMT      TT TT  TT TT    TTTSTTTTT         T   F TTTTDTT  
   138   29 B F  G >  S+     0   0    2  740   28  FFSF  F FF  FLL      FF SF  FF FF    FFFFFFLFF         F   T SSFFFYF  
   139   30 B S  G 3  S+     0   0   57  740   55  SSSS  S TS  SSS      TS DS  SS SS    TSSSSSSSS         S   L HHSSNSS  
   140   31 B S  G <  S+     0   0   71  740   57  SSYS  D DN  SSS      NK Dg  SS TS    SSATTTSSS         S   T ggNDTSS  
   141   32 B Y  S <  S-     0   0   44  738   42  YYYY  H YY  MFF      AA Yy  YY YS    YYSDSAFYY         Y   Y yyAHYYY  
   142   33 B T        -     0   0   30  739   92  SDYQ  Y YW  RDL      WW AG  YE GG    GDAAAWGYY         Y   G GGWYAYG  
   143   34 B M  E     -OP 160 207E   0  739   49  MMMM  M MM  VMM      MM VM  MM MM    MMMMVMMMM         M   I MMMMMMM  
   144   35 B S  E     -OP 159 206E   0  740   72  NSNH  D SN  MFQ      NS GG  SN HN    NHSYYKSSY         E   H GGSDSHY  
   145   36 B W  E     +OP 158 205E   0  740    0  WWWW  W WW  WWW      WW WW  WW WW    WWWWWWWWW         W   W WWWWWWW  
   146   37 B V  E     -OP 156 204E   0  740   17  VVVV  V VV  VVI      VV FF  VV VV    IVVVVVIVI         V   V FFVVVVI  
   147   38 B R  E     -OP 155 203E  10  740   21  RRRR  R RR  RRR      RR RR  RR RR    RRRRRRRRR         R   R RRRRRRR  
   148   39 B Q  E     -OP 154 202E   9  740    4  QQQQ  Q QQ  QQQ      QQ QQ  QQ QQ    QQQQQQQQQ         Q   Q QQQQQQQ  
   149   40 B T    >   -     0   0    9  739   74  AAAA  A PS  AAA      AA AV  AA AA    AAAAAAAAA         A   A VVAAAAA  
   150   41 B P  T 3  S+     0   0   80  740   11  PPPP  P PP  PPP      PP PP  PP PP    PPPPPPPPP         P   P PPPPPPP  
   151   42 B E  T 3  S-     0   0  151  740   29  GGGG  G GE  GGG      GG GG  GG GG    GGGGGGGGG         G   G GGGGGGG  
   152   43 B K    <   +     0   0  121  740   37  KKKK  K KK  KKK      KK KK  KK KK    KKKKKKKKK         K   K KKKKKKK  
   153   44 B R        -     0   0  113  739   42  GGGG  G AG  GGG      GG EE  GG GG    GGGGGGGGG         G   G EEGGGGG  
   154   45 B L  E     -O  148   0E   9  740   13  LLLL  L LL  LLL      LL RR  LL LL    LLLLLLLLL         L   L RRLLLLL  
   155   46 B E  E     -O  147   0E  44  739    4  EEEE  E EE  EEE      EE EE  EE EE    EEEEEEEEE         Q   E EEEEDEE  
   156   47 B W  E     +O  146   0E  15  739   11  WWWW  W WW  AVP      WW GF  WW WW    WWWWWWPWW         W   W LLWWWWW  
   157   48 B V  E     -     0   0E   0  739   28  VVVV  V LV  VVV      VV VV  VL VV    VVVVVVVVV         V   V VVVVVVV  
   158   49 B A  E     -O  145   0E   0  740   36  SSAK  S GA  AAA      GG SA  SS AA    SSAAGVASS         A   A AAGSAAS  
   159   50 B S  E     -OQ 144 168E   0  740   94  RYRL  R FE  GLS      RR CA  LN VV    YAWWWWGRY         Q   G AARSSRA  
   160   51 B I  E     -OQ 143 167E   4  739   18  IIVI  I II  III      II II  II II    IIKKRRIII         I   L IIIIIVI  
   161   52 B N    >   -     0   0   47  740   85  DSHS  R RR  YVS      KK SR  DN SW    NSYYYVSDN         S   W RRKSSYS  
   162   53 B N  T 3  S+     0   0   65  740   86  TSSS  N NL  NTK      TS SW  TG YY    GNEQEESTG         S   Y WWTTIHN  
   163   54 B G  T 3  S-     0   0   65  740   68  GGNS  K KK  DTN      KK GS  GP DD    ADNEGQSAA         D   G SSKGKDD  
   164   55 B G  S <  S+     0   0   30  740   50  SGGG  A AS  GGG      ST DG  SG GG    GGGASVGGG         G   T GGTSTGG  
   165   56 B G  S    S+     0   0   74  739   59  GSGG  n bh  SAY      dd GV  SS NS    SSNSSVSSS         S   N TIdghNS  
   166   57 B R        +     0   0  163  548   85  .SST  t ya  G..      tt ST  .S YQ    SGDNLEDSS         S   . SSttaYS  
   167   58 B T  E     -Q  160   0E  62  724   48  TTTI  T TI  TAT      AT TT  TT KK    TTKSTKTTT         T   K TTTTTIT  
   168   59 B Y  E     +Q  159   0E  53  723   87  YNNY  E TH  YGW      DD YY  SY YY    SYHHHAYSS         Y   N YYDLLGY  
   169   60 B Y        -     0   0   44  737    7  YYYY  Y EY  YYY      YY YY  YY YY    YYYFYFYYY         Y   Y YYYYYYY  
   170   61 B P    >>  -     0   0   20  737   66  AAAA  A YA  AAA      AA AV  AA AA    AAAAAAAAA         P   A AAASAAA  
   171   62 B D  T 34 S+     0   0  148  739   65  DDDD  A SE  SPD      AA DD  DD DD    DDDDVNDDD         D   E DDADDDD  
   172   63 B T  T 34 S+     0   0   90  739   62  SSSS  S AS  SSV      PP SS  SS SS    SSSTSSASS         A   S SSPSSSS  
   173   64 B V  T X> S+     0   0    1  740   43  VVVV  V VV  VVV      VV VV  VV VV    VVVVVVVVV         V   V VVVVVVV  
   174   65 B K  B 3< S+l  177   0C 142  739   35  KKKK  K KK  KKQ      KK KK  KK RK    KKNNQNQKK         K   K KKKKKKK  
   175   66 B G  T 34 S+     0   0   74  739   36  GGGG  G GG  GGG      GG GG  GG GG    GGGGGGGGG         G   G GGGGEGG  
   176   67 B R  T <4 S+     0   0   36  739   21  RRRR  R RR  RRR      RR RR  RR RR    RRRRRRRRR         Q   R RRRRRRR  
   177   68 B F  E  <  -lM 174 192C   2  740   67  FFFF  F FF  FFF      FL FF  FF FF    FFFFFFFFF         F   F FFLFFFF  
   178   69 B T  E     - M   0 191C  79  740   38  TTTT  T TT  TTT      TT TT  TT TT    TTTTTTTTT         T   T TTTITTT  
   179   70 B I  E     + M   0 190C   5  740   22  IIII  I II  III      II II  II II    IIIIIIIII         I   I IIIIIII  
   180   71 B S  E     - M   0 189C  51  736   45  SSSS  S SS  SSS      SS SS  SS SS    SSSSSSSSS         S   S SSSSSSS  
   181   72 B R  E     - M   0 188C  30  739   68  RRWR  R RR  RRR      RR TR  RR RR    RRRRRRRRR         R   R RRRRRWR  
   182   73 B D  E > > - M   0 187C  60  738    5  DDDD  D BD  DDD      DD DD  DD DD    DDNNNNDDD         D   D DDDDDDD  
   183   74 B N  G > 5S+     0   0   48  739   59  NNKN  D BD  NNS      DS NN  NN NN    NNDDDDNNN         N   N NNDNDKN  
   184   75 B A  G 3 5S+     0   0   99  739   41  GGAA  S SS  GGG      SS AA  GG SA    GGSSSSGGG         A   S VVSASAG  
   185   76 B K  G < 5S-     0   0  111  740   54  NNSK  K ZK  QQQ      KK SK  NN KK    NNKKKKQNN         K   K KKKKQNN  
   186   77 B N  T < 5 +     0   0   62  740   46  SSSN  N GS  SSS      NN NS  SS NN    SSNNNNSSS         N   D NNNNSSS  
   187   78 B T  E   < -KM 132 182C  16  740   68  LLLT  T IS  MTT      TT TT  LL TM    LLTTTTTLL         T   T MMTTMLL  
   188   79 B L  E     -KM 131 181C   0  737   61  LLLL  L LV  GLV      LL VV  LL LA    LLLLLLLLL         L   L VVLLVLL  
   189   80 B Y  E     -KM 130 180C  41  737   41  HHSF  Y YY  YYY      YY YY  HH NY    HHYYYYYHH         Y   Y YYYYYSH  
   190   81 B L  E     -KM 129 179C   0  739    8  LLLL  L LL  LLL      LL LL  LL LL    LLLLLLLLL         L   L LLLLLLL  
   191   82 B Q  E     -KM 128 178C  76  739   41  QQQQ  Q QQ  QQQ      QR QQ  QQ DH    QQQQQQQQQ         Q   M QQQQQQQ  
   192   83 B M  E     +KM 127 177C   0  740   11  MMMM  M MM  MMM      MM MM  MM MM    MMMMMMMMM         M   N MMMMMMM  
   193   84 B S        +     0   0   42  740   54  NNNS  S NN  DNN      NN NN  NN NN    NNNNLINNN         N   S NDNNNNN  
   194   85 B S  S    S-     0   0   68  739   23  SSSS  S TN  SSS      SS SS  SS SS    SSGRSSGSS         S   . SSSSNSS  
   195   86 B L        -     0   0    3  740   16  LLLL  L LL  LLL      LL LL  LL LL    LLLLLVLLL         L   L LLLLLLL  
   196   87 B K    >   -     0   0  102  740   70  KKKR  K RR  KEK      KK KK  KK RR    KKQEETKKK         G   R KKKRKKK  
   197   88 B S  G >  S+     0   0   70  740   59  AATA  T AA  AAA      TT PP  AA TA    AAAAPPAAA         A   A PPTATTA  
   198   89 B E  G 3  S+     0   0  126  740   21  EEED  E QE  EEE      EE EE  EE EE    EEZZZZEEE         E   D EEEEEEE  
   199   90 B D  G <   +     0   0    2  740    3  DDDD  D DD  DDD      DD DD  DD DD    DDVBBBDDD         D   D DDDDDDD  
   200   91 B T    <   +     0   0   32  740   32  TTTM  T ST  TTT      TT TT  TT TT    TTSTTTTTT         T   T TTTTTTT  
   201   92 B A  E    S- R   0 223E   8  737    4  AAAA  A AG  AGA      AA AG  AA AA    AAAAAAAAA         A   A AAAAAAA  
   202   93 B M  E     -PR 148 222E  58  739   46  TTLM  V TI  TTT      VV VV  TT LM    MTIVVVTTT         V   V VVVVLLT  
   203   94 B Y  E     -PR 147 221E   0  739    1  YYYY  Y YY  YYY      YY YY  YY YY    YYYYYYYYY         Y   Y YYYYYYY  
   204   95 B Y  E     -P  146   0E   7  740    4  YYYY  Y YY  YYY      FY YY  YY YY    YYYYYYYYY         Y   Y HYYYYYY  
   205   96 B d  E     -P  145   0E   0  740    0  CCCC  C CC  CCC      CC CC  CC CC    CCCCCCCCC         C   C CCCCCCC  
   206   97 B V  E     -PS 144 217E   0  740   24  SAAA  A AS  AAT      AT AA  AA AT    AAAAAAAAA         A   A AATATAA  
   207   98 B R  E     -PS 143 216E  21  739   39  rrtr  r rT  ikk      tt av  gr ka    rrrrrRkrr         k   r aatrvtr  
   208   99 B H  E     + S   0 214E   6  629   94  ddtd  v i.  wak      ys rp  dd se    ddsfs.cdd         l   l ppetnen  
   209  100 B E  E  >  + S   0 213E  63  676   73  KKKD  H T.  GIG      GS PD  KK QT    KKPVLVGKK         S   Q VVTGLTL  
   210  101 B Y  T >4 S-     0   0   80  702   91  NNPG  I E.  GGY      HK PG  NN GG    NNTQTVPNN         G   G GGGGQTL  
   211  102 B Y  T 34 S-     0   0  140  709   44  LLWL  F F.  AWa      FR cF  LL Yf    LLFFFvWLL         S   l FFySFFF  
   212  103 B Y  T 34 S+     0   0   39  264   90  LL..  S ..  .Ad      .T p.  LL .s    LL...t.LL         .   h ..s....  
   213  104 B A  E <<  -S  209   0E   0  447   85  IS.R  F .G  SSC      .S G.  SS .D    SS...SNIS         R   E ..GS...  
   214  105 B M  E     +S  208   0E   0  580   59  RREQ  F .F  III      .F M.  RR FK    RRFFSMLRR         E   M ..WLR.R  
   215  106 B D  E     +     0   0E  19  696   48  EEDE  L AP  ADD      DE DV  EE DW    EEADADDEE         S   D AAYDD.E  
   216  107 B Y  E     -S  207   0E  99  702   57  FFFP  T YS  AAA      YY YY  FF HL    FFHVVVAFF         L   D YYGVS.F  
   217  108 B W  E     -S  206   0E  23  731    0  WWWW  W WW  WWW      WW WW  WW WW    WWWFWWWWW         W   W WWWWWWW  
   218  109 B G        -     0   0    0  714   13    AS  N GG  GGG      GG GG     GG      GGGGG           A   G GGGGPA   
   219  110 B Q        -     0   0   91  701   38    AN  A ZP  RRR      QQ KQ     QR      QQQQR           Q   K QQQRA    
   220  111 B G        -     0   0   16  687   10    AG  N GG  GGG      GG GG     GG      GGGGG           G   G GGGGG    
   221  112 B T  E     -R  203   0E  21  675   26        A TT  TTT      IT TT     TT      TTTTA           S   T TTTV     
   222  113 B T  E     -R  202   0E  72  661   75        S LL  SSS      LL QQ     L       LLLPS           V   A QQLL     
   223  114 B V  E     -R  201   0E   0  654   18        L VV  VVV      VV VV     V       VVVVV           L   V VVVV     
   224  115 B T  E     -n  120   0D  36  643   13          TT  TTT      TT TT     T       TTTTT           T   T TTTT     
   225  116 B V  E     +n  121   0D   6  626    6          VV  VVV      VV VV     V           V               V VVVV     
   226  117 B S        -     0   0   36  616    5          S   SSS      SS SS     S           S               S SSSS     
   227  118 B S  S    S+     0   0   84  597   20          S   SSS      SS SS     S           S               S SSSS     
   228  119 B A  S    S+     0   0   70   97   58                                                             A    A     
   229  120 B W        -     0   0  123   87   40                                                             S    S     
   230  121 B R        +     0   0  207   62   76                                                                  T     
   231  122 B H              0   0  156   56   69                                                                  K     
   232  123 B P              0   0  155   28   53                                                                  G     
## ALIGNMENTS  491 -  560
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1    1 A D              0   0  183  423   16  D   D  DD  DEEEEEDD DQ EDEEE   DED  ED  N  DDDDDDDD    EEDDDDDDDDQDEQD
     2    2 A I        -     0   0   32  466   12  IIIII  II  IIIIIIII II IILLL   III  IPI I IIIIIIIII    IIIIIIVVIIIINII
     3    3 A E        -     0   0  117  468   68  QQQQQ  MT  QVVVVVQQ VV VQTTV   QVV  QVQ V VQQQTTTTQ    VVVVQQQQQQAVVVV
     4    4 A L  E     -A   25   0A  10  482    7  LMMMM  MM  MLLLLLMM LL MLLLM   LLM  MMM L LMMMMMMMM    LLLLMMMMMMLLLLL
     5    5 A T  E     -A   24   0A  64  482    8  TTTTT  TT  TTTTTTTT ST TTTTT   TTT  TTT T SSTTTTTTT    TTTTTTIITTSSTTT
     6    6 A Q  E     -A   23   0A  13  482    0  QQQQQ  QQ  QQQQQQQQ QQ QQQQQ   QQQ  QQQ Q QQQQQQQQQ    QQQQQQQQQQQQQQQ
     7    7 A T  E    S+A   22   0A  64  482   35  SSTSS  SS  SSSSSSTS SS SSSSS   SSS  STS S SSSSSSSSP    SSSSSTSSSTSSSSS
     8    8 A P        -     0   0   46  485    9  PPPPP  PL  PPPPPPTP PP PPPPP   PPP  PPP P PPPPPPPPT    PPPPPPPPPPPPPPP
     9    9 A V  S    S+     0   0   96  489   67  SSPSS  ST  SGGGGGSS AA AAGDA   SGD  SSS A ASSFTSSLS    GGAASSSSSSAAAAA
    10   10 A S  E     -d  104   0B  60  491   42  ISSFS  SS  TTTTTTSS II TITTT   STT  LSS F SSSFSSSSS    TTSSSSSSSSIIIIS
    11   11 A L  E     -d  105   0B  58  494   23  LLLLL  LL  LLLLLLLL LMLLMLLL   LLL  LTL L LLLLLLLLL    LLLLLLLLLMLLMML
    12   12 A S  E     +d  106   0B  60  495   42  YSSSS  PS  SSSSSSSP SSSSSSSS   ASS  SSA A SSSSSSLSS    SSAASSSSSPSSSSA
    13   13 A A  E     -d  107   0B   0  495   58  AAAAA  VK  VLLLLLAA AAAVALLL   MLL  AAA K GAAAKKVVA    LLVVAAAAAAAAAAV
    14   14 A S    >   -     0   0   47  496   31  SSSSS  SS  SSSSSSSS SSSSSSSS   SSS  SAS S SSSSSSSSS    SSSSSSSSSSSSSSS
    15   15 A V  T 3  S+     0   0   76  496   66  PLLVV  HQ  VPPPPPLL PPPPPPPP   VPP  PVV Q PLLVQQRRQ    PPLLLLLLILPPPPL
    16   16 A G  T 3  S+     0   0   42  496    5  GGGGG  GG  GGGGGGGG GGGGGGGG   GGG  GGG G GRGGGGGGG    GGGGGGGGGGGGGGG
    17   17 A E    <   -     0   0   71  496   36  DDDDD  DE  DEEEEEHD EEEEEEEE   QEE  DGD E EDDDEEDGD    EEQQEDDDEEEEEEQ
    18   18 A T        -     0   0   69  496   62  KTTTR  RT  RRRSRRRK KKKRKRRG   KRR  RTT T RTTTTTRRR    RRRRRRIIRRKKKKR
    19   19 A V  E     - B   0  75A  11  496   36  IVVVV  VV  VAAAAAVV VVVAVAAA   VAA  VVV V VVVVVVVVV    AAAAVVVVVVVVVVA
    20   20 A T  E     - B   0  74A  67  495   29  TTTTT  NT  TTTTTTTT TTTTTTTT   TTT  TTT T TTTTTTTTT    TTTTSSTTTTTTTTT
    21   21 A I  E     - B   0  73A   1  494   17  IIIII  II  ILLLLLII MMMLMLLL   MLL  III I IIIIIIIII    LLIILIMMIIMMMMI
    22   22 A T  E     -AB   7  72A  29  494   59  TRNTT  TR  TSSSSSTS TTTSTSSS   SSS  TNT N STSTRRITT    SSSSTSTTTSTTTTS
    23   23 A b  E     -AB   6  71A   0  495    1  CCCCC  CC  CCCCCCCC CCCCCCCC   CCC  CCC C CCCYCCFCC    CCCCCCCCCCCCCCC
    24   24 A R  E     -AB   5  70A 110  495   47  RQQKR  RQ  ERRRRRSR RRRRSRRR   KRR  RQK K KQQQQQRRR    RRRRRRQQQRRRSSR
    25   25 A A  E     -A    4   0A  10  495   28  AAAAE  AA  AAAAAAAA AAAAAAAA   SAA  ASA A AAAAAAAAA    AAAAAAAAAAAAAAA
    26   26 A S  S    S+     0   0   66  495    4  SSSSS  SS  SSSSSSSS SSSSSSSS   SSS  SSS S SSSSSSSSS    SASSSSSSSSSSSSS
    27   27 A E  S    S-     0   0  101  495   38  QQQQQ  QQ  QQQQQQQQ SSSQSQQQ   QQQ  QQE Q EQQKQQQEQ    QLKKQQQQQQSSSSK
    28   28 A N        +     0   0   83  495   45  GGSGG  NG  TSSSSSDG SSSSSSSS   SSS  NND S SGGVGGGDS    SLSSDDGGGGSSSSS
    29   29 A I    >   -     0   0    5  496   32  IIIII  II  VVVVVVII VVVVVVVV   LVV  AVI V LIIIIIIII    VSVVILTTIIVVVIV
    30   30 A Y  T 3   -     0   0  155  496   81  SNSNS  NS  LssSssSS SrSSSssG   lss  NyG S tSSSSSSYG    ssssGSSSSSSNSSs
    31   31 A S  T 3  S+     0   0   53  471   64  SNNR.  SN  SssSssNS .s.S.ssS   nng  KnY S sSKNNNNDI    ggssSQIIKN....s
    32   32 A Y    <   +     0   0   63  495   53  YEWWN  WY  YYFNYYYT YYYNYYYY   YYY  WYG Y YWYYYVYNN    YYYYSYNNWYYYYYY
    33   33 A L  E     -E   90   0B   0  495    7  LLLLN  LL  LLLLLLLL MLMLMLLL   LLL  LLL L LLLLLLLLL    LLMMLLLLLLMMMMM
    34   34 A A  E     -E   89   0B   0  495   71  GNAAL  AS  NAAAAANH HHHANAAA   AAA  TSN A NANANSHNA    GAHHNFNNANHHHHH
    35   35 A W  E     -EF  88  48B   1  496    0  WWWWN  WW  WWWWWWWW WWWWWWWW   WWW  WWW W WWWWWWWWW    WWWWWWWWWWWWWWW
    36   36 A Y  E     -EF  87  46B   0  496    8  YYYYY  FY  YYYYYYYY YYYYYYYY   YYY  YFY Y YYYYYYYYY    YYYYLYFFYYYYYYY
    37   37 A Q  E     -EF  86  45B   7  496   27  QQQQQ  QQ  QQQQQQQQ QQQQQQQQ   QQQ  QQQ Q QQQQQQQQQ    QQQQQQQQQQQQQQQ
    38   38 A Q  E     -E   85   0B  21  496    4  QQQQQ  QQ  QQQQQQQQ QQQQQQQQ   QQQ  QQQ Q QQQQQQQQQ    QQQQQQQQQQQQQQQ
    39   39 A K    >   -     0   0   51  495    8  KKKKK  KK  KKKKKKKK KKKKKKKK   KRK  KKK K KKKKKKKKK    KKKKEKKKKKKKKKK
    40   40 A Q  T 3  S+     0   0  190  496   18  PPPPP  PP  PPPRPPPP PPPPSPPP   PPP  PPL P HPPPPPAPP    PPPPPPPPPPPPSPP
    41   41 A G  T 3  S+     0   0   86  496   10  GGGGG  GG  GGGGGGDG GGGGGGGG   GGG  GGG G GGGGGGGGG    GGGGDGGGGDGGGGG
    42   42 A K  S <  S-     0   0  126  495   54  NADAK  QQ  KQQQQQGK SSSQTQQQ   QQQ  KQI Q QKKKQQQQQ    QQQQGQKKKGSSTTQ
    43   43 A S        -     0   0   21  495   56  ASSST  AA  AAASAATS SSSASAAA   SAA  PPA A ASSSAAAPA    AAPPTPAAATSSSSP
    44   44 A P        -     0   0    4  495   10  PPPPP  PP  PPPPPPVP PPPPPPPP   PPP  PPP P PPPPPPPPP    PPPPIPPPPIPPPPP
    45   45 A Q  E     -F   37   0B  74  495   32  EKKKK  KK  KRRRRRKK KKKRKRRR   KRR  KKK K RKKTKKKKK    RRKKKKKKKKKKKKK
    46   46 A F  E     +F   36   0B  25  495   41  LLLLL  LL  LLLLLLLL PLPLRLLL   LLL  PLL R LLLFLPCLL    LLLLRLLLLPPPRRL
    47   47 A L  E     +     0   0B   4  495    9  LLLLL  LL  LLLLLLLL WWWLWLLL   LLL  RLL L LLLLLLLLL    LLLLLLLLLLWWWWL
    48   48 A V  E     -FG  35  54B   0  496    5  IIIII  II  IIIIIIII IIIIIIII   LII  III I IIIIIIIII    IMIIIIIIIIIIIII
    49   49 A Y  E >> S+ G   0  53B  39  496   17  YYYYY  YY  YYYRYYYY YYYYYYYY   YYY  YYY S YYYYYYYYY    YYYYYYYYDYYSYYY
    50   50 A N  T 34 S-     0   0   52  496   91  DAKGA  SD  AGVDGGYG ASACDGGG   FGG  ELG G WAYGYYGGH    GGLLARGGEYAADDL
    51   51 A A  T 34 S+     0   0    3  496   44  SAAAA  AT  AAAAAATA TTTATAAA   AAA  AAA A AATATTATA    AAAATVAAATTTTTA
    52   52 A K  T <4 S+     0   0  148  496   25  YSSSS  SN  SSSSSSSS SSSSSSSS   SSS  SSN S NSSTNNSSN    SSSSSSSSSSSSSSS
    53   53 A T  E  <  -G   49   0B  47  496   68  NTNTS  NC  SSSSSSRS NNNTKSSS   TSS  KTT N KNNNSRNNS    SSNNSRINKNNNKKN
    54   54 A L  E     -G   48   0B  60  496   59  LLLLL  LL  LRRRRRLL LLLRLRRR   RRR  LLL R LLLLLLLLL    RRLLLLLLLLLLLLL
    55   55 A G    >   -     0   0    9  495   70  YQEQQ  QQ  EAAAAAHQ AAAAAAAA   EAA  QAE N AQEYQHQQE    AAEEDTEEHQAAAAE
    56   56 A E  T 3  S+     0   0  192  495   35  ASTSS  PS  TTTNTTST SSSTSTTT   STT  TSS S SSTTSSPPS    TTSSSNDDTSSSSSS
    57   57 A G  T 3  S+     0   0   70  496    5  GGGGG  GG  GGGGGGGG GGGGGGGG   GGG  GGG G GGGGGGGGG    GGGGGGGGGGGGGGG
    58   58 A V    <   -     0   0   25  494   10  VVIVI  VV  VIIIIIVV VVVIVIII   VII  VVV V VVVVVVVVV    IIVVVVVVVVVVVVV
    59   59 A P    >   -     0   0   47  495    7  PPPPP  PP  PPPPPPPP PPPPPPPP   PPP  PPP P PPPPPPPPP    PPPPPPPPPPPPPPP
    60   60 A S  T 3  S+     0   0  115  496   56  ASSSS  SS  SDDDDDSS AVAAADDD   DDD  SSS D ASSSSSLSS    DDAAKDSSSSAAAAA
    61   61 A R  T 3  S+     0   0   44  496    4  RRRRR  RR  RRRRRRRR RRRRRRRR   RRR  RRR R RRRQRRRRR    RRRRRRRRRRRRRRR
    62   62 A F  E <   +C   75   0A   5  496    1  FFFFF  FF  FFFFFFFF FFFFFFFF   FLF  FFF F FFFFFFFFF    FFFFFFFFFFFFFFF
    63   63 A S  E     -C   74   0A  55  495   23  SSRSS  SS  SSSSSSSS SSSSTSSS   ISS  SSS S SRSSSSSSS    SSSSSSSSSSSSSSS
    64   64 A G  E     +C   73   0A  13  496    2  GGGGD  GG  GGGGGGGG GGGGGGGG   GGG  GGG G GGGGGGGGG    GGGGGGGGGGGGGGG
    65   65 A S  E     +C   72   0A  63  496    6  SSSSS  SS  QSSSSSSS SSSSSSSS   SSS  SSS S SSSSSSSSS    SSSSSSSSSSSSSSS
    66   66 A G  E     -C   71   0A  36  496   14  GGGGG  GG  GGGGGGGG GGGGGGGG   GGG  GGG G GGGGGGGGG    GGGGRGRRGGGGGGG
    67   67 A S  E >   +C   70   0A  79  496    9  FYSSS  SS  SSSSSSSS SSSSSSSS   SSS  SSS S SSSSSSSSS    SSSSSSYYSSSSSSS
    68   68 A G  T 3  S-     0   0   16  496   12  GGGGG  GG  GGGGGGAG GGGGGGGG   GGG  GGE G GGGGGGGEG    GGGGGGGGGGGGGGG
    69   69 A T  T 3  S+     0   0   67  495   13  TTTTT  TT  TTTTTTTT TTTTTTTT   TTT  TTT T TKTATTTTT    TTTTSTTTTTTTNTT
    70   70 A Q  E <   +BC  24  67A 110  496   29  DDDDD  DD  BDDDDDDD SSSESDDD   DDD  DQD D DDDDDDDDD    DDDDDDDDEDSSSSD
    71   71 A F  E     -BC  23  66A   2  494    5  FFYFY  YY  FFFFFFYF YYYFYFFF   FFF  FFY F FFYYYYFYF    FFFFYFFFFYYYYYF
    72   72 A S  E     -BC  22  65A  26  495   30  TTSTT  SS  TTTTTTST SSSTSTTT   ATT  TTT T TTSSSSTST    TTTTSTTTTSSSSST
    73   73 A L  E     -BC  21  64A   0  496    2  LLLLL  LL  FLLLLLLL LLLLLLLL   LLL  LLL F LLLLLLLLL    LLLLLLLLLLLLLLL
    74   74 A K  E     -BC  20  63A  97  496   38  TTTTT  TT  TTTITTTT TTTTTTTT   TTT  TTT T TTTTTTTTT    TTNNTTTTTTTTTTN
    75   75 A I  E     -BC  19  62A   0  496    1  IIIII  II  IIIIIIII IIIIIIII   III  III I IIIIIIIIF    IIIIIIIIIIIIIII
    76   76 A N  S    S-     0   0   86  496   29  SSSRS  SS  SSSSSSTN SSSSSSSS   RNS  SSS S SSSSSRSSS    SSHHSDSSSSSSSSH
    77   77 A S  S    S-     0   0   58  496   62  SGGGS  SS  SRRRRRNN RSRSNRRR   SRR  SGS N SGGSSSSSS    RRPPSPSSSSRRSSP
    78   78 A L        -     0   0    0  496   27  LLLLL  LL  VLLLLLLL VVVLMLLL   VLL  LVV L LLLLLLLLL    LLVVLMLLLLMVTMV
    79   79 A L    >   -     0   0   67  496   31  EQQQQ  EE  ZEEEEEQE EEEQEEEE   QEE  EQQ Q EQQEEEEEE    EEEEEEEEEEEEEEE
    80   80 A P  G >  S+     0   0   92  496   59  CAAAP  PP  PPPPPPQA AAAFAPPP   APP  PCA P PAALPPPPP    PPEESEDDSPAAGAE
    81   81 A E  G 3  S+     0   0  102  496   15  EEEEE  EE  ZDEEEEEE EEEEEEEE   EEE  EDE E EEEEEEEEE    EEEEEDEEDEEEEEE
    82   82 A D  G <  S+     0   0    1  496    5  DDDDD  DD  BDDDDDDD DDDDDDDD   DDD  DDD D DDDDDDYDD    DDDDDDDDDDDDDDD
    83   83 A F    <   +     0   0   29  495   73  SAVFF  VI  FFFFFFXV AAAFAFFF   LFF  AAA A AFVFFVAAA    FFAAFTMMFFAAAAA
    84   84 A G  E    S- H   0 105B  17  496   23  AAAAA  AA  AAAAAAAG AAAAAAAA   AAA  GAG A AAAAAAAAA    AAAVVAAAGAAAAAA
    85   85 A S  E     -EH  38 104B  24  496   62  ITDNT  ND  TVVVVVTI TTTVTVVV   DVV  TTI V HTDTTTTTT    VVTTDTTTDMTTTTT
    86   86 A Y  E     -EH  37 103B   0  496    0  YYYYY  YY  YYYYYYYY YYYYYYYY   YYY  YYY Y YYYYYYYYY    YYYYYYYYYYYYYYY
    87   87 A Y  E     -E   36   0B   5  495    4  YYYYY  YY  YYYYYYXF YYYYYYYY   FFY  YYY Y YYFHYFYYY    YYYYYFFFYYYYYYY
    88   88 A b  E     -E   35   0B   0  496    0  CCCCC  CC  CCCCCCCC CCCCCCCC   CCC  CCC C CCCCCCCCC    CCCCCCCCCCCCCCC
    89   89 A Q  E     -EI  34  99B   0  494   48  QQQLE  VL  QQQQQQQQ QQQQQQQQ   QQQ  HAQ Q QQQKQVQQQ    QQQQLQLLQQQQQHQ
    90   90 A H  E     -E   33   0B  22  486   28  QNQQQ  QQ  ZQQQQQQQ QQQHQQQQ   QQQ  QGQ Q QQQQQQQQQ    QQHHQQQQKQQQQQH
    91   91 A H        +     0   0    0  423   89  RDYRS  GS  ...YYYGG .YW.WYYY   H.Y  YYG G SYHEGSGGY    ..SSYSHHYY..WRS
    92   92 A Y  S    S+     0   0  104  454   87  HYNNY  WY  YYYSGGNY WDSYSGGG   YYD  NYY Y YNNLIYNSY    YYRRARSSDDWWSSR
    93   93 A G  S    S-     0   0   34  421   71  SESSS  SN  LGGTTS.S SSSNSSSS   TGT  S S N DSSSSSSSN    GG..S.YYNSSSSS.
    94   94 A T  S    S-     0   0  104  444   88  YGYWT  FY  DSSSSSTT SSKNNSSS   TTS  N T N SWSYFSTYS    SSEESLLLTSSSNYE
    95   95 A P  S    S+     0   0    7  441   51  PPPPP  PP  LSSPPPLP NPYWPRPP   PSP  P P P SPPPPPPPP    LSLLPIPPPPNNPPL
    96   96 A P  S    S-     0   0   55  420   76  PWPLP  PP  PPPYRWPR PSMPPGTG   WPA  P P P PPPPPPsPP    GPPPWPYYCPPPPWP
    97   97 A L        -     0   0   21  151   88  ...T.  TT  RQS...Y. PIYF.Y..   .RW  . . . ...T.Tm..    RRRP.R....PP..Y
    98   98 A T        -     0   0   40  278   41  TGTVT  VV  TTTTTTT. TTTTTTTT   TPT  . . T TT.VTVT..    TSTTTTTT..TTTTT
    99   99 A F  B     -I   89   0B  18  277   26   WVLV  II  FFFFFFF. FFFFFFFF   FFF  . .   VV.LMI ..    FFFFFFFF..FFFFF
   100  100 A G        -     0   0    3  285   38   GLQL  QQ  GGGGGGG. GGGGGGGG   DGG  . .   FL.QTQ ..    GGGGGGGG..GGGGG
   101  101 A G        -     0   0   52  300   63   GQQQ  AA  QQQQQQG. GAGPGQQQ   GQQ  . .   QQ.QQA ..    QQGGGGGG..GGGGG
   102  102 A G        -     0   0   11  300   41   GISL  MM  GGGGGGG. GGGGGGGG   GGG  . .   GG.NGM ..    GGGGGGGG..GGGGG
   103  103 A T  E     - H   0  86B   0  360   19   GALN  TT  TSTTTTTT TTTTTTTT   TTT  T .   TGTSST TT    TTTTTTTTMTTTTTT
   104  104 A K  E     -dH  10  85B  98  359   60   KKDK  KK  KKKKKKKV KKKKKKKK   KRK  V T   EQVNRK VV    KKKKKKKKV KMKKK
   105  105 A L  E     -dH  11  84B   4  343   39   VIKL      VVVLVVLL LLLVLLVV   LLV  L V   LVLYI  II    VVLLLLLLL LLLLL
   106  106 A E  E     -d   12   0B 108  326   52   QEEE      DEEEEEXQ EEEDEEEE   EEE  Q Q    TQEG  QQ    EEEEEEEEQ EEEEE
   107  107 A I  E      d   13   0B 113  295   51   VIIS      LILIIIIA ILIIIIII   III         LVLV  NP    IIIIIIIIA IIIII
   108  108 A K              0   0  145  261   18   K KK      KKKKKKKQ KKKKKKKK   KKK         K  Q  KK    KKKKKKKKR KKKKK
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30       EE   D                 QQQ   EQ   E E                            
   111    2 B V        +     0   0   19  428   12       VV  VV        V        VVV   VV   M V         V                  
   112    3 B K  E     -J  134   0C 111  430   32       QQ  QQ        Q        QQQ   RQ   K K         Q                  
   113    4 B L  E     -J  133   0C   3  452    1       LL  LL        L        LLL   LL   L L         L                  
   114    5 B Q  E     -J  132   0C  83  454   70       VL  VV        V        QQQ   VV   V V         V                  
   115    6 B E  E     +J  131   0C   5  458   22       EE  EE        E        QEE   EQ   E E         E                  
   116    7 B S  E     +J  130   0C  69  463   14       SS  SS        S        SSS   SS   S S         S                  
   117    8 B G        +     0   0   36  467    4       GG  GG        G        GGG   GG   G G         G                  
   118    9 B G        +     0   0   29  718   50       GG  GG        G        GGG   GG   G G         GAAA               
   119   10 B D        -     0   0   96  725   42       AG  GD        G        GGG   GG   D D         GEEE               
   120   11 B L  E     +n  224   0D  79  727   14       LL  LL        L        LLL   LV   L L         LLLL               
   121   12 B V  E     -n  225   0D  16  729   31       VV  QR        V        VVV   VV   R R         QVVV               
   122   13 B Q    >   -     0   0  114  730   53       QQ  QQ        Q        QQQ   EQ   Q Q         QRRK               
   123   14 B P  T 3  S+     0   0   66  730    7       PP  PP        P        AAA   PP   P P         PPPP               
   124   15 B G  T 3  S+     0   0   58  734   31       GG  GG        G        GGG   GG   G G         GGGG               
   125   16 B G    <   -     0   0   25  736   63       GG  GG        R        DDD   GR   G G         GAAA               
   126   17 B S        +     0   0   78  735   29       SS  SS        S        SSS   FS   S S         SLSS               
   127   18 B L  E     - K   0 192C  25  737   28       GL  LL        L        LLL   LL   L L         LVVV               
   128   19 B K  E     - K   0 191C  93  735   55       RR  RR        R        RRR   RR   R R         RKKK               
   129   20 B L  E     - K   0 190C   0  740   16       LL  LL        L        LLL   LL   L L         LLLL               
   130   21 B S  E     -JK 116 189C  28  740   37       SS  SS        S        SSS   SS   S S         SSSS               
   131   22 B d  E     -JK 115 188C   0  740    0       CC  CC        C        CCC   CC   C C         CCCC               
   132   23 B A  E     -JK 114 187C  52  740   67       AA  KK        T        EEA   VV   V V         KKKT               
   133   24 B A  E     +J  113   0C   8  740   48       AA  GA        A        AAA   VA   A A         AAAA               
   134   25 B S  E     +J  112   0C  58  740   14       SS  TS        P        SSS   SS   S S         TSLS               
   135   26 B G  S    S+     0   0   56  739    3       GG  GG        G        GGG   GG   G G         GGGG               
   136   27 B F  S    S-     0   0   33  740   31       FF  FL        F        RRR   FF   F F         FFYF               
   137   28 B T    >   -     0   0   93  740   53       TT  TT        T        TTT   TT   T T         TNTN               
   138   29 B F  G >  S+     0   0    2  740   28       FF  LY        F        SSS   FF   F F         FIFI               
   139   30 B S  G 3  S+     0   0   57  740   55       SS  TS        G        HHH   SS   D K         SKTK               
   140   31 B S  G <  S+     0   0   71  740   57       TR  SS        D        ggg   DT   D D         SDDD               
   141   32 B Y  S <  S-     0   0   44  738   42       TV  .Y        Y        yyy   HY   Y A         FYYT               
   142   33 B T        -     0   0   30  739   92       SL  AF        A        GGG   YA   G A         RYEY               
   143   34 B M  E     -OP 160 207E   0  739   49       RS  MM        M        MMM   MM   M M         MMMM               
   144   35 B S  E     -OP 159 206E   0  740   72       FS  TH        S        GGG   DH   S S         EHHH               
   145   36 B W  E     +OP 158 205E   0  740    0       WW  WW        W        WWW   WW   W W         WWWW               
   146   37 B V  E     -OP 156 204E   0  740   17       VV  VV        V        FFF   VV   V F         VVVV               
   147   38 B R  E     -OP 155 203E  10  740   21       RR  RR        R        RRR   RR   R R         RKKK               
   148   39 B Q  E     -OP 154 202E   9  740    4       QQ  QQ        Q        QQQ   QQ   Q Q         QQQQ               
   149   40 B T    >   -     0   0    9  739   74       AA  AA        A        VVI   AA   A A         ARTR               
   150   41 B P  T 3  S+     0   0   80  740   11       PP  PP        P        PPP   PP   P S         PPPP               
   151   42 B E  T 3  S-     0   0  151  740   29       GG  GG        G        GGG   GG   G G         GEVE               
   152   43 B K    <   +     0   0  121  740   37       KK  KK        K        KKK   KR   K K         KQHQ               
   153   44 B R        -     0   0  113  739   42       GG  GG        G        EEE   GG   G G         GGGG               
   154   45 B L  E     -O  148   0E   9  740   13       LL  LL        L        RRR   LL   L P         LLLL               
   155   46 B E  E     -O  147   0E  44  739    4       EE  EE        E        EEE   DE   Q Q         AEEE               
   156   47 B W  E     +O  146   0E  15  739   11       WW  WW        W        LLL   WW   W W         PWWW               
   157   48 B V  E     -     0   0E   0  739   28       VV  VV        V        VVV   VV   V V         VIII               
   158   49 B A  E     -O  145   0E   0  740   36       ES  AA        G        AAA   SA   S S         AGGG               
   159   50 B S  E     -OQ 144 168E   0  740   94       FG  SR        F        AAA   SV   Y S         VWAR               
   160   51 B I  E     -OQ 143 167E   4  739   18       RR  IV        I        III   II   I I         IIII               
   161   52 B N    >   -     0   0   47  740   85       VL  DY        R        RRR   SS   S T         EDHD               
   162   53 B N  T 3  S+     0   0   65  740   86       QN  YH        S        WWW   TY   W G         KPPP               
   163   54 B G  T 3  S-     0   0   65  740   68       GA  RD        K        SSS   GD   S D         DEGA               
   164   55 B G  S <  S+     0   0   30  740   50       SS  NG        A        GGG   SG   G S         GNSN               
   165   56 B G  S    S+     0   0   74  739   59       AS  NN        y        VLR   gN   S S         RGGG               
   166   57 B R        +     0   0  163  548   85       IN  .Y        t        EEN   tY   S N         MNGN               
   167   58 B T  E     -Q  160   0E  62  724   48       SL  AI        T        TTT   TK   I I         TTTT               
   168   59 B Y  E     +Q  159   0E  53  723   87       HH  WG        E        YYY   LY   Y Y         WIAK               
   169   60 B Y        -     0   0   44  737    7       YF  YY        Y        HHY   YY   Y Y         YYYY               
   170   61 B P    >>  -     0   0   20  737   66       AA  AA        A        KKA   PA   A T         ADND               
   171   62 B D  T 34 S+     0   0  148  739   65       DV  SD        A        DDD   DD   G D         PPQP               
   172   63 B T  T 34 S+     0   0   90  739   62       SS  SS        S        SSS   SS   S S         AKKK               
   173   64 B V  T X> S+     0   0    1  740   43       VA  VV        V        VVV   VV   V V         VFFF               
   174   65 B K  B 3< S+l  177   0C 142  739   35       QQ  QK        K        KKK   KK   K K         EQKQ               
   175   66 B G  T 34 S+     0   0   74  739   36       AG  GG        G        GGG   GG   G G         GGGG               
   176   67 B R  T <4 S+     0   0   36  739   21       RR  RR        R        RRR   RR   R R         RKKK               
   177   68 B F  E  <  -lM 174 192C   2  740   67       FF  FF        F        FFF   FF   F F         FAAA               
   178   69 B T  E     - M   0 191C  79  740   38       TT  TT        T        TTT   IS   T T         TSTT               
   179   70 B I  E     + M   0 190C   5  740   22       II  II        I        III   II   T T         IILI               
   180   71 B S  E     - M   0 189C  51  736   45       SS  SS        S        SSS   SS   S S         STTT               
   181   72 B R  E     - M   0 188C  30  739   68       RR  RW        R        RRR   RR   R R         RAAA               
   182   73 B D  E > > - M   0 187C  60  738    5       NN  DD        D        DDD   DD   D D         DDDD               
   183   74 B N  G > 5S+     0   0   48  739   59       DD  NK        D        NNN   NN   N N         DTKT               
   184   75 B A  G 3 5S+     0   0   99  739   41       SS  GA        S        ATV   AS   A A         GSSS               
   185   76 B K  G < 5S-     0   0  111  740   54       KK  QN        K        KKK   KN   K K         QSSS               
   186   77 B N  T < 5 +     0   0   62  740   46       NN  SS        S        NND   NN   N N         SNSN               
   187   78 B T  E   < -KM 132 182C  16  740   68       TT  TL        I        MMM   TT   T T         MTTT               
   188   79 B L  E     -KM 131 181C   0  737   61       LL  LL        A        VVL   LL   L L         VAAA               
   189   80 B Y  E     -KM 130 180C  41  737   41       YY  YS        Y        YYY   YH   Y Y         YYYY               
   190   81 B L  E     -KM 129 179C   0  739    8       LL  LL        L        LLL   LL   L L         LLML               
   191   82 B Q  E     -KM 128 178C  76  739   41       QQ  QQ        Q        QQQ   QE   Q Q         QQEQ               
   192   83 B M  E     +KM 127 177C   0  740   11       MM  MM        M        MMM   MM   M M         MLLL               
   193   84 B S        +     0   0   42  740   54       NL  NN        N        NNN   NN   D D         NSSS               
   194   85 B S  S    S-     0   0   68  739   23       TS  DS        S        SSS   ST   R R         SSSS               
   195   86 B L        -     0   0    3  740   16       GL  LL        L        LLL   LL   L L         LLLL               
   196   87 B K    >   -     0   0  102  740   70       EQ  KK        K        KKK   RR   T T         KTTT               
   197   88 B S  G >  S+     0   0   70  740   59       AA  AT        T        PPP   AT   Q Q         ASSS               
   198   89 B E  G 3  S+     0   0  126  740   21       ZZ  EE        E        EEE   EE   E E         EEEE               
   199   90 B D  G <   +     0   0    2  740    3       BB  DD        D        DDD   DD   D D         DDDD               
   200   91 B T    <   +     0   0   32  740   32       TT  TT        T        TTT   TT   T T         TTST               
   201   92 B A  E    S- R   0 223E   8  737    4       AA  AA        A        AAA   AA   A A         AAAA               
   202   93 B M  E     -PR 148 222E  58  739   46       VL  TL        V        VVV   VL   L L         TVVV               
   203   94 B Y  E     -PR 147 221E   0  739    1       YY  YY        Y        YYY   YY   Y Y         YYYY               
   204   95 B Y  E     -P  146   0E   7  740    4       YY  YY        Y        YYT   YY   Y Y         YYYY               
   205   96 B d  E     -P  145   0E   0  740    0       CC  RC        C        CCC   CC   C C         CCCC               
   206   97 B V  E     -PS 144 217E   0  740   24       AA  AA        T        AAA   AA   A A         AATA               
   207   98 B R  E     -PS 143 216E  21  739   39       rr  kt        r        aav   rk   t i         kRRR               
   208   99 B H  E     + S   0 214E   6  629   94       pa  ye        v        ppp   ts   s e         t..W               
   209  100 B E  E  >  + S   0 213E  63  676   73       GV  IT        E        VVV   GQ   Q S         D..G               
   210  101 B Y  T >4 S-     0   0   80  702   91       GA  CT        N        GGG   GG   C Q         SWYN               
   211  102 B Y  T 34 S-     0   0  140  709   44       YF  LF        W        FFF   NY   F F         IyyY               
   212  103 B Y  T 34 S+     0   0   39  264   90       ..  N.        .        ...   ..   . .         .yy.               
   213  104 B A  E <<  -S  209   0E   0  447   85       F.  S.        .        ...   S.   . .         .AAA               
   214  105 B M  E     +S  208   0E   0  580   59       S.  I.        F        ...   LF   . .         .MMM               
   215  106 B D  E     +     0   0E  19  696   48       DD  D.        D        AAA   DD   . .         DDDD               
   216  107 B Y  E     -S  207   0E  99  702   57       VV  A.        P        YYY   VP   Q N         AYYY               
   217  108 B W  E     -S  206   0E  23  731    0       WW  WW        W        WWW   WW   W W         WWWW               
   218  109 B G        -     0   0    0  714   13       GG  GT        G        GGG   GG   T T         GGGG               
   219  110 B Q        -     0   0   91  701   38       QQ  R         Q        QQQ   RQ   T T         RQQQ               
   220  111 B G        -     0   0   16  687   10       GG  G         G        GGG   GG   K K         GGGG               
   221  112 B T  E     -R  203   0E  21  675   26       TT  T         T        TTT   VT   S T         TTTT               
   222  113 B T  E     -R  202   0E  72  661   75       LK  S         L        QQQ   LL   V V         SSSS               
   223  114 B V  E     -R  201   0E   0  654   18       VV  V         V        VVV   VV   I I         VVVV               
   224  115 B T  E     -n  120   0D  36  643   13       SS  T         T        TTT   TT   A A         TTTT               
   225  116 B V  E     +n  121   0D   6  626    6           V         V        VVV   VV   T T         VVVV               
   226  117 B S        -     0   0   36  616    5           S         S        SSS   SS               SSSS               
   227  118 B S  S    S+     0   0   84  597   20           S         S        SSS   SS               SSSS               
   228  119 B A  S    S+     0   0   70   97   58                                    A                                   
   229  120 B W        -     0   0  123   87   40                                    S                                   
   230  121 B R        +     0   0  207   62   76                                    T                                   
   231  122 B H              0   0  156   56   69                                    K                                   
   232  123 B P              0   0  155   28   53                                    G                                   
## ALIGNMENTS  561 -  630
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....7....:....8....:....9....:....0....:....1....:....2....:....3
     1    1 A D              0   0  183  423   16  D   DD D D  D  DD      DDD D   DDEDDDDDQD DDD E DD  QE  D  ND  QQ     
     2    2 A I        -     0   0   32  466   12  I   IIII V LIIIIII     III I   IVIIIIVIII III I VV  IVVII  II  II     
     3    3 A E        -     0   0  117  468   68  Q   VVME V VVVVQQQ     TMK A   VVVVVVQTVV VQV I LV  VVEVV  MT  VV     
     4    4 A L  E     -A   25   0A  10  482    7  M   MMLL MMLLLLMMM     MMM M   MMMLLMMMLL LML L MM  LMMLL  MM  LL     
     5    5 A T  E     -A   24   0A  64  482    8  T   SSTT TTTTTTTTT     TTT T   TTTTTTITTT TTT T TS  TTTTT  TT  TT     
     6    6 A Q  E     -A   23   0A  13  482    0  Q   QQQQ QQQQQQQQQ     QQQ Q   QQQQQQQQQQ QQQ Q QQ  QQQQQ  QQ  QQ     
     7    7 A T  E    S+A   22   0A  64  482   35  S   SSSS TTTSSSSSS     SSS T   TTSSSSSSSS SSS S TS  STTSS  SS  TT     
     8    8 A P        -     0   0   46  485    9  P   PPP. PPPPPPPPP     PPP P   PPPPPPPPPP PPP P PP  PPPPP  PP  PP     
     9    9 A V  S    S+     0   0   96  489   67  ST ASSAP SASAAASSS     SSS E   AAAAADSGAA ASA A VS  DASAA  SS  EE     
    10   10 A S  E     -d  104   0B  60  491   42  ST TSFSA SSSSSSSSS     SSS S   SSTSSSSSIS ISS T SF  YSPSF  SS  SS     
    11   11 A L  E     -d  105   0B  58  494   23  LM LLLLL KVVLLLLLL     LLL L   VVLLLLLLLL MLL L LL  VVVLL  LL  LL     
    12   12 A S  E     +d  106   0B  60  495   42  SA SAASA SESASSSPS     SPP A   SSSAAASASA SSP S SA  SSSSS  SP  AA     
    13   13 A A  E     -d  107   0B   0  495   58  AA VVVRV AVAKRRAAA     VVV V   EEVVVVAVAV AAM V VV  VEAGA  AV  VV     
    14   14 A S    >   -     0   0   47  496   31  SS TSSSS AAASSSSSS     SSS S   PPSSSSSSFS SSS S SS  SPASS  SS  SS     
    15   15 A V  T 3  S+     0   0   76  496   66  VP PVVAP VVVQPPVVL     PHR P   VVPLLLLPPL PLL P LV  PVVPP  PP  PP     
    16   16 A G  T 3  S+     0   0   42  496    5  GG GGGGG GGGGGGGGG     GGG G   GGGGGGGGGG GGG G GG  GGGGG  GG  GG     
    17   17 A E    <   -     0   0   71  496   36  DE DEEEE DGGEEEDDD     DDD D   GGEQQEDQEQ EQQ E DE  EGGED  DD  DD     
    18   18 A T        -     0   0   69  496   62  RK RKKTR TTTTRRRTT     RRR R   TTRRRRIRKR KRR R QK  TTTRR  RR  TT     
    19   19 A V  E     - B   0  75A  11  496   36  VI VVVVV VVVVVVVVV     VVV V   VVAAAAVVVA VVA A AV  AVVVV  VV  VV     
    20   20 A T  E     - B   0  74A  67  495   29  TT STTTT TTTTTTPtT     TTI T   TTTTTTTTTT TST T ST  TTTTT  TT  TT     
    21   21 A I  E     - B   0  73A   1  494   17  FI LMMII IIIIIISiI     ILI I   IILIIIMIMI ILI L IM  LIIII  II  II     
    22   22 A T  E     -AB   7  72A  29  494   59  IT SSSSS KKKNSSPSR     TTT N   KKSSSNTNTS TTS S SS  TKNSN  TT  RR     
    23   23 A b  E     -AB   6  71A   0  495    1  CC CCCCC CCCCCCGCC     CCC C   CCCCCCCCCC CCC C CC  CCCCC  CC  CC     
    24   24 A R  E     -AB   5  70A 110  495   47  QS RKKRR QQQKKKHRQ     RRR K   QQRRRKQRRR NRK R RK  KQQKK  GR  KK     
    25   25 A A  E     -A    4   0A  10  495   28  AA ASSAA AAAAAAAAA     AAA A   TAAAASAAAA AAA A SS  AAAAA  AA  AA     
    26   26 A S  S    S+     0   0   66  495    4  SS SSSTS SSSSSSSSS     SSS S   SSSSSSSSSS SSS S SS  SSSSS  SS  SS     
    27   27 A E  S    S-     0   0  101  495   38  QS QQQED QEQQQQEQQ     QEQ S   QQQKKQQQSK SQQ Q QQ  SQEQE  QE  SS     
    28   28 A N        +     0   0   83  495   45  DS SSSSS SDSSSSGSG     SGD S   SSSSSSGSSS SDS S SS  SSDSS  ND  SS     
    29   29 A I    >   -     0   0    5  496   32  II ILLLV IIIVVVIII     III L   IIVVVITVVV VIL V IL  VIILI  II  LL     
    30   30 A Y  T 3   -     0   0  155  496   81  As SlltS SYSSssSSN     NSG t   DYSsslNSSs SGd S vl  SSYnt  NY  tt     
    31   31 A S  T 3  S+     0   0   53  471   64  Nn DnnqT SSSSssSNN     SSS d   DSNssnIN.n .Is T tn  NSSsd  SD  qq     
    32   32 A Y    <   +     0   0   63  495   53  HY YYYNL YLYYYYWYE     WYY Y   YNNYYYNYYY YNY N YY  WYLYF  WS  RL     
    33   33 A L  E     -E   90   0B   0  495    7  LL LLLLM LLLLLLLLL     LLL L   LLLMMLLVMM MLM L LL  LLLLL  LL  LL     
    34   34 A A  E     -E   89   0B   0  495   71  NH HAAHH SANNNNAHN     VNN A   SAAHHANAHH HHN A EA  ASAHS  AH  AA     
    35   35 A W  E     -EF  88  48B   1  496    0  WW WWWWW WWWWWWWWW     WWW W   WWWWWWWWWW WWW W WW  WWWWW  WW  WW     
    36   36 A Y  E     -EF  87  46B   0  496    8  YY YYYYY YYYYYYYYY     HYY Y   YYYYYYFYYY FLY Y YY  YYYYY  YY  YY     
    37   37 A Q  E     -EF  86  45B   7  496   27  QQ QQQQQ QQQQQQQQQ     QQQ Q   QQQQQQQQQQ QQQ Q LQ  QQQQQ  QQ  QQ     
    38   38 A Q  E     -E   85   0B  21  496    4  KQ QQQQQ QQQQQQQKQ     QQQ Q   QZQQQQQQQQ QQQ Q QQ  QQQQK  QQ  QQ     
    39   39 A K    >   -     0   0   51  495    8  KK KKKKK KKKKKKKKK     KKK K   KKKKKKKKKK KEK K KK  KKKKK  IR  KK     
    40   40 A Q  T 3  S+     0   0  190  496   18  PP SPPPP PPPPPPPPP     PPP T   PPPPPPPPPP PPP P PP  SPPPP  PP  SS     
    41   41 A G  T 3  S+     0   0   86  496   10  GG HGGGG GGGGGGGGG     GGG G   GGGGGGGGGG GDG G GG  GGGGG  GG  GG     
    42   42 A K  S <  S-     0   0  126  495   54  EF EQQQQ QQQQQQKQA     KQQ Q   QQQQQQKQSQ TGQ Q QQ  QQQQQ  QK  QQ     
    43   43 A S        -     0   0   21  495   56  AS SSSAQ PPPTAAAAS     AAA A   PPPPPPASSP STP A SS  APPVA  AA  AA     
    44   44 A P        -     0   0    4  495   10  PP PPPPP PPPPPPPPP     PPP P   PPPPPPPPPP PIP P PP  PPPPP  PP  PP     
    45   45 A Q  E     -F   37   0B  74  495   32  KK RKKRK KKKKRRKKK     KKK K   KKRKKKKRKK KKK R KK  KKKRR  KK  KK     
    46   46 A F  E     +F   36   0B  25  495   41  FL LLLLL LLLLLLLLL     RLV L   GLLLLLLLPL LRL L LL  LRLLL  LL  LL     
    47   47 A L  E     +     0   0B   4  495    9  LL LLLLL LLLLLLLLL     LLL L   LLLLLLLLWL WLL L LL  LLLLL  LL  LL     
    48   48 A V  E     -FG  35  54B   0  496    5  II IIIII IIIIIILII     III I   IIIIIIIIII III I II  IIIII  II  II     
    49   49 A Y  E >> S+ G   0  53B  39  496   17  YY KYYYY YYYYYYYSY     YKY Y   YYYYYYYYYK YYY Y YY  YYYYY  YY  YY     
    50   50 A N  T 34 S-     0   0   52  496   91  DR YWWDL RSQRYDKYA     KYV L   RKGLLWGYAY SAA G KW  GKSYW  KG  NH     
    51   51 A A  T 34 S+     0   0    3  496   44  GT AAAAA AAAIAAAAA     AAA A   AAAAAAAATA TTA A IA  AAAAA  AA  AG     
    52   52 A K  T <4 S+     0   0  148  496   25  SS SSSTS SSSSNNPTS     SNN S   SSSSSSSSSS SSS S SS  SSSNK  SS  SS     
    53   53 A T  E  <  -G   49   0B  47  496   68  FN QTTNH TTTNSNGST     NIS T   TTTNSTISNY NSN I NT  TTYKN  NN  TS     
    54   54 A L  E     -G   48   0B  60  496   59  LL SRRLL LLLRLLLLL     LLL R   LLRLLRLRLL LLL R RR  RLLLL  LL  RL     
    55   55 A G    >   -     0   0    9  495   70  KA IEEAE EAAAAAQAQ     QEQ A   AEAEEEEAAE AGE A FE  HAAAE  QQ  QQ     
    56   56 A E  T 3  S+     0   0  192  495   35  TS SSSSS SSSSSSSSS     SSS S   SSTSSSDTSS SSS T SS  TSSSS  SP  SS     
    57   57 A G  T 3  S+     0   0   70  496    5  GG GGGGG GGGGGGGGG     GGR G   GGGGGGGGGG GGG G GG  GGGGG  GG  GG     
    58   58 A V    <   -     0   0   25  494   10  VV IVVVV VVVVVVVVV     VVV I   VVIVVVVIVV VVI I VV  TVVVV  IV  VV     
    59   59 A P    >   -     0   0   47  495    7  PP PPPPP PPPPPPPPP     PPP P   PPPPPPPPPP PPP S PP  PPPPP  PP  PP     
    60   60 A S  T 3  S+     0   0  115  496   56  ST SDDGA SSSDAASSS     ASL D   SSAAADSDTA AKA A DD  EPSAD  SS  DS     
    61   61 A R  T 3  S+     0   0   44  496    4  RR RRRRR RRRRRRMRR     RRR R   RRRRRRRRRR RRR R RR  RRRRR  RR  RR     
    62   62 A F  E <   +C   75   0A   5  496    1  FF FFFFF FFFFFFFFF     FFF F   FFFFFFFFFF FFF F FF  IFFFF  FF  FF     
    63   63 A S  E     -C   74   0A  55  495   23  SS STTRS KKKSSSSSS     SSS S   RKSSSSSSSS SSS S ST  SKKSS  SS  SS     
    64   64 A G  E     +C   73   0A  13  496    2  GG GGGGG GGGGGGGGG     GGG G   GGGGGGGGGG GGG G GG  GGGGG  GG  GG     
    65   65 A S  E     +C   72   0A  63  496    6  GS SSSSS SSSSSSSSS     SSS S   SSSSSSSSSS SSS S SS  SSSSS  SS  SS     
    66   66 A G  E     -C   71   0A  36  496   14  GG GGGGG GGGGGGGGG     GGG G   GGGGGGRGGG GRG G GG  GGGGG  GG  GG     
    67   67 A S  E >   +C   70   0A  79  496    9  SS SSSSS SSSSSSSSY     SSC S   SSSSSSYSSS SSS S SS  SSSSS  SS  SS     
    68   68 A G  T 3  S-     0   0   16  496   12  AG GGGGG GGGGGGGGG     GGG G   GGGGGGGGGG GGG G GG  GGGGG  GG  GD     
    69   69 A T  T 3  S+     0   0   67  495   13  TT STTTT TTTTTTTTT     TTT T   TTTTTTTTTT TST T TT  TTTTT  AT  TT     
    70   70 A Q  E <   +BC  24  67A 110  496   29  NS DDDDD QEEYDDEDD     DDD D   DDEDDDDDSD SDD E DD  DQEDD  DD  DD     
    71   71 A F  E     -BC  23  66A   2  494    5  FY FFFFF FFFFFFFFF     YFF F   FFFFFFFFYF YYF F FF  FFYFF  YY  YF     
    72   72 A S  E     -BC  22  65A  26  495   30  TS TTTTT TTTTTTTTT     TTT T   TTTTTTTTST SST T TT  TTTTT  TT  TT     
    73   73 A L  E     -BC  21  64A   0  496    2  VL LLLLL LLLLLLLLL     LLL L   LLLLLLLLLL LLL L LL  LLLLL  FL  FL     
    74   74 A K  E     -BC  20  63A  97  496   38  TT STTTT TTTTTTTTT     TTT T   TTTNNTTSTN TTN N KT  TTTTT  TT  TT     
    75   75 A I  E     -BC  19  62A   0  496    1  II IIIII IIIIIIIII     III I   IIIIIIIIII III I II  IIIII  II  II     
    76   76 A N  S    S-     0   0   86  496   29  SG NSSSD SNSNSSSSS     SSS N   SSSHQSSSSH SSH T SS  SSSSS  SS  SN     
    77   77 A S  S    S-     0   0   58  496   62  ST SSSSP DGDNSSSGG     SSS R   DDRPPSSNRP RSP S RS  RDGSN  SS  RR     
    78   78 A L        -     0   0    0  496   27  LM VVVLV LVLFLLLLL     VVL V   LLLVVLLLVV MLV L VV  MLVLM  ML  VV     
    79   79 A L    >   -     0   0   67  496   31  QE EKKEE EQEQEEQKQ     DEE E   EEQEEQEQEE EEE Q EK  EEQEE  DE  EE     
    80   80 A P  G >  S+     0   0   92  496   59  PA PAAPA CCCAPPPPA     PPP A   CCSEEADAAE ASE S AA  ACCPA  PP  AA     
    81   81 A E  G 3  S+     0   0  102  496   15  EE EEEED ADADEEEEE     EEE D   AAEEEEEEEE EEE G EE  EDDEE  EE  DE     
    82   82 A D  G <  S+     0   0    1  496    5  DD DDDDD DDDDDDYDD     DDD D   DDDDDDDDDD DDD D DD  DDDDD  DD  DD     
    83   83 A F    <   +     0   0   29  495   73  FV VLLAT AAAAGAFFA     VVV A   AAFAAVMVVA AFA L LL  AAAAS  VV  AA     
    84   84 A G  E    S- H   0 105B  17  496   23  AA GAAGA AAAAGAAAA     AAT G   AAAAAAAGAA AVA A GA  AAAAA  AA  GG     
    85   85 A S  E     -EH  38 104B  24  496   62  TT VVVET TTTVDHTTT     TDT D   TTVTIVTDTT TAT L VV  DTTHV  TN  ND     
    86   86 A Y  E     -EH  37 103B   0  496    0  YY YYYYY YYYYYYYYY     YYY Y   YYYYYYYYYY YYY Y YY  YYYYY  YY  YY     
    87   87 A Y  E     -E   36   0B   5  495    4  YY YYYYY YYYYYYYHY     YYY Y   YFYYYYFYYY YYY F YY  YYYYY  YH  YY     
    88   88 A b  E     -E   35   0B   0  496    0  CC CCCCC CCCCCCCCC     CCC C   CCCCCCCCCC CCC C CC  CCCCC  CC  CC     
    89   89 A Q  E     -EI  34  99B   0  494   48  QQ QQQQQ QQQQQQQQQ     QQQ Q   QQQQQQLQLQ QLQ Q FQ  QQQQQ  QL  KQ     
    90   90 A H  E     -E   33   0B  22  486   28  QQ NQQQQ SGSQHQQQN     QQQ Q   SGQHHQQHQH QQQ Q QQ  HSCQQ  QQ  QQ     
    91   91 A H        +     0   0    0  423   89  YG GYYSS NGTGYYFSD     HSY S   TSYSSY.HWS RYS Y AY  TNTSH  HT  HS     
    92   92 A Y  S    S+     0   0  104  454   87  HS HYYNW YYYNKKSNY     NNN Y   YBNRRYHYTG SAS G SY  DYYRL  NN  YR     
    93   93 A G  S    S-     0   0   34  421   71  HS S.SSN YYGNSSSSV     SSS E   GYN..NTSSE SSE D HS  VGYSK  SS  TS     
    94   94 A T  S    S-     0   0  104  444   88  LI FSYFD SSSPYYAAF     NYL T   VTWEELYYNF YSD W FY  TSSSL  YF  TD     
    95   95 A P  S    S+     0   0    7  441   51  PP PYPPP SGSPLPLPC     PPP P   GGPLLPLPPP PPP P PP  LSSPP  PP  PP     
    96   96 A P  S    S-     0   0   55  420   76  FR LPP W SSSPSlPSS     PPP     FTPPPWPPPP LYP P RP  WSSlP  PP         
    97   97 A L        -     0   0   21  151   88  .Y .R. . ....Hq...     ..T     ..WLL.Y..W ... Y ..  RS.q   ..         
    98   98 A T        -     0   0   40  278   41  TT TTT T ...TSC.T.     ..V     .VTTTTT.TT TTT T TT  TS.C   ..         
    99   99 A F  B     -I   89   0B  18  277   26  FF FFF F ... AF. F     ..I     .FFFFFF.FF FFF F FF  FYYF   ..         
   100  100 A G        -     0   0    3  285   38  GG GGG G NGN SS. W     ..Q     GGGGGGG.GG GGG G GG  GGGR   ..         
   101  101 A G        -     0   0   52  300   63  PG AGG G GTG EQ. P     TTA     GGQAAQG.AG AGG Q GS  GAAP   TT         
   102  102 A G        -     0   0   11  300   41  GG GGG G SDS GG. G     VVM     GGGGGGG.GG GGG G GG  G  A   VV         
   103  103 A T  E     - H   0  86B   0  360   19  TT TTT T TTT A T F     TTT     TTTTTTTTTT TTT T TT  T  Q   TT         
   104  104 A K  E     -dH  10  85B  98  359   60  KK KKK K VTV K V G     QQK     EERKKKKVKK KKK K KK  R  K   QQ         
   105  105 A L  E     -dH  11  84B   4  343   39  VL LLL L IVI A L L     AA      VVVLLVLLLL LLL L LL  V  L   AA         
   106  106 A E  E     -d   12   0B 108  326   52  DE EEE E Q Q E H N     MM      VVEEEEEQEE EEE E EE  E      MM         
   107  107 A I  E      d   13   0B 113  295   51  FI III L     G T L     TT      VVILLII LI LII I II  I      IT         
   108  108 A K              0   0  145  261   18  KK KKK K     R R       KK      KKKKKKK K  KKK K KK  K      KK         
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30    E     Q         EQQE                   E   Q Q  ED     QQ           
   111    2 B V        +     0   0   19  428   12    V     V         VVVV    V              V   V V  VV     VV  VV       
   112    3 B K  E     -J  134   0C 111  430   32    Q     Q         QZQQ    Q              Q   Q Q  KQ     QQ  QQ       
   113    4 B L  E     -J  133   0C   3  452    1    L     L         LLLL    L              L   L L  LL     LL  LL       
   114    5 B Q  E     -J  132   0C  83  454   70    Q     V         VVVV    V              Q   Q Q  LV     VQ  VV       
   115    6 B E  E     +J  131   0C   5  458   22    Q     Q         EZEE    E              Q   Q E  EE     QQ  EE       
   116    7 B S  E     +J  130   0C  69  463   14    S     S         SSSSS   S              S   P S  SS     SP  SS       
   117    8 B G        +     0   0   36  467    4    G     G         GGGGE   G              G   G G  GG     GG  GG       
   118    9 B G        +     0   0   29  718   50    P     G         GGGGP   G AAA          P   T G  GG     GA  GG  AAAA 
   119   10 B D        -     0   0   96  725   42    E     G         GGGGV   G EEE          E   E R  GD     GE  GG  EEEE 
   120   11 B L  E     +n  224   0D  79  727   14    L     V         LAVLI   L LLL          L   L S  LL     LL  LL  LLLLL
   121   12 B V  E     -n  225   0D  16  729   31    V     V         AVVVK   Q VVV          V   V V  VR     VV  QQ  MAVVV
   122   13 B Q    >   -     0   0  114  730   53    K     Q         KZQQR   Q RRK          K   K Q  QQ     KK  QQ  KRKKA
   123   14 B P  T 3  S+     0   0   66  730    7    P     P         PPAPP   P SPP          P   P S  PP     PP  PP  PPPPP
   124   15 B G  T 3  S+     0   0   58  734   31    G     G         GGGGG   G GGG          G   G G  GG     GG  GG  GGGGS
   125   16 B G    <   -     0   0   25  736   63    A     R         ARTEE   G AAA          A   A G  GG     GA  GG  AAAAQ
   126   17 B S        +     0   0   78  735   29    S     S         FSSSS   S SLS          S   S S  SS     SS  SS  SSSSS
   127   18 B L  E     - K   0 192C  25  737   28    V     L         LLLLH   P VVV          V   V L  LL     LV  LL  VVVVL
   128   19 B K  E     - K   0 191C  93  735   55    K     R         RRRKT   R KKK          K   K R  RS     RK  RR  KKKKS
   129   20 B L  E     - K   0 190C   0  740   16    M     L         LLLLL   L LLL          M   L L  LL     LL  LL  ILLLI
   130   21 B S  E     -JK 116 189C  28  740   37    S     S         TSSST   S SSS          S   S S  SS     SS  SS  SSSST
   131   22 B d  E     -JK 115 188C   0  740    0    C     C         CCCCC   C CCC          C   C C  CC     CC  CC  CCCCC
   132   23 B A  E     -JK 114 187C  52  740   67    K     V         AATTT   K TKT          K   K A  AK     VK  KK  KKTTT
   133   24 B A  E     +J  113   0C   8  740   48    A     A         AAAAA   G AAA          A   A A  AA     AA  GG  AAAAV
   134   25 B S  E     +J  112   0C  58  740   14    S     S         SSSSS   T SSS          S   S S  SS     SS  TT  TSSSS
   135   26 B G  S    S+     0   0   56  739    3    G     G         GGAGG   G GGG          G   G G  GG     GG  GG  GGGGG
   136   27 B F  S    S-     0   0   33  740   31    Y     F         FFFFF   F FFF          Y   Y I  FL     FY  FF  YYFFF
   137   28 B T    >   -     0   0   93  740   53    T     T         TSNST   T NNN          T   T D  TT     ST  DD  TTNNS
   138   29 B F  G >  S+     0   0    2  740   28    F     F         FFLYF   F TII          F   F V  FS     FF  FF  FFIIL
   139   30 B S  G 3  S+     0   0   57  740   55    T     S         SSSSS   S KKK          T   T N  AS     RT  SS  STKKT
   140   31 B S  G <  S+     0   0   71  740   57    D     T         DTDNS   S DDD          D   S R  DY     DS  DD  SSDDD
   141   32 B Y  S <  S-     0   0   44  738   42    Y     Y         YYYYY   L YYT          Y   Y N  FY     FY  FF  YYTTY
   142   33 B T        -     0   0   30  739   92    Y     A         WAAVD   S YYY          Y   W A  YN     YW  DD  WWYYG
   143   34 B M  E     -OP 160 207E   0  739   49    M     M         MMMMM   M MMM          M   M M  MM     MM  MM  IMMMV
   144   35 B S  E     -OP 159 206E   0  740   72    K     H         SHHTH   Q HHH          K   H G  SH     SH  TT  EQHHS
   145   36 B W  E     +OP 158 205E   0  740    0    W     W         WWWWW   W WWW          W   W W  WW     WW  WW  WWWWW
   146   37 B V  E     -OP 156 204E   0  740   17    V     V         VVVVV   V VVV          V   V F  IV     IV  VV  VVVVI
   147   38 B R  E     -OP 155 203E  10  740   21    K     R         HRRRR   R KKK          K   K R  RR     RK  RR  KKKKR
   148   39 B Q  E     -OP 154 202E   9  740    4    Q     Q         QQQQQ   Q QQQ          Q   Q Q  QQ     ZQ  QQ  QQQQQ
   149   40 B T    >   -     0   0    9  739   74    S     A         AAAAT   A RRR          S   R A  SA     TR  AA  RRRRP
   150   41 B P  T 3  S+     0   0   80  740   11    H     P         PPPPP   P PPP          P   P P  PP     PP  AA  PPPPP
   151   42 B E  T 3  S-     0   0  151  740   29    G     G         GGGGG   G EEE          G   G G  GG     GG  GG  GGEEG
   152   43 B K    <   +     0   0  121  740   37    K     R         KKKKK   K QQQ          K   Q T  KK     KR  KK  HQQQK
   153   44 B R        -     0   0  113  739   42    S     G         GGGGG   G GGG          S   G E  AG     GG  GG  GGGGG
   154   45 B L  E     -O  148   0E   9  740   13    L     L         LLLLL   L LLL          L   L R  PL     LL  LL  LLLLL
   155   46 B E  E     -O  147   0E  44  739    4    E     E         EZZEE   E EEE          E   E E  EE     ZE  EE  EEEEE
   156   47 B W  E     +O  146   0E  15  739   11    W     W         WWWWW   W WWW          W   W F  WW     WW  YY  WWWWW
   157   48 B V  E     -     0   0E   0  739   28    I     V         VLVVV   I III          I   I V  LV     VI  VV  IIIIL
   158   49 B A  E     -O  145   0E   0  740   36    G     A         GSATA   A GGG          G   G A  SA     SG  AA  GGGGG
   159   50 B S  E     -OQ 144 168E   0  740   94    D     V         QVLNE   E WWR          D   N G  FR     YR  GG  EARRV
   160   51 B I  E     -OQ 143 167E   4  739   18    I     I         IIIIV   T III          I   I V  IV     II  II  IIIII
   161   52 B N    >   -     0   0   47  740   85    N     S         NSSRS   T DDD          N   N R  RY     GD  NQ  LYDDW
   162   53 B N  T 3  S+     0   0   65  740   86    P     Y         PYYPT   G PPP          P   P W  NS     GP  RR  PPPPG
   163   54 B G  T 3  S-     0   0   65  740   68    N     D         NBGDG   D EEA          N   S S  KN     SN  HD  GGAAG
   164   55 B G  S <  S+     0   0   30  740   50    N     G         GGGES   S NNN          N   N D  AG     GS  GG  SDNNG
   165   56 B G  S    S+     0   0   74  739   59    G     N         GBSTS   A GGG          G   G A  nG     SG  NN  GGGGS
   166   57 B R        +     0   0  163  548   85    G     Y         SBBE.   K DNN          G   G Y  tS     TG  DD  SDNN.
   167   58 B T  E     -Q  160   0E  62  724   48    T     K         TZTKK   T TTT          T   T T  TT     LT  PP  TTTTT
   168   59 B Y  E     +Q  159   0E  53  723   87    S     Y         YYYFY   W GIK          S   N D  EN     YK  DD  NRKKY
   169   60 B Y        -     0   0   44  737    7    Y     Y         FYYYY   Y YYY          Y   Y Y  YY     YY  YY  YYYYY
   170   61 B P    >>  -     0   0   20  737   66    N     A         TAASS   A ADD          N   N A  NA     AN  AA  NTDDN
   171   62 B D  T 34 S+     0   0  148  739   65    Q     D         DADDQ   P PPP          Q   E D  PD     DE  DD  EQPPS
   172   63 B T  T 34 S+     0   0   90  739   62    K     S         SSSSS   S KKK          K   R S  SS     SK  AA  KKKKA
   173   64 B V  T X> S+     0   0    1  740   43    F     V         VVVVV   V FFF          F   F V  VV     VF  LV  FFFFL
   174   65 B K  B 3< S+l  177   0C 142  739   35    K     K         KKR.Q   E QQQ          K   K K  KK     KK  EQ  KKQQK
   175   66 B G  T 34 S+     0   0   74  739   36    G     G         GGG.G   G GGG          G   G G  GG     GS  GG  GGGGS
   176   67 B R  T <4 S+     0   0   36  739   21    K     R         WRRRR   R KKK          K   K R  RR     RK  RR  KKKKR
   177   68 B F  E  <  -lM 174 192C   2  740   67    A     F         SFFFF   F AAA          A   A F  FF     FA  FF  AAAAL
   178   69 B T  E     - M   0 191C  79  740   38    T     S         TTTTT   T TST          T   T T  TT     TT  TT  TTTTS
   179   70 B I  E     + M   0 190C   5  740   22    L     I         IIIVI   I MII          L   L I  II     IL  II  FLIII
   180   71 B S  E     - M   0 189C  51  736   45    T     S         SSSSS   S TTT          T   T S  SS     ST  SS  TTTTS
   181   72 B R  E     - M   0 188C  30  739   68    V     R         RRRRR   R AAA          V   S R  RW     RV  RR  AAAAK
   182   73 B D  E > > - M   0 187C  60  738    5    D     D         DBBDD   D DDD          D   D D  DD     DD  DD  DDDDD
   183   74 B N  G > 5S+     0   0   48  739   59    K     N         NBINN   N TTT          K   K N  DK     NK  NN  TKTTN
   184   75 B A  G 3 5S+     0   0   99  739   41    S     S         ASSAS   G SSS          S   S N  TA     AP  GG  SSSSS
   185   76 B K  G < 5S-     0   0  111  740   54    S     N         KKKRK   Q SSS          S   S K  QS     QS  QQ  SSSSK
   186   77 B N  T < 5 +     0   0   62  740   46    S     N         NBBNQ   S NNN          S   S N  NS     KS  SS  NSNNS
   187   78 B T  E   < -KM 132 182C  16  740   68    T     T         TTTSQ   T TTT          T   T T  VL     ST  TT  TTTTQ
   188   79 B L  E     -KM 131 181C   0  737   61    A     L         LMLVV   L AAA          A   A V  LL     LA  VV  AAAAV
   189   80 B Y  E     -KM 130 180C  41  737   41    Y     H         YYYSY   Y YYY          Y   Y Y  YS     YY  YY  YYYYF
   190   81 B L  E     -KM 129 179C   0  739    8    M     L         LLLNL   L LLL          M   M L  LL     LM  LL  MMLLL
   191   82 B Q  E     -KM 128 178C  76  739   41    Q     E         QEZSE   Q QQQ          Q   E Q  QQ     ZQ  QQ  QQQQK
   192   83 B M  E     +KM 127 177C   0  740   11    L     M         MMMMM   M LLL          L   L M  MM     ML  MM  LLLLM
   193   84 B S        +     0   0   42  740   54    N     N         NNKFN   N SSS          N   S G  NN     BS  NN  SSSSN
   194   85 B S  S    S-     0   0   68  739   23    S     T         SSTLS   S SSS          S   S S  TS     SS  SS  SSSSS
   195   86 B L        -     0   0    3  740   16    L     L         LLLQL   L LLL          L   L L  LL     LL  LL  LLLLL
   196   87 B K    >   -     0   0  102  740   70    T     R         KRRRK   K TTT          T   T E  RK     RT  KK  TATTQ
   197   88 B S  G >  S+     0   0   70  740   59    S     T         TATVT   A SSS          S   S A  AT     TS  AA  SSSST
   198   89 B E  G 3  S+     0   0  126  740   21    E     E         EEEEE   E EEE          E   E G  EE     ZE  EE  EEEED
   199   90 B D  G <   +     0   0    2  740    3    D     D         DNDDD   D DDD          D   D D  DD     BD  DD  DDDDD
   200   91 B T    <   +     0   0   32  740   32    S     T         TTTTS   T TTT          S   S T  TT     TS  TT  SSTTT
   201   92 B A  E    S- R   0 223E   8  737    4    A     A         AAAAA   G AAA          A   A A  AA     AA  AA  AAAAA
   202   93 B M  E     -PR 148 222E  58  739   46    V     L         VVVTV   T VVV          V   V L  IL     VV  TT  VVVVM
   203   94 B Y  E     -PR 147 221E   0  739    1    Y     Y         YYYYY   Y YYY          Y   Y Y  YY     YY  YY  YDYYY
   204   95 B Y  E     -P  146   0E   7  740    4    Y     Y         YYYYY   Y YYY          Y   Y Y  YY     YY  YY  YYYYY
   205   96 B d  E     -P  145   0E   0  740    0    C     C         CCCCC   C CCC          C   C C  CC     CC  CC  CCCCC
   206   97 B V  E     -PS 144 217E   0  740   24    A     A         TAAAA   A NAA          A   A A  AA     AA  AT  AAAAA
   207   98 B R  E     -PS 143 216E  21  739   39    R     k         krkrR   k lrR          R   r a  kt     aR  rr  rrrrk
   208   99 B H  E     + S   0 214E   6  629   94    .     s         hltfE   a ny.          .   r a  ta     w.  yy  rytyy
   209  100 B E  E  >  + S   0 213E  63  676   73    D     Q         EGRGS   S LD.          .   G A  TG     S.  PP  RDGGG
   210  101 B Y  T >4 S-     0   0   80  702   91    R     G         FSBDH   K YGS          D   Y G  AT     TY  SS  YYDNN
   211  102 B Y  T 34 S-     0   0  140  709   44    Y     Y         FVFYl   V YyY          y   Y Y  VH     Fy  FF  YYAYY
   212  103 B Y  T 34 S+     0   0   39  264   90    Y     .         .A..s   . YyY          y   . .  ..     .y  ..  ....Y
   213  104 B A  E <<  -S  209   0E   0  447   85    A     .         SG.GK   . AAG          V   . .  ..     SA  ..  AA.PA
   214  105 B M  E     +S  208   0E   0  580   59    M     F         LT.PL   . MMS          F   F .  .G     LM  II  MMMFM
   215  106 B D  E     +     0   0E  19  696   48    D     D         SD.DS   D DDD          D   D S  KQ     BD  DD  DDDDD
   216  107 B Y  E     -S  207   0E  99  702   57    Y     P         SY.FV   A YYY          Y   Y Y  MD     YY  AA  YYYYY
   217  108 B W  E     -S  206   0E  23  731    0    W     W         WWWWW   W WWW          W   W W  WW     WW  WW  WWWWW
   218  109 B G        -     0   0    0  714   13    G     G         CGGGG   G GGG          G   G G  GG     GG  GG  GGGGG
   219  110 B Q        -     0   0   91  701   38    Q     Q         AZQQQ   R QQQ          Q   Q Q  LP     ZQ  RR  QQQQQ
   220  111 B G        -     0   0   16  687   10    G     G         GGGGG   G GGG          G   G G  GI     GG  GG  GGGGG
   221  112 B T  E     -R  203   0E  21  675   26    T     T         ATTTS   T TTT          T   T T  KA     BT  TT  TTTTT
   222  113 B T  E     -R  202   0E  72  661   75    S     L         SLLLT   S SST          T   T Q  IG     LS  SS  SSSTS
   223  114 B V  E     -R  201   0E   0  654   18    V     V         AVVVF   V VVL          L   L V  IV     VV  VV  VVVLV
   224  115 B T  E     -n  120   0D  36  643   13    T     T         GTTST   T TTT          T   T T  GR     T   TT  TTTTT
   225  116 B V  E     +n  121   0D   6  626    6    V     V         AIVV    V VVV          V   V V   V     V   VV  VVVVV
   226  117 B S        -     0   0   36  616    5    S     T         SSST    S SSS          S   S S   G     S   SS  SSSSS
   227  118 B S  S    S+     0   0   84  597   20    S     S         ES S    S SSS          S   S S   T     S   SS  SSSSS
   228  119 B A  S    S+     0   0   70   97   58                    G                                                   
   229  120 B W        -     0   0  123   87   40                    A                                                   
   230  121 B R        +     0   0  207   62   76                    G                                                   
   231  122 B H              0   0  156   56   69                    E                                                   
   232  123 B P              0   0  155   28   53                    A                                                   
## ALIGNMENTS  631 -  700
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....4....:....5....:....6....:....7....:....8....:....9....:....0
     1    1 A D              0   0  183  423   16              D DDDDDDDDQ   E   DDDD QKE   D     E       DNNDDDEEEEEEQQD
     2    2 A I        -     0   0   32  466   12              I IIIIIIIVI   I   IIII III L III   V       IIIIIINIIIIIIII
     3    3 A E        -     0   0  117  468   68              V VVVVVVVQL   V   VQQK VVQ V VVV   T       VVVVVVVVVVVVVVT
     4    4 A L  E     -A   25   0A  10  482    7              MMLLLLLMMML   L L LMMMMLMM MLLLL   M       LLLLLMLLLLLLLLM
     5    5 A T  E     -A   24   0A  64  482    8              TTTTTTTTTIT   T T TTTTTTTT TTTTT   T       TTTTTTTTTTTTTTT
     6    6 A Q  E     -A   23   0A  13  482    0              QQQQQQQQQQQ   Q Q QQQQQQQQ QQQQQ   Q       QQQQQQQQQQQQQQQ
     7    7 A T  E    S+A   22   0A  64  482   35              TTSSSSSSSSS   S S STSSSSSS TTSSS   S       SSSSSSSSSSSSSSS
     8    8 A P        -     0   0   46  485    9              PPPPPPPPPPP   P P PPPPPPPP PPPPP   P       PPPPPPPPPPPPPPP
     9    9 A V  S    S+     0   0   96  489   67              SSAAAAADDSA   A G DSSSADSA ASAAA   S       AAAAADAAAAAAAAG
    10   10 A S  E     -d  104   0B  60  491   42              SSSSSSSSSSI   TST SSLSTYSS SPSSS   S       SSSSSSIIIIIIIIS
    11   11 A L  E     -d  105   0B  58  494   23              VVLLLLLLLLM   LLL LLLLLVLL VVLLR   L       LLLLLLMTTTTTMML
    12   12 A S  E     +d  106   0B  60  495   42              SSAAAAAAASS   SAS SASSSSSS SSASA   P       AAAAAAAAAAAASSA
    13   13 A A  E     -d  107   0B   0  495   58              AAVVVVVVVAA   LVL VVAALVAA AAKGA   V       VVVVVVAAAAAAAAV
    14   14 A S    >   -     0   0   47  496   31              AASSSSSSSSS   SSS SSSSSSSS AASSS   S       SSSSSSSSSSSSSSS
    15   15 A V  T 3  S+     0   0   76  496   66              VVLLLLLLLLP   PLP LVVLPPPL VVQPP   H       LLLLLLLLLLLLPPL
    16   16 A G  T 3  S+     0   0   42  496    5              GGGGGGGGGGG   GGG GGGGGGGG GGGGG   G       GGGGGGGGGGGGGGG
    17   17 A E    <   -     0   0   71  496   36              GGQQQQQEEDQ   EQD EEDEEEED GGEEE   D       QQQQQEQQQQQQQQQ
    18   18 A T        -     0   0   69  496   62              TTRRRRRRRIK   RRR RKRRRTRR TTTRR   R       RRRRRRKKKKKKKKR
    19   19 A V  E     - B   0  75A  11  496   36              VVAAAAAAAVV   AAA VVVVAAVV VVVVV   V       AAAAAAVVVVVVVVV
    20   20 A T  E     - B   0  74A  67  495   29              TTTTTTTTTTT   STT TTTTTTTT TTTTT   T       TTTTTTTTTTTTTTT
    21   21 A I  E     - B   0  73A   1  494   17              IIIIIIIIIMM   LIL VMLILLII IIIIM   L       IIIIIIMIIIIIMMM
    22   22 A T  E     -AB   7  72A  29  494   59              KNSSSSSNNTT   SSS NSSSSTNT NSNSS   T       SSSSSNTTTTTTTTN
    23   23 A b  E     -AB   6  71A   0  495    1              CCCCCCCCCCC   CCC CCCCCCCC CCCCC   C       CCCCCCCCCCCCCCC
    24   24 A R  E     -AB   5  70A 110  495   47              QQRRRRKKKQS   RRR KKKRRKKQ QQKKK   R       RRRKKKSSSSSSSSR
    25   25 A A  E     -A    4   0A  10  495   28              AAAAAAASSAA   AAA LSAAAAAA ASAAA   A       AAAAASAAAAAAAAA
    26   26 A S  S    S+     0   0   66  495    4              SSSSSSSSSSS   SSS SSSSSSST SSSSS   S       SSSSSSSSSSSSSSS
    27   27 A E  S    S-     0   0  101  495   38              EEEEEEQQQQS   QEQ QQQEQSEQ EKQQQ   Q       EEEQQQSSSSSSSSQ
    28   28 A N        +     0   0   83  495   45              SDSSSSSSSGS   SSS SSNNSSSG DSRSG   G       SSSSSSSSSSSSSSN
    29   29 A I    >   -     0   0    5  496   32              IIVVVVVVVTV   VVL VLIIVTII IVVVI   I       VVVVVVVVVVVVVVI
    30   30 A Y  T 3   -     0   0  155  496   81              GSdddddllNS   Adr llNNSStN DySsS   S       dddddlsSSSSSSSY
    31   31 A S  T 3  S+     0   0   53  471   64              NAsssssnnI.   Tss nnKNS.dT SnSsD   S       nssssns.......S
    32   32 A Y    <   +     0   0   63  495   53              ENFFFFYYYNY   YYQ YYYISYLW YCYYY   N       FFFYYYYYYYYSYYN
    33   33 A L  E     -E   90   0B   0  495    7              LLMMMMMLLLM   LML LLLLLILL LLLLL   L       MMMMMLLMMMMLMMV
    34   34 A A  E     -E   89   0B   0  495   71              AANNNHNAANY   ANV AANAAAYA ASAHN   H       NHHNNAHHHHHHHHN
    35   35 A W  E     -EF  88  48B   1  496    0              WWWWWWWWWWW   WWW WWWWWWWW WWWWW   W       WWWWWWWWWWWWWWW
    36   36 A Y  E     -EF  87  46B   0  496    8              YYFFFYYYYFY   YYY FYYYYYYY YYYYY   Y       FYYYYYYYYYYYYYY
    37   37 A Q  E     -EF  86  45B   7  496   27              QQQQQQQQQQQ   QQQ QQQQQQQQ QQQQQ   Q       QQQQQQQQQQQQQQQ
    38   38 A Q  E     -E   85   0B  21  496    4              QQQQQQQQQQQ   HQQ QQQKQQHQ QQQQQ   Q       QQQQQQQQQQQQQQQ
    39   39 A K    >   -     0   0   51  495    8              KKKKKKNKKKK   KKK NKKKKKKK KKKKK   K       KKKKKKKKKKKKKKK
    40   40 A Q  T 3  S+     0   0  190  496   18              PPPPPPPPPPP   PPP PPLEPSPP PPPPP   P       PPPPPPSSSSSSSSP
    41   41 A G  T 3  S+     0   0   86  496   10              GGGGGGGGGGG   GGG GGGDGGGG GGGGG   G       GGGGGGGGGGGGGGG
    42   42 A K  S <  S-     0   0  126  495   54              QQQQQQQQQKS   QQQ QQEGQQQK QQQQQ   H       QQQQQQATTTTTTTQ
    43   43 A S        -     0   0   21  495   56              PPPPPPSPPAS   APR PSASAAAA PPAAA   P       PPPPPPSSSSSSSSA
    44   44 A P        -     0   0    4  495   10              PPPPPPPPPPP   PPP PPPVPPPL PPPPP   P       PPPPPPPPPPPPPPP
    45   45 A Q  E     -F   37   0B  74  495   32              KKKKKKKKKKR   RKR KKKKRKRK KKKRR   K       KKKKKKKKKKKKKKR
    46   46 A F  E     +F   36   0B  25  495   41              LLLLLLLLLLL   LLL LLLLLLTF LLLLL   L       LLLLLLPPPPPPRRL
    47   47 A L  E     +     0   0B   4  495    9              LLLLLLLLLLL   LLL LLLLLLLL LLLLL   I       LLLLLLLWWWWWWWL
    48   48 A V  E     -FG  35  54B   0  496    5              IIIIIIIIIII   III IIIIIIII IIIII   I       IIIIIIIIIIIIIII
    49   49 A Y  E >> S+ G   0  53B  39  496   17              YYYYYYYYYYY   YYY YYYYYYYS YYYYW   Y       YYYYYYHYYYYYYYY
    50   50 A N  T 34 S-     0   0   52  496   91              RAAAARAWWGD   DAG WWNYGWWK YRGWD   R       ALLATWREEEEEDDA
    51   51 A A  T 34 S+     0   0    3  496   44              AAAAAAAAAAT   AAV AATTAVAA AAAAA   A       AAAAAATIIIIITTA
    52   52 A K  T <4 S+     0   0  148  496   25              SSSSSSSSSSS   SSS SSNSSSTT SSSNT   N       SSSSSSSSSSSSSSS
    53   53 A T  E  <  -G   49   0B  47  496   68              KDNNNNNTTIN   NNN ATNNSTNI DNKRN   S       NNNNNTNKKKKKKKS
    54   54 A L  E     -G   48   0B  60  496   59              LLQQQLLRRLL   RLR RRLLRRLL LLRLL   L       QLLLLRLLLLLLLLR
    55   55 A G    >   -     0   0    9  495   70              AAGGGEEEEEA   AEA QEQQVHEH AAGAY   Q       GEEEEEAAAAAAADA
    56   56 A E  T 3  S+     0   0  192  495   35              SSSSSSSSSAS   TST SSTSTTST SSSSP   S       SSSSSSSSSSSSSST
    57   57 A G  T 3  S+     0   0   70  496    5              GGGGGGGGGGG   GGG GGGGGGGG GGGGG   G       GGGGGGGGGGGGGGG
    58   58 A V    <   -     0   0   25  494   10              VVVVVIIVVVV   III VVIVITVV VVVVV   V       VVVIIVVVVVVVVVI
    59   59 A P    >   -     0   0   47  495    7              SPPPPPPPPPP   PPP PPPPPPPS PPPPP   P       PPPPPPPPPPPPPPP
    60   60 A S  T 3  S+     0   0  115  496   56              SSAAAAADDSV   AAD ADSSDEAS SSDAA   S       AAAAADAAAAAAAAG
    61   61 A R  T 3  S+     0   0   44  496    4              RRRRRRRRRRR   RRR RRRRRRRR RRRRR   R       RRRRRRRRRRRRRRR
    62   62 A F  E <   +C   75   0A   5  496    1              FFFFFFFFFFF   FFF FFFFFIFF FFFFF   F       FFFFFFFFFFFFFFF
    63   63 A S  E     -C   74   0A  55  495   23              KKSSSSSSSSS   SSS MTSSSSSS KKSSS   S       SSSSSSSSSSSSSSS
    64   64 A G  E     +C   73   0A  13  496    2              GGGGGGGGGGG   GGG GGGGGGGG GGGGG   G       GGGGGGGGGGGGGGG
    65   65 A S  E     +C   72   0A  63  496    6              SSSSSSSSSRS   SSS SSSSSSSS SSRSS   S       SSSSSSSSSSSSSSS
    66   66 A G  E     -C   71   0A  36  496   14              GGGGGGGGGRG   GGG GGGGGGRG GGGGG   G       GGGGGGGGGGGGGGG
    67   67 A S  E >   +C   70   0A  79  496    9              SSSSSSSSSYS   SSA SSSSSSST SSSSS   S       SSSSSSSSSSSSSSS
    68   68 A G  T 3  S-     0   0   16  496   12              GGGGGRGGGGA   GGG GGGGEGGW GGGGG   G       GRRGGGGGGGGGAAG
    69   69 A T  T 3  S+     0   0   67  495   13              TTTTTTTTTTT   TTT TTTKTTTT TTTTT   T       TTTTTTTTTTTTTTT
    70   70 A Q  E <   +BC  24  67A 110  496   29              EEDDDDDDDDS   DDD EDDDDDDD EQDDD   D       DDDDDDSSSSSSSSD
    71   71 A F  E     -BC  23  66A   2  494    5              FYFFFFFFFFY   FFF FFYYYFFF FFFFF   F       FFFFFFYYYYYYYYF
    72   72 A S  E     -BC  22  65A  26  495   30              TTSSSTTTTTS   TTT STTSTTTT TTTTS   T       STTTTTSSSSSSSST
    73   73 A L  E     -BC  21  64A   0  496    2              LLLLLLLLLLL   LLL LFLLLLLL LLLRL   L       LLLLLLLLLLLLLLL
    74   74 A K  E     -BC  20  63A  97  496   38              TTNNNTNTTTT   TNT TTTTTTST TTTTT   T       NTTNNTTTTTTTTTT
    75   75 A I  E     -BC  19  62A   0  496    1              IIIIIIIIIII   III IIIIFIII IIIII   I       IIIIIIIIIIIIIII
    76   76 A N  S    S-     0   0   86  496   29              SSHHHNHSSST   SHS SSSSSSSS SSNSS   S       HDDHHSSSSSSNTTS
    77   77 A S  S    S-     0   0   58  496   62              GGPPPPPSSSR   SPR SSSGSRSS GENSN   S       PPPPPSSSSSSTSSN
    78   78 A L        -     0   0    0  496   27              VVMMMVVLLLM   LVL LVLLLMML VVFLM   Q       MVVVVLVMMMMMMML
    79   79 A L    >   -     0   0   67  496   31              QQEEEEEQQEQ   EEE QKQEQEEE QQQEE   E       EEEEEQEEEEEEQQQ
    80   80 A P  G >  S+     0   0   92  496   59              CCEEEAEAADA   PEP AAPSAAPP CCAPA   P       EAAEEAAAAAAAAAA
    81   81 A E  G 3  S+     0   0  102  496   15              DADDDDEEEEE   AEE EEEEGEEE DDDEE   E       DDDEEEEEEEEEEEE
    82   82 A D  G <  S+     0   0    1  496    5              DDDDDDDDDDD   DDD DDDDDDDD DDDDD   D       DDDDDDDDDDDDDDD
    83   83 A F    <   +     0   0   29  495   73              AATTTVAVVMA   FAF VLVIVAAA AAAAA   F       TAAAAVDAAAAAAAV
    84   84 A G  E    S- H   0 105B  17  496   23              GAAAAAAAAAA   AAA AAAAAGAA AAAAA   A       AAAAAAAAAAAAAAG
    85   85 A S  E     -EH  38 104B  24  496   62              ITMMMTTVVTT   VTV VVTTVDIT TTVHV   T       MTTTTVTIIIIITTD
    86   86 A Y  E     -EH  37 103B   0  496    0              YYYYYYYYYYY   YYY YYYYYYYY YYYYY   Y       YYYYYYYYYYYYYYY
    87   87 A Y  E     -E   36   0B   5  495    4              YYFFFYYYYFY   YYY YYFYYYYY YYYYY   Y       FYYYYYYYYYYYYYY
    88   88 A b  E     -E   35   0B   0  496    0              CCCCCCCCCCC   CCC CCCCCCCC CCCCC   C       CCCCCCCCCCCCCCC
    89   89 A Q  E     -EI  34  99B   0  494   48              QQQQQQQQQLQ   QLQ QQLQQQLQ QQQQQ   Q       QQQQQQQQQQQQQQQ
    90   90 A H  E     -E   33   0B  22  486   28              QSQQQQQQQQQ   HQQ QQQQH QQ GGQQQ   Q       QQQQQQQQQQQQQQE
    91   91 A H        +     0   0    0  423   89              DASSSSSYYHW   RSY YYHGY TY GYYSY   H       SNNSSYW    WWWG
    92   92 A Y  S    S+     0   0  104  454   87              WDKKKNNYDSS   NYG YYSYY YK YYDRD   N       KNNNNYS    TSSY
    93   93 A G  S    S-     0   0   34  421   71              NYEEEEE.TYS   NES DSSTS NS YSNSS   I       EEEEESG    YSSN
    94   94 A T  S    S-     0   0  104  444   88              SSVVVDDSILY   WSS SYRPT VS TAVYS   S       VDDDDTY    PNNY
    95   95 A P  S    S+     0   0    7  441   51              NGPPPPPTPPP   PPL TPPPS PP SGPPP   P       PPPPPPP    LPPP
    96   96 A P  S    S-     0   0   55  420   76              nsWPWYYPTYp   pfY YPHTP  P SSPlH   P       YWYFW F    ILLP
    97   97 A L        -     0   0   21  151   88              nv.Y...Y..l   fy. . ...  . ...q.   .       ..... .    ....
    98   98 A T        -     0   0   40  278   41              NTTTTTTS.TT   TTT T ..S  . .S.CT   .       TTTTT .    TTT.
    99   99 A F  B     -I   89   0B  18  277   26              FFFFFFFFFFF   FFF F ..F  . .F.FY   .       FFFFF .    FFF.
   100  100 A G        -     0   0    3  285   38              GGGGGGGGGGG   GGG G ..G  . AG.SG   .       GGGGG G    GGG.
   101  101 A G        -     0   0   52  300   63              GGGGGGGQGGA   PSQ Q G.Q  . D .PQ   A       GGGSS S    AAA.
   102  102 A G        -     0   0   11  300   41              GGGGGGGGGGG   GGG G D.G  . T .EG   V       GGGGG G    GGG.
   103  103 A T  E     - H   0  86B   0  360   19              TTTTTTTTTTT   TTT T T.T  T T TQT   T       TTTTT T    TTTT
   104  104 A K  E     -dH  10  85B  98  359   60              EEKKKKKKKKK   RKK K NMK  V V VKK   Q       KKKKK K    KKKV
   105  105 A L  E     -dH  11  84B   4  343   39              VVLLLLLLVLL   VLL L HLV  L I L L   A       LLLLL L    LLLL
   106  106 A E  E     -d   12   0B 108  326   52              VVEEEEEEEEE   DEE E NQE  Q Q Q T   M       EEEEE E    EEEQ
   107  107 A I  E      d   13   0B 113  295   51              VVIIIIIIIKL   VII I IVI      P F   T       IIIII I    LLL 
   108  108 A K              0   0  145  261   18              KKKKKKKKKKK   KKK N N K      R N   K       KKKKK K    KKK 
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30                         QQE   E        D     D E                       
   111    2 B V        +     0   0   19  428   12                         EEV   V        V     V V                       
   112    3 B K  E     -J  134   0C 111  430   32                         QQQ   Q        Q     I Q                       
   113    4 B L  E     -J  133   0C   3  452    1                         LLL   L        L     LLL                       
   114    5 B Q  E     -J  132   0C  83  454   70                         VMQ   Q        V     TQQ                       
   115    6 B E  E     +J  131   0C   5  458   22                         EEQ   Q        E     EEQ                       
   116    7 B S  E     +J  130   0C  69  463   14                         SSS   S        S     SSS                       
   117    8 B G        +     0   0   36  467    4                         GGG   G        G     GGG                       
   118    9 B G        +     0   0   29  718   50  AAAAAAAPAPAP           GGP   A        G     GPP A APAAA               
   119   10 B D        -     0   0   96  725   42  EEEEEEEEEGEG           GGE   E        D     DGE E EGEEE               
   120   11 B L  E     +n  224   0D  79  727   14  LLLLLLLLLLLL           LLL   L        L     VTL LLLLLLL               
   121   12 B V  E     -n  225   0D  16  729   31  AAVVVVVVVVVV           VVV   V        R     KVV VVAVVVA               
   122   13 B Q    >   -     0   0  114  730   53  RRKKKKRKRARA           TTK   K        Q     KKK RQKAKKR               
   123   14 B P  T 3  S+     0   0   66  730    7  PPPPPPSPPPPP           LLP   P        P     PPP PPPPPPP               
   124   15 B G  T 3  S+     0   0   58  734   31  GGGGGGGGGSGS           GGG   G        G     GSG GSGSGGG               
   125   16 B G    <   -     0   0   25  736   63  AAAAAAAAAQAQ           GGA   A        G     EEA AQAQAAA               
   126   17 B S        +     0   0   78  735   29  SSSSSSSSLSSS           SSS   S        S     SSS SSSSSSS               
   127   18 B L  E     - K   0 192C  25  737   28  VVVVVVVVVLVL           LLV   V        L     LLV VLVLVVV               
   128   19 B K  E     - K   0 191C  93  735   55  KKKKKKKKKSKS           KKK   K        S     RRK KSKSKKK               
   129   20 B L  E     - K   0 190C   0  740   16  LLLLLLLMLILI           LLM   L        L     LLM LIMILLL               
   130   21 B S  E     -JK 116 189C  28  740   37  SSSSSSSSSTST           SSS   S        S     STS STSTSSS               
   131   22 B d  E     -JK 115 188C   0  740    0  CCCCCCCCCCCC           CCC   C        C     CCC CCCCCCC               
   132   23 B A  E     -JK 114 187C  52  740   67  KKTTTTTKKTKT           KKK   T        K     KTK KTKTTTK               
   133   24 B A  E     +J  113   0C   8  740   48  AAAAAAAAAIAV           AAA   A        A     AVA AVAVAAA               
   134   25 B S  E     +J  112   0C  58  740   14  SSSSSSSSSSLS           SSS   S        S     SSS SSSSSSS               
   135   26 B G  S    S+     0   0   56  739    3  GGGGGGGGGGGG           GGG   G        G     GGG GGGGGGG               
   136   27 B F  S    S-     0   0   33  740   31  YYFFFFFYFFYF           IIY   F        L     FFY YFYFFFY               
   137   28 B T    >   -     0   0   93  740   53  TTNNNNNTNSTS           DDT   N        T     DET TSTSNNT               
   138   29 B F  G >  S+     0   0    2  740   28  FFIIIIIFILFL           FFF   I        N     FLF FLFLIIF               
   139   30 B S  G 3  S+     0   0   57  740   55  TTKKKKKTKTTT           SST   K        S     SST TTTTKKT               
   140   31 B S  G <  S+     0   0   71  740   57  SSDDDDDSDSDS           HHD   D        Y     SSD DSSSDDD               
   141   32 B Y  S <  S-     0   0   44  738   42  YYTTTTYYYYYY           YYY   T        Y     YYY YYYYTTY               
   142   33 B T        -     0   0   30  739   92  WWYYYYYVYGEG           GGY   Y        Y     AHY EGWGYYY               
   143   34 B M  E     -OP 160 207E   0  739   49  MMMMMMMMMVMV           IIM   M        M     MMM MVMVMKI               
   144   35 B S  E     -OP 159 206E   0  740   72  QQHHHHHHHHHH           SSK   H        H     HHK HHHHHHN               
   145   36 B W  E     +OP 158 205E   0  740    0  WWWWWWWWWWWW           WWW   W        W     WWW WWWWWWW               
   146   37 B V  E     -OP 156 204E   0  740   17  VVVVVVVVVVVV           VVV   V        V     VIV VVVVVVV               
   147   38 B R  E     -OP 155 203E  10  740   21  KKKRKKKKKRKR           RRK   K        R     RRK KRKRKKK               
   148   39 B Q  E     -OP 154 202E   9  740    4  QQQQQQQQQQQQ           QQQ   Q        Q     QQQ QQQQQQQ               
   149   40 B T    >   -     0   0    9  739   74  RRRRRRRKRPTP           AAS   R        A     PPS TPRPRRR               
   150   41 B P  T 3  S+     0   0   80  740   11  PPPPPPPPPPPP           PPH   P        P     PPH PPPPPPT               
   151   42 B E  T 3  S-     0   0  151  740   29  GGEEEEEGEGVG           GGG   E        G     GGG VGGGEEG               
   152   43 B K    <   +     0   0  121  740   37  QQQQQQQQQKHK           KKK   K        K     KKK HKQKQQQ               
   153   44 B R        -     0   0  113  739   42  GGGGGGGGGGGG           GGS   G        G     GGS GGGGGGG               
   154   45 B L  E     -O  148   0E   9  740   13  LLLLLLLLLLLL           LLL   L        L     LLL LLLLLLL               
   155   46 B E  E     -O  147   0E  44  739    4  EEEEEEEEEEEE           EEE   E        E     EEE EEEEEEE               
   156   47 B W  E     +O  146   0E  15  739   11  WWWWWWWWWWWW           WWW   W        W     WWW WWWWWWW               
   157   48 B V  E     -     0   0E   0  739   28  IIIIIIIIILIL           III   I        V     III ILILIII               
   158   49 B A  E     -O  145   0E   0  740   36  GGGGGGGGGVGG           AAG   G        A     AGG GGGGGGG               
   159   50 B S  E     -OQ 144 168E   0  740   94  AARRRRWYWVAV           YYD   R        Q     FVD AVYVRRE               
   160   51 B I  E     -OQ 143 167E   4  739   18  IIIIIIIIIIII           III   I        V     III IIIIIII               
   161   52 B N    >   -     0   0   47  740   85  YYDDDDDNDWHW           YYN   D        H     SAN HWNWDDY               
   162   53 B N  T 3  S+     0   0   65  740   86  PPPPPPPPPSPA           PPP   P        K     YTP PSPAPPP               
   163   54 B G  T 3  S-     0   0   65  740   68  GGAAAAEYEDGG           NNN   A        D     PGN GGSGAAG               
   164   55 B G  S <  S+     0   0   30  740   50  DDNNNNNNNGSG           YYN   S        G     SGN SGTGNNS               
   165   56 B G  S    S+     0   0   74  739   59  GGGGGGGDGSGS           GGG   G        G     gSG GSGSGGG               
   166   57 B R        +     0   0  163  548   85  DDNNNNDGN.G.           SSG   N        S     t.G G.Y.NNN               
   167   58 B T  E     -Q  160   0E  62  724   48  TTTTTTTTTTTT           VVT   T        T     TTT TTTTTTT               
   168   59 B Y  E     +Q  159   0E  53  723   87  RRKKKKEEITAN           DDS   K        K     HAS ADENKKY               
   169   60 B Y        -     0   0   44  737    7  YYYYYYYYYYYY           YYY   Y        Y     YIY YYYYYYY               
   170   61 B P    >>  -     0   0   20  737   66  TTDDDDANDNNN           AAN   D        A     SAN NNNNDDN               
   171   62 B D  T 34 S+     0   0  148  739   65  QQPPPPPEPSQS           SSQ   P        D     QDQ QAQSPPE               
   172   63 B T  T 34 S+     0   0   90  739   62  KKKKKRKKKAKA           WWK   K        S     SSK KAKAKKK               
   173   64 B V  T X> S+     0   0    1  740   43  FFFFFFFFFLFL           VVF   F        V     VLF FFFLFFF               
   174   65 B K  B 3< S+l  177   0C 142  739   35  KKQQQQQKQKKM           NNK   Q        K     QKK KIKMQQK               
   175   66 B G  T 34 S+     0   0   74  739   36  GGGGGGGGGSGS           GGG   D        G     GNG GSDSGGG               
   176   67 B R  T <4 S+     0   0   36  739   21  KKKKKKKKKRKR           RRK   K        R     RRK KRKRKKK               
   177   68 B F  E  <  -lM 174 192C   2  740   67  AAAAAAAAALAL           FFA   A        F     FVA ALALAAA               
   178   69 B T  E     - M   0 191C  79  740   38  TTTTTTTTSSTS           TTT   T        T     TTT TSTSTTT               
   179   70 B I  E     + M   0 190C   5  740   22  LLIIIIMLIILI           IIL   I        I     VIL LILIIIL               
   180   71 B S  E     - M   0 189C  51  736   45  TTTTTTTTTSTS           SST   T        S     STT TSTSTTT               
   181   72 B R  E     - M   0 188C  30  739   68  AAAAAAASAKAK           LLV   A        W     RKV AKAKAAA               
   182   73 B D  E > > - M   0 187C  60  738    5  DDDDDDDDDDDD           DDD   D        D     EDD DDDDDDD               
   183   74 B N  G > 5S+     0   0   48  739   59  KKTTTTTKTNKN           NNK   T        K     NNK KNKNTTK               
   184   75 B A  G 3 5S+     0   0   99  739   41  SSSSSSSSSSSS           AAS   S        S     SGS SSSSSSS               
   185   76 B K  G < 5S-     0   0  111  740   54  SSSSSSSSSKSK           QQS   S        S     NKS SKSKSSS               
   186   77 B N  T < 5 +     0   0   62  740   46  SSNNNNNSNSSS           NNS   N        S     SKS SSSSNNS               
   187   78 B T  E   < -KM 132 182C  16  740   68  TTTTTTTTTQTQ           TTT   T        L     MQT TQTQTTT               
   188   79 B L  E     -KM 131 181C   0  737   61  AAAAAAAAAVAV           VVA   A        L     LVA AVAVAAA               
   189   80 B Y  E     -KM 130 180C  41  737   41  YYYYYYYYYFYF           FFY   Y        S     YYY YFYFYYY               
   190   81 B L  E     -KM 129 179C   0  739    8  MMLLLLLMLLML           LLM   L        L     LLM MFMLLLM               
   191   82 B Q  E     -KM 128 178C  76  739   41  QQQQQQQDQKEK           QQQ   Q        Q     QQQ EKQKQQQ               
   192   83 B M  E     +KM 127 177C   0  740   11  LLLLLLLLLMLM           MML   L        M     MML LMLMLLL               
   193   84 B S        +     0   0   42  740   54  SSSSSSSSSNSN           IIN   S        N     NNN SNSNSSS               
   194   85 B S  S    S-     0   0   68  739   23  SSSSSSSSSSSS           SSS   S        S     SGS SSSSSSS               
   195   86 B L        -     0   0    3  740   16  LLLLLLLLLLLL           LLL   L        L     LML LLLLLLL               
   196   87 B K    >   -     0   0  102  740   70  AATTTTTTTQTQ           TTT   T        K     RET TQTQTTT               
   197   88 B S  G >  S+     0   0   70  740   59  SSSSSSSSSTST           AAS   S        T     AVS SASTSSS               
   198   89 B E  G 3  S+     0   0  126  740   21  EEEEEEEEEDED           AAE   E        E     EKE EDEDEEE               
   199   90 B D  G <   +     0   0    2  740    3  DDDDDDDDDDDD           DDD   D        D     DDD DDDDDDD               
   200   91 B T    <   +     0   0   32  740   32  SSTTTTTSTTST           TTS   T        T     TTS STSTTTS               
   201   92 B A  E    S- R   0 223E   8  737    4  AAAAAAAAAAAA           AAA   A        A     AAA AAAAAAA               
   202   93 B M  E     -PR 148 222E  58  739   46  VVVVVVVVVMVM           TTV   V        L     MMV VIVMVVV               
   203   94 B Y  E     -PR 147 221E   0  739    1  YYYYYYYYYYYY           YYY   Y        Y     YYY YYYYYYY               
   204   95 B Y  E     -P  146   0E   7  740    4  YYYYYYYYYYYY           FFY   Y        Y     YYY YYYYYYF               
   205   96 B d  E     -P  145   0E   0  740    0  CCCCCCCCCCCC           CCC   C        C     CCC CCCCCCC               
   206   97 B V  E     -PS 144 217E   0  740   24  AAAAAANAAATA           AAA   A        A     AAA TAAAAGA               
   207   98 B R  E     -PS 143 216E  21  739   39  RrRrRRrrrRrR           rrr   g        a     RrR rrRRrrR               
   208   99 B H  E     + S   0 214E   6  629   94  .v.g..hrsHn.           rrk   y        q     Da. sr..pd.               
   209  100 B E  E  >  + S   0 213E  63  676   73  .P.HGDSGSDYD           GGD   G        K     SSD SPHGHAS               
   210  101 B Y  T >4 S-     0   0   80  702   91  .YYYGDLYPRDR           TTY   N        P     QGR YLYYYRI               
   211  102 B Y  T 34 S-     0   0  140  709   44  wYyyWYYYYYyY           RRY   F        W     FYY YyYyyYy               
   212  103 B Y  T 34 S+     0   0   39  264   90  r.yt.H.YYYyY           ...   .        .     ..W .yRdy.y               
   213  104 B A  E <<  -S  209   0E   0  447   85  AAPP.AAAAWAA           ...   .        .     .NY .AYAV.A               
   214  105 B M  E     +S  208   0E   0  580   59  MMFL.FMMMMMM           LLF   .        E     .FF FMTMGFM               
   215  106 B D  E     +     0   0E  19  696   48  DDAADADDDDDD           DDD   D        D     PDD DDDDEDD               
   216  107 B Y  E     -S  207   0E  99  702   57  YYYYYYYYYYYY           LLY   Y        F     SYV YYYYNYY               
   217  108 B W  E     -S  206   0E  23  731    0  WWWWWWWWWWWW           WWW   W        W     WWW WWWWWWW               
   218  109 B G        -     0   0    0  714   13  GGGGGGGGGGGG           GGG   G        A     NGG GGGGGGG               
   219  110 B Q        -     0   0   91  701   38  QQQQQQQQQQQQ           QQQ   Q        A     LQA QQQQQQQ               
   220  111 B G        -     0   0   16  687   10  GGGGGGGGGGGG           GGG   G        A     PGG GGGGGGG               
   221  112 B T  E     -R  203   0E  21  675   26  TTTTTTTTTTTT           TTT   T        G     STT TTTTTTT               
   222  113 B T  E     -R  202   0E  72  661   75  SSLLTLSSSSSS           LLT   T              SMT TSTSTTS               
   223  114 B V  E     -R  201   0E   0  654   18  VVVVLVVVVVVV           VVL   L              KVV LVLVLLV               
   224  115 B T  E     -n  120   0D  36  643   13  TTTTTTTTTTTT           TTT   T              KTT TTTTTTT               
   225  116 B V  E     +n  121   0D   6  626    6  VVVVVVVVVVVV           IIV   V              IVV VVVVVVV               
   226  117 B S        -     0   0   36  616    5  SSSSSSSSSSSS           SSS   S              STS SSSSSSS               
   227  118 B S  S    S+     0   0   84  597   20  SSAASASSSSSS           SSS   S              NSS SSSSSSS               
   228  119 B A  S    S+     0   0   70   97   58                                                                        
   229  120 B W        -     0   0  123   87   40                                                                        
   230  121 B R        +     0   0  207   62   76                                                                        
   231  122 B H              0   0  156   56   69                                                                        
   232  123 B P              0   0  155   28   53                                                                        
## ALIGNMENTS  701 -  770
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 A D              0   0  183  423   16  D D DE DD DDDQ D D Q DDDD             D DDDDQQQE          EEKDD  DEQE 
     2    2 A I        -     0   0   32  466   12  I I IN II VIIVII VII IIII             VFIIIIIIII          LIIII  IIII 
     3    3 A E        -     0   0  117  468   68  V V QL QV LQQIVQ VVT TTTV             VEVVVVLVLV          VVVVQ  QVVV 
     4    4 A L  E     -A   25   0A  10  482    7  L M ML LM MMMLLMLMLM RMML             MLLLLMLLLL          LLLLM  MMLLL
     5    5 A T  E     -A   24   0A  64  482    8  T T TT TS TTTTTTTTTT TTTT             TTTTATTTTT          TTTTT  TTTTT
     6    6 A Q  E     -A   23   0A  13  482    0  Q Q QQ QQ QQQQQKQQQQ QQQQ             QQQQQQQQQQ          QQQQQ  QQQQQ
     7    7 A T  E    S+A   22   0A  64  482   35  S S SS SS TSSSTSTTSS SSSS             TTSSSSSSSS          TSSST  SSSST
     8    8 A P        -     0   0   46  485    9  P Q TP PP PPPPPPAPRP PPPP             PPPPPPPPPP          PPPPT  PPPPP
     9    9 A V  S    S+     0   0   96  489   67  A T SA SS LSSASSSAAS SSSE             ASAAADAAAA        A PGAAS  SADAS
    10   10 A S  E     -d  104   0B  60  491   42  S F SI SS SLSTPSPSSL SSSS             SSSSSSIIIT        S STSSS  LTYLP
    11   11 A L  E     -d  105   0B  58  494   23  L M LM LL LLMLVVVVLL LLLL             VVLLLLMMML        L LLLLL  LLVLV
    12   12 A S  E     +d  106   0B  60  495   42  A S SS AP PSSSSSSSSS SPPA             SEAATVSSSS        A SSAAS  SSSSS
    13   13 A A  E     -d  107   0B   0  495   58  V T AA VV VAVLGATEGV VLVV             EAVVVVAAAL        V PLVVA  ALVKA
    14   14 A S    >   -     0   0   47  496   31  S S SS SS SSSSAPAPST SSSS             PASSSSSSSS        S SFSSS  SSSAA
    15   15 A V  T 3  S+     0   0   76  496   66  L V LP AV LVLPVVVVPP HHRP             VVLLLLPPPP        L VPLLL  VPPLV
    16   16 A G  T 3  S+     0   0   42  496    5  G G GG GG GGGGGGGEGG GGGG             GGGGGGGGGG        G GGRGG  GGGIG
    17   17 A E    <   -     0   0   71  496   36  Q D DE EE DDDEGSDGED EDDD             GGQQQEQQQE        Q EEQQD  DEEEG
    18   18 A T        -     0   0   69  496   62  R R RK KK QRTRSITTRT RRRR             TTRRRRKKKR        R TRRRR  RRTKT
    19   19 A V  E     - B   0  75A  11  496   36  A V VV VV AVVAVVVVVV VVVV             VVAAAAVVVA        A VAAAV  VAVVV
    20   20 A T  E     - B   0  74A  67  495   29  T S XT TT STTTTATTTT TTTT             TTTTTTTTTT        T RTTTT  TTTTT
    21   21 A I  E     - B   0  73A   1  494   17  I V XM ML ILILIIIIII IIII             IIIIIIMMML        I ILIII  LLFII
    22   22 A T  E     -AB   7  72A  29  494   59  S T XT SS SNTSNNNKSS TNTN             KKSSSNTTTS        S RSSSS  NSTTS
    23   23 A b  E     -AB   6  71A   0  495    1  C C CC CC CCCCCCCCCC SCCC             CCCCCCCCCC        C CCCYC  CCCCC
    24   24 A R  E     -AB   5  70A 110  495   47  R K SS KK RKRRQQQQKR RKKK             QQKKRRSSSR        R LRRRR  KRKRQ
    25   25 A A  E     -A    4   0A  10  495   28  A A AA SS SAAAAAAAAA AAAA             ASAAASAAAA        A AAAAA  AAAAS
    26   26 A S  S    S+     0   0   66  495    4  S S SS SS SSSSSSSSSS SSSS             SSSSSSSSSS        S SSSSS  SSSSS
    27   27 A E  S    S-     0   0  101  495   38  Q Q QS QQ QQQQQQQQQQ QQQS             QQQQQQSSSQ        E DQEKQ  QQSQK
    28   28 A N        +     0   0   83  495   45  S N GS SS SNDSSSSSSD GDHS             SSSSSSSSSS        S FSSSD  NSSSS
    29   29 A I    >   -     0   0    5  496   32  V V IV VL IIVVIIIIVI IIIL             IIVVVVVVVV        V LVVII  IVVIV
    30   30 A Y  T 3   -     0   0  155  496   81  s G SS ll vYGSSgsGsS SGSt             YGddslSSSS        e FsdsS  YSGSy
    31   31 A S  T 3  S+     0   0   53  471   64  n T N. nn tKISNssSsK NGNn             STsssn...N        s NsssN  KSSTn
    32   32 A Y    <   +     0   0   63  495   53  Y N XY YY YNYSEYYNYY GYSY             GYYYYYYYYY        L GYFYY  NSWNC
    33   33 A L  E     -E   90   0B   0  495    7  M V XV LL LLVLLLLLLL LLLL             LLMMMLMMML        M VLMML  LLILL
    34   34 A A  E     -E   89   0B   0  495   71  H A XY AA EENASSSAHN HHHA             AANNHAHHHA        Q SAHHN  EAAHS
    35   35 A W  E     -EF  88  48B   1  496    0  W W WW WW WWWWWWWWWW WWWW             WWWWWWWWWW        W WWWWW  WWWWW
    36   36 A Y  E     -EF  87  46B   0  496    8  Y Y FY YY YYFYYYYYYY YYYY             YYYYYYYYYY        Y YYYNY  YYYHY
    37   37 A Q  E     -EF  86  45B   7  496   27  Q Q QL QQ LQQQQQQQQQ QQQQ             QZQQQQQQQQ        Q QQQQQ  QQQQQ
    38   38 A Q  E     -E   85   0B  21  496    4  Q Q QQ QQ QQQQQQQQQQ KQQQ             ZZQQQQQQQQ        Q QQQQQ  QQQQQ
    39   39 A K    >   -     0   0   51  495    8  R K KK KK KKKKKKKKKK KKKK             KKKKKKKKKK        K KKKKK  KKKKK
    40   40 A Q  T 3  S+     0   0  190  496   18  P P PP PP PHPPPPPPPH PLPR             PPPPPPSSSP        P PPPPP  HPSPP
    41   41 A G  T 3  S+     0   0   86  496   10  G G DG GG GGGGGGGGGG GGGG             GGGGGGGGGG        G EGGGD  GGGNG
    42   42 A K  S <  S-     0   0  126  495   54  Q Q GS QQ QEKQQQQQQQ QQQQ             QQQQQQTTTQ        Q KQQQG  EQQQQ
    43   43 A S        -     0   0   21  495   56  P S TS SS SASAPPPRAS AAAT             PPPPPASSSV        P PASPT  AAAAP
    44   44 A P        -     0   0    4  495   10  P P VP PP PPPPPPPPPP PPPP             PPPPPPPPPP        P PPPPV  PPPPP
    45   45 A Q  E     -F   37   0B  74  495   32  K K KR KK KKRRKKKKRK KKKQ             KKKKKKKKKR        K TRKRK  KKKKK
    46   46 A F  E     +F   36   0B  25  495   41  L A LL LL LLHLLLLLLL LLLL             LLLVLLRRRL        L LLLLL  LLLLL
    47   47 A L  E     +     0   0B   4  495    9  L L LL LL LLMLLLLLLL LLLL             LLLLLLWWWL        L LLLLL  LLLLL
    48   48 A V  E     -FG  35  54B   0  496    5  I I II II IIIIIIIIII IIII             IIIIIFIIII        I IIIII  IIIVI
    49   49 A Y  E >> S+ G   0  53B  39  496   17  K Y YY YY YYYYYYYYYY YRRY             YYYFKSYYYY        Y SYYYY  YYYKY
    50   50 A N  T 34 S-     0   0   52  496   91  Y S YD WW KYRGLRKSRN GHYG             KRAAYWDDDR        A GGRVY  YGLYR
    51   51 A A  T 34 S+     0   0    3  496   44  A A TT AA VTAAAAAAAT AAAA             AAAAAATTTA        A ATAVT  TAAAA
    52   52 A K  T <4 S+     0   0  148  496   25  S S SS SS SNTSSSSSSN NTNS             SSSSSSSSSS        S SSSSS  NSSSS
    53   53 A T  E  <  -G   49   0B  47  496   68  N Y SN TA NNNSTTTTNN TSTT             TTNNNTKKKN        N DSNNR  NSTQN
    54   54 A L  E     -G   48   0B  60  496   59  L P LL RR RLLRLLLLLL LLLR             LLLLLRLLLR        V LRLLL  LRRTL
    55   55 A G    >   -     0   0    9  495   70  E Y XA EE FQAAAAAAEH QQEA             AAEEEEAAAT        E EAEEH  QAHIA
    56   56 A E  T 3  S+     0   0  192  495   35  S S SS SS STDTSSSSSS SSSS             SSSSSSSSST        S TTSSS  TTTSS
    57   57 A G  T 3  S+     0   0   70  496    5  G G GG GG GGGGGGGGGG GGGG             GGGGGGGGGG        G GGGGG  GGGGG
    58   58 A V    <   -     0   0   25  494   10  V V VV VV VIVIVVVVVI VVVI             VVIIVVVXVI        V VIVVV  IITVV
    59   59 A P    >   -     0   0   47  495    7  P P PP PP PSPPPPPPPP PPPP             SSPPPPPPPP        P PPPPP  SPPPP
    60   60 A S  T 3  S+     0   0  115  496   56  A H SV DD DSSDSSSSAS SSSD             SSAAADAAAD        A PDAAS  SDESS
    61   61 A R  T 3  S+     0   0   44  496    4  R R RR RR RRRRRRRRRR RRRR             RRRRRRRRRR        R RRRRR  RGRQR
    62   62 A F  E <   +C   75   0A   5  496    1  F F FF FF FFFFFFFFFF FFFF             FFFFFFFFFF        F FFFFF  FFIFF
    63   63 A S  E     -C   74   0A  55  495   23  S T SS TT SSSSKSKKSS ISSS             KKSSSSSSXS        S SSSSS  SSSSK
    64   64 A G  E     +C   73   0A  13  496    2  G G GG GG GGGGGGGGGG GGGG             GGGGGGGGGG        G GGGGG  GGGGG
    65   65 A S  E     +C   72   0A  63  496    6  S S SS SS SSSSSSSSSS SISS             SSSSSSSSSS        S SSSSS  SSSSS
    66   66 A G  E     -C   71   0A  36  496   14  G G GG GG GGRGGGGGGG LGGG             GGGGGGGGGG        G GGGGG  GGGGG
    67   67 A S  E >   +C   70   0A  79  496    9  S S SS SS SSSSSSSSSS SSYS             SSSSSSSSSS        S SSSSS  SSSSS
    68   68 A G  T 3  S-     0   0   16  496   12  G G GG GG GGGGGGGGGG GGGG             GGGGGGAAAG        G GERGG  GGGGG
    69   69 A T  T 3  S+     0   0   67  495   13  T T XT TT TTSTTTTTTT KTTT             TTTTTTTTTT        T TTTTT  TTTTT
    70   70 A Q  E <   +BC  24  67A 110  496   29  D D DS DD DDDEEQQEDD DDDD             EEDDDDSSSD        D DDDDD  DEDDQ
    71   71 A F  E     -BC  23  66A   2  494    5  F F YY FF FYYFFFFFFY FFFF             FFFFFFYYYF        F YFFFY  YFFFF
    72   72 A S  E     -BC  22  65A  26  495   30  T T SS TT TTSTTTTTTT TTTT             TTTTTTSSST        S TTTTS  TTTTT
    73   73 A L  E     -BC  21  64A   0  496    2  L L LL LL LLLLLLLLLL LLLL             LLLLLLLLLL        L LLLLL  LLLLL
    74   74 A K  E     -BC  20  63A  97  496   38  N T TT TS KTTTTTTTTT ITTT             TTNNNTTTTT        N TTTDT  TTTTT
    75   75 A I  E     -BC  19  62A   0  496    1  I I II II IIIIIIIIII IIII             IIIIIIIIII        I IIIII  IIIII
    76   76 A N  S    S-     0   0   86  496   29  H S SS SS SSSSSSSSSS SSIS             SSHHHPTTTS        H GSDHS  SSSSS
    77   77 A S  S    S-     0   0   58  496   62  P N NR SS RSSSDSSDSS SSSR             DGPPPGSSSR        P GRPPN  SSRSE
    78   78 A L        -     0   0    0  496   27  V V LM VV VLLLLMVLLV LLLV             LVVVVLMMML        V VLVVL  LLMLV
    79   79 A L    >   -     0   0   67  496   31  E Q EE QK EQEEEQQEEE EEEE             EEEEEQQQQD        E QEEEE  QEEEQ
    80   80 A P  G >  S+     0   0   92  496   59  E S PA AT APSPCCCCPT PPPV             CCEEEAAAAP        E APAEQ  PPAPC
    81   81 A E  G 3  S+     0   0  102  496   15  E E EE EE EEEEADDAEE EEED             AAEEEEEEEE        D EEDEE  EEEED
    82   82 A D  G <  S+     0   0    1  496    5  D D DD DD DDDDDDDDDD EDDD             DDDDDDDDDD        D DDDDD  DDDDD
    83   83 A F    <   +     0   0   29  495   73  T L IA LL LVVFADAAAA AAAA             AAAADVAAAF        I AFAAI  VVAVA
    84   84 A G  E    S- H   0 105B  17  496   23  A A AA AA GAAAAAAAAG AAAG             AAAAAAAAAA        A AAAAA  AGAAA
    85   85 A S  E     -EH  38 104B  24  496   62  T E TT VV VTDVTTTTHV TTTD             TTTTAVTTTV        M TVTTT  TVDTT
    86   86 A Y  E     -EH  37 103B   0  496    0  Y Y YY YY YYYYYYYYYY YYYY             YYYYYYYYYY        Y YYYYY  YYYYY
    87   87 A Y  E     -E   36   0B   5  495    4  Y F YY YY YYHYYYYYYY YFHY             FYYYYYYYYY        F YYYYF  YYYYY
    88   88 A b  E     -E   35   0B   0  496    0  C C CC CC CCCCCCCCCC CCCC             CCCCCCCCCC        C CCCCC  CCCCC
    89   89 A Q  E     -EI  34  99B   0  494   48  Q Q QQ HQ FYLQQQQQQF QQQQ             ZQQQQQQQQQ        Q LQQQQ  YQQQQ
    90   90 A H  E     -E   33   0B  22  486   28  H Q QQ QQ QQQKSNQSQQ QQQQ             GGQQHQQQQQ        Q GQQRQ  QQQQG
    91   91 A H        +     0   0    0  423   89  S Y YW  Y GYYYYLGYYH GGSS             STSSSYWWWY        S GYDIG  YDLSY
    92   92 A Y  S    S+     0   0  104  454   87  W N ST  Y SNDSYNYYKK WYSY             TYNNWYSSSG        R YGNRS  NYYNY
    93   93 A G  S    S-     0   0   34  421   71  E S KS  S HSESGKSYSS DSFE             YYEEERSSSS        K SSEET  SSNSS
    94   94 A T  S    S-     0   0  104  444   88  I Y FY  Y FGYSSSSSYW YFYT             GZDDIINNNS        V GSDAL  GWFNG
    95   95 A P  S    S+     0   0    7  441   51  P P PP  P PPPPSSSSPP PPPP             GSPPPPPPPP        P SIPYP  PPPPP
    96   96 A P  S    S-     0   0   55  420   76  L Y WF  L YHPPALSSlF PRPL             GALWLYLLLP        W aFYTP  HPLPA
    97   97 A L        -     0   0   21  151   88  . . ..  . ........q. .T..             ..........        . l....  .....
    98   98 A T        -     0   0   40  278   41  T T TT  T TGT.....C. .V.T             YSTTTTTTT.        T TTT..  ..TT.
    99   99 A F  B     -I   89   0B  18  277   26  F F FF  F FFV.....F. .I.R             FFFFFFFFF.        F FFFF.  ..HV.
   100  100 A G        -     0   0    3  285   38  G G GG  G GAI..K.CS. .Q.G             GGGGGGGGG.        G GGGG.  G.RL.
   101  101 A G        -     0   0   52  300   63  A G GS  A GQQTGYAGQ. TATE             GGASAQAAST        G APSG.  ETGQ.
   102  102 A G        -     0   0   11  300   41  G G GG  G GLGVAGDAK. VMVE             GGGGGGGGGV        G GGGG.  GVGNG
   103  103 A T  E     - H   0  86B   0  360   19  T T TT  T TTSITKTTST TTTT             TTTTTATTTI        T TTTTT  SITMS
   104  104 A K  E     -dH  10  85B  98  359   60  K K KK  K KKKQVKTVCV QKQM             EEKKKKKKKQ        K NKKKM  SRGK 
   105  105 A L  E     -dH  11  84B   4  343   39  L L LL  L LQILLLVILL ATAP             VVLLL LLLL        L VVLLI  THVI 
   106  106 A E  E     -d   12   0B 108  326   52  E E EE  V ER EQS QHQ MSIT             VVEE  XEEE        E EDEE   LENK 
   107  107 A I  E      d   13   0B 113  295   51  I I IL  L IS T V  I  TQTP             VVLI  LLXI        I IIII   ARIV 
   108  108 A K              0   0  145  261   18  K K KK  K KK K    Q  KKKK             KKKK  KKK         K KK     KK K 
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30     Q  E  D          E                           QQQQQQQQ       QQ     
   111    2 B V        +     0   0   19  428   12     V  V  V          V                           VVVVVVVV       VV     
   112    3 B K  E     -J  134   0C 111  430   32     Q  Q  Q          Q                           QQQQQQQK       QQ     
   113    4 B L  E     -J  133   0C   3  452    1     L  L  L          L                           LLLLLLLL       LL     
   114    5 B Q  E     -J  132   0C  83  454   70     Q  V  Q          Q                           QQQQQQQH       VI     
   115    6 B E  E     +J  131   0C   5  458   22     Q  E  E          Q                           QQQQQQQQ       QQ     
   116    7 B S  E     +J  130   0C  69  463   14   S P  S  S          S                           PPPPPPPS       SS     
   117    8 B G        +     0   0   36  467    4   G G  G  G          G                           GGGGGGGG       GG     
   118    9 B G        +     0   0   29  718   50   A A  A  P          P    PAPPAPAAPAPAA          ATAAAAAP A     AS     
   119   10 B D        -     0   0   96  725   42   E E  E  D          E    GEGGEGEEGEGEE          EEEEEEEE E     EE     
   120   11 B L  E     +n  224   0D  79  727   14   L L  V  L          L    LLLLLLLLLLLLL          LLLLLLLV L     VL     
   121   12 B V  E     -n  225   0D  16  729   31   V V  K  V          V    VMVVVVVMVVVMV          VVVVVVVV V     KR     
   122   13 B Q    >   -     0   0  114  730   53   K K  K  K          K    QKAAKQRKAKQKK          RKKKKKKK K     KK     
   123   14 B P  T 3  S+     0   0   66  730    7   P P  P  P          P    PPPPPPPPPPPPP          PPPPPPPP P     PP     
   124   15 B G  T 3  S+     0   0   58  734   31   G G  G  S          G    SGSSGSGGSGSGG          GGGGGGGG G     GG     
   125   16 B G    <   -     0   0   25  736   63   A A  A  Q          A    QAQQAQAAQAQAA          SAAAAAAA A     AA     
   126   17 B S        +     0   0   78  735   29   S S  S  S          S    SSSSSSSSSSSSS          SSSSSSSS S     SS     
   127   18 B L  E     - K   0 192C  25  737   28   V V  V  L          V    LVLLVLVVLVLVV          VVVVVVVV V     VV     
   128   19 B K  E     - K   0 191C  93  735   55   K K  K  S          K    SKSSKSKKSKSKK          KKKKKKKK K     KK     
   129   20 B L  E     - K   0 190C   0  740   16   L L  V  L          M    IIIILILIILIIL          LLLLLLLL L     VV     
   130   21 B S  E     -JK 116 189C  28  740   37   S S  S  T          S    TSTTSTSSTSTSS          SSSSSSSS S     SS     
   131   22 B d  E     -JK 115 188C   0  740    0   C C  C  C          C    CCCCCCCCCCCCC          CCCCCCCC C     CC     
   132   23 B A  E     -JK 114 187C  52  740   67   T K  K  T          K    TKTTKTKKTTTKK          KKKKKKKK T     KK     
   133   24 B A  E     +J  113   0C   8  740   48   A A  A  V          A    VAVIAVAAVAVAA          AAAAAAAA A     AA     
   134   25 B S  E     +J  112   0C  58  740   14   S S  S  T          S    STSSSSLTSSSTS          SSSSSSSS S     SS     
   135   26 B G  S    S+     0   0   56  739    3   G G  G  G          G    GGGGGGGGGGGGG          GGGGGGGG G     GG     
   136   27 B F  S    S-     0   0   33  740   31   F Y  Y  Y          Y    FYFFYFYYFFFYY          YYYYYYYY F     YY     
   137   28 B T    >   -     0   0   93  740   53   N T  T  S          T    STSSTSTTSNSTT          TTTTTTTI N     TT     
   138   29 B F  G >  S+     0   0    2  740   28   I F  F  I          F    LFLLFLFFLILFF          FFFFFFFF I     FF     
   139   30 B S  G 3  S+     0   0   57  740   55   K T  S  T          T    TSTTTTTSSKTST          TTTTTTTT E     TT     
   140   31 B S  G <  S+     0   0   71  740   57   D S  S  s          D    SSSSSSDSRDSSS          SSSSSSSS D     SN     
   141   32 B Y  S <  S-     0   0   44  738   42   T Y  Y  y          Y    YYYYYYYYYTYYY          YYYYYYYY T     YY     
   142   33 B T        -     0   0   30  739   92   Y W  Y  T          Y    GWGGWGEWSYGWY          WWWWWWWD Y     AA     
   143   34 B M  E     -OP 160 207E   0  739   49   M M  M  W          M    VIVVMVMIVMVTM          MMMMMMMI M     ML     
   144   35 B S  E     -OP 159 206E   0  740   72   H H  H  H          K    HEHHHHHEHHHEY          HHHHHHHD H     HN     
   145   36 B W  E     +OP 158 205E   0  740    0   W W  W  W          W    WWWWWWWWWWWWW          WWWWWWWW W     WW     
   146   37 B V  E     -OP 156 204E   0  740   17   V V  V  I          V    VVVVVVVVVVVVV          VVVVVVVV V     VL     
   147   38 B R  E     -OP 155 203E  10  740   21   K K  R  R          K    RKRRKRKKRKRKK          KKKKKKKR K     RR     
   148   39 B Q  E     -OP 154 202E   9  740    4   Q Q  Q  Q          Q    QQQQQQQQQQQQQ          QQQQQQQQ Q     QQ     
   149   40 B T    >   -     0   0    9  739   74   R R  A  F          S    SRPPRPTRPRPRR          RRRRRRRT R     AA     
   150   41 B P  T 3  S+     0   0   80  740   11   P P  P  P          H    PPPPPPPPPPPPP          PPPPPPPP P     PP     
   151   42 B E  T 3  S-     0   0  151  740   29   E G  G  G          G    GGGGGGVGGEGGG          GGGGGGGE E     GG     
   152   43 B K    <   +     0   0  121  740   37   Q R  Q  N          K    KHKKQKHHKQKHQ          RQRRRRRQ Q     QQ     
   153   44 B R        -     0   0  113  739   42   G G  G  K          S    GGGGGGGGGGGGG          GGGGGGGG G     RG     
   154   45 B L  E     -O  148   0E   9  740   13   L L  L  L          L    LLLLLLLLLLLLL          LLLLLLLL L     LL     
   155   46 B E  E     -O  147   0E  44  739    4   E E  E  E          E    EEEEEEEEEEEEE          EEEEEEEE E     EE     
   156   47 B W  E     +O  146   0E  15  739   11   W W  W  W          W    WWWWWWWWWWWWW          WWWWWWWW W     WW     
   157   48 B V  E     -     0   0E   0  739   28   I I  M  M          I    LILLILIILILII          IIIIIIII I     MM     
   158   49 B A  E     -O  145   0E   0  740   36   G G  G  A          G    GGGVGGGGGGGGG          GGGGGGGG G     GG     
   159   50 B S  E     -OQ 144 168E   0  740   94   R R  I  Y          D    VEVVEVAEMRVEE          RNRRRRRW R     WW     
   160   51 B I  E     -OQ 143 167E   4  739   18   I I  I  I          I    IIIIIIIIIIIII          IIIIIIII I     II     
   161   52 B N    >   -     0   0   47  740   85   D D  N  H          N    WLWWNWHLWDWLN          DNDDDDDF D     NN     
   162   53 B N  T 3  S+     0   0   65  740   86   P P  P  Y          P    SPASPSPPGPSPP          PPPPPPPP P     AT     
   163   54 B G  T 3  S-     0   0   65  740   68   A N  S  S          N    GGGDSGGGGAGGS          NSNNNNNG A     GN     
   164   55 B G  S <  S+     0   0   30  740   50   N S  G  G          N    GSGGNGSSGNGSN          SNSSSSSE T     NT     
   165   56 B G  S    S+     0   0   74  739   59   G G  G  N          G    SGSSGSGGSGSGG          GGGGGGGG G     GG     
   166   57 B R        +     0   0  163  548   85   N G  S  .          G    .S..R.GS.T.SG          GGGGGGGS H     NK     
   167   58 B T  E     -Q  160   0E  62  724   48   T T  T  T          T    TTTTTTTTTTTTT          TTTTTTTT S     TA     
   168   59 B Y  E     +Q  159   0E  53  723   87   K K  S  D          S    DNNTNDANDKDNN          KNKKKKKE K     KT     
   169   60 B Y        -     0   0   44  737    7   Y Y  Y  F          Y    YYYYYYYYYYYYF          YYYYYYYY Y     YY     
   170   61 B P    >>  -     0   0   20  737   66   D N  A  N          N    NNNNNNNNNDNNN          NNNNNNNN D     SA     
   171   62 B D  T 34 S+     0   0  148  739   65   P E  Q  P          Q    AGSSEAQESPAEE          EEEEEEEE P     QQ     
   172   63 B T  T 34 S+     0   0   90  739   62   K K  K  S          K    AKAAKAKKAKAKK          KKKKKKKK K     KA     
   173   64 B V  T X> S+     0   0    1  740   43   F F  F  L          F    FFLLFFFFLFFFF          FFFFFFFF F     FF     
   174   65 B K  B 3< S+l  177   0C 142  739   35   Q K  Q  K          K    IKMKKIKKKQIKK          KKKKKKKK Q     QT     
   175   66 B G  T 34 S+     0   0   74  739   36   G S  G  S          G    SGSSSSGGSGSGS          SSSSSSSG G     GG     
   176   67 B R  T <4 S+     0   0   36  739   21   K K  R  R          K    RKRRKRKKRKRKK          KKKKKKKR K     RR     
   177   68 B F  E  <  -lM 174 192C   2  740   67   A A  V  I          A    LALLALAALALAA          AAAAAAAA A     VF     
   178   69 B T  E     - M   0 191C  79  740   38   T T  T  S          T    STSSTSTTSTSTT          TTTTTTTT T     TV     
   179   70 B I  E     + M   0 190C   5  740   22   I L  M  I          L    IFIILILFIIIFL          LLLLLLLL I     IF     
   180   71 B S  E     - M   0 189C  51  736   45   T T  T  T          T    STSSTSTTSTSTT          TTTTTTTS T     TS     
   181   72 B R  E     - M   0 188C  30  739   68   A V  R  R          V    KAKKVKAAKAKAV          VVVVVVVV S     RL     
   182   73 B D  E > > - M   0 187C  60  738    5   D D  D  D          D    DDDDDDDDDDDDD          DDDDDDDD D     DD     
   183   74 B N  G > 5S+     0   0   48  739   59   T K  T  T          K    NANNKNKTNTNTK          KKKKKKKK T     TT     
   184   75 B A  G 3 5S+     0   0   99  739   41   S P  S  S          S    SSSSSSSSSSSSS          PSPPPPPS S     SS     
   185   76 B K  G < 5S-     0   0  111  740   54   S S  T  K          S    KSKKSKSSKSKSS          SSSSSSSS S     AV     
   186   77 B N  T < 5 +     0   0   62  740   46   N S  S  N          S    SNSSSSSNSNSNS          SSSSSSSS N     SS     
   187   78 B T  E   < -KM 132 182C  16  740   68   T T  T  Q          T    QTQQTQTTQTQTT          TTTTTTTT T     TT     
   188   79 B L  E     -KM 131 181C   0  737   61   A A  V  F          A    VAVVAVAAVAVAA          AAAAAAAA A     AT     
   189   80 B Y  E     -KM 130 180C  41  737   41   Y Y  Y  F          Y    FYFFYFYYFYFYY          YYYYYYYY Y     YY     
   190   81 B L  E     -KM 129 179C   0  739    8   L M  M  L          M    FMLLMFMMLLFMM          MMMMMMMM L     ML     
   191   82 B Q  E     -KM 128 178C  76  739   41   Q Q  E  Q          Q    KQKKQKEQKQKQQ          QQQQQQQE Q     EQ     
   192   83 B M  E     +KM 127 177C   0  740   11   L L  L  L          L    MLMMLMLLMLMLL          LLLLLLLL L     LI     
   193   84 B S        +     0   0   42  740   54   S S  S  N          N    NSNNSNSSNSNSS          SSSSSSST S     SS     
   194   85 B S  S    S-     0   0   68  739   23   S S  S  S          S    SSSSSSSSSSSSS          SSSSSSSR S     SS     
   195   86 B L        -     0   0    3  740   16   L L  L  V          L    LLLLLLLLLLLLL          LLLLLLLL L     LL     
   196   87 B K    >   -     0   0  102  740   70   T T  R  T          T    QTQQTQTTQTQTT          TTTTTTTT T     RK     
   197   88 B S  G >  S+     0   0   70  740   59   S S  S  A          S    ASTTSASSTSASS          SSSSSSSS S     SA     
   198   89 B E  G 3  S+     0   0  126  740   21   E E  E  E          E    NEDDEDEEDEDEE          EEEEEEEE E     EE     
   199   90 B D  G <   +     0   0    2  740    3   D D  D  D          D    DDDDDDDDDNDDD          DDDDDDDD D     DD     
   200   91 B T    <   +     0   0   32  740   32   T S  T  T          S    TSTTSTSSTTTSS          SSSSSSSS T     TT     
   201   92 B A  E    S- R   0 223E   8  737    4   A A  A  A          A    AAAAAAAAAAAAA          AAAAAAAA A     AA     
   202   93 B M  E     -PR 148 222E  58  739   46   V V  V  T          V    IVMMVIVVMVIVV          VVVVVVVV V     VV     
   203   94 B Y  E     -PR 147 221E   0  739    1   Y Y  Y  Y          Y    YYYYYYYYYYYYY          YYYYYYYY Y     YY     
   204   95 B Y  E     -P  146   0E   7  740    4   Y Y  Y  Y          Y    YYYYYYYYYYYYY          YYYYYYYF Y     YF     
   205   96 B d  E     -P  145   0E   0  740    0   C C  C  C          C    CCCCCCCCCCCCC          CCCCCCCC C     CC     
   206   97 B V  E     -PS 144 217E   0  740   24   A A  A  A          A    AAAAAATAAAAAT          AAAAAAAA V     AA     
   207   98 B R  E     -PS 143 216E  21  739   39   r r  r  r          r    rrrRrrRrrsrrR          rRrrrRrR r     rR     
   208   99 B H  E     + S   0 214E   6  629   94   r d  p  y          y    itwHdr.rpylt.          g.lig.dG a     y.     
   209  100 B E  E  >  + S   0 213E  63  676   73   D E  A  G          D    PGPDGP.GKGPGS          SRSTS.YD V     DD     
   210  101 B Y  T >4 S-     0   0   80  702   91   A D  A  N          W    REYRNL.STNLEW          SGHTSIDY V     LR     
   211  102 B Y  T 34 S-     0   0  140  709   44   M Y  F  Y          Y    yYYYYy.FYYyYY          FWYYFYyy F     RW     
   212  103 B Y  T 34 S+     0   0   39  264   90   . .  S  Y          .    y..YVy.Y..y..          YEYYY.yr .     ..     
   213  104 B A  E <<  -S  209   0E   0  447   85   . A  R  A          .    A.AWGALAA.A..          AAAAAAAY .     P.     
   214  105 B M  E     +S  208   0E   0  580   59   . M  F  M          F    MFMMFMRMMVMFF          MMMMMGMF .     HN     
   215  106 B D  E     +     0   0E  19  696   48   D D  D  D          D    DDDDADDDDDDDD          DDDDDDDD D     DD     
   216  107 B Y  E     -S  207   0E  99  702   57   Y Y  Y  Y          V    YYYYYYYYYYYYV          YYYYYYYL Y     YY     
   217  108 B W  E     -S  206   0E  23  731    0   W W  W  W          W    WWWWWWWWWWWWW          WWWWWWWW W     WW     
   218  109 B G        -     0   0    0  714   13   G G  G  G          G    GGGGGGGGGGGGG          GGGGGGGG G     GG     
   219  110 B Q        -     0   0   91  701   38   Q Q  Q  Q          A    QQQQQQQQQQQQA          QQQQQQQQ Q     QQ     
   220  111 B G        -     0   0   16  687   10   G G  G  G          G    GGGGGGGGGGGGG          GGGGGGGG G     GG     
   221  112 B T  E     -R  203   0E  21  675   26   T T  T  T          T    TTTTTTTTTTTTT          TTTTTTTT T     TT     
   222  113 B T  E     -R  202   0E  72  661   75   S S  L  S          T    STSSLSTSSTSTT          SSSSSSST A     LQ     
   223  114 B V  E     -R  201   0E   0  654   18   V V  V  V          V    VLVVVVLVVLVLV          VVVVVVVV L      V     
   224  115 B T  E     -n  120   0D  36  643   13   T T  T  T          T    TTTTTTTTTTTTT          TTTTTTTT T      T     
   225  116 B V  E     +n  121   0D   6  626    6   V V  V  V          V    VVVVVVVVVVVVV          VVVVVVVV V      V     
   226  117 B S        -     0   0   36  616    5   S S  S  S          S    SSSSSSSSSSSSS          SSSSSSSS S      S     
   227  118 B S  S    S+     0   0   84  597   20   S S  S  S          S    SSSSASSSSSSSS          SSSSSSSS S      S     
   228  119 B A  S    S+     0   0   70   97   58   A E     A                  T                   EEEEEEEG              
   229  120 B W        -     0   0  123   87   40     S     K                  G                   SSSSSSST              
   230  121 B R        +     0   0  207   62   76     Q     T                  V                   QQQQQQQK              
   231  122 B H              0   0  156   56   69     S     T                  K                   SSSSSSS               
   232  123 B P              0   0  155   28   53           P                                                            
## ALIGNMENTS  771 -  840
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 A D              0   0  183  423   16  EDDD D   DDQ             D DDDZDND DD      D D DDDDDDKDEDDEDDQ  EDDD  
     2    2 A I        -     0   0   32  466   12  IITIII  IIII             IIIIVIIII II      I I IVIVIIIIIIIVIPI  IIII  
     3    3 A E        -     0   0  117  468   68  VVVIVV  VMMV             QVVVVVVVL QV      V E VVQVVVVMVVVVVMV  VIVV  
     4    4 A L  E     -A   25   0A  10  482    7  LLLLLM  LMML             MMMMMLLLM MM      L L MMMLMLLMMMMLMLM MLMMM  
     5    5 A T  E     -A   24   0A  64  482    8  TTTTTT  TTTT             TTTTTTTTT NT      T T TTNTTTTTTTTTTTT TTTTT  
     6    6 A Q  E     -A   23   0A  13  482    0  QQQQQQ  QQQQ             QQQQQZQQQ QQ      Q Q QQQQQQQQQQQQQQQ QQQQQ  
     7    7 A T  E    S+A   22   0A  64  482   35  SSSSSS  TYST             STTTTSSSS TA      S S STTTTSSSSSSSTTT TSSTS  
     8    8 A P        -     0   0   46  485    9  PPPPPP  PPPP             PPPPPPPPQ PT      P P PPPPPPPPPPPPPAP PPPPP  
     9    9 A V  S    S+     0   0   96  489   67  DAAAAD  LSSE             SSLLLGAAK SP      A L LLSVLASDAGDALSP AGALL  
    10   10 A S  E     -d  104   0B  60  491   42  FSSSSS  SSTS             SSSSSTSSF TS      S T SSTTSSSSTSSSSPSPSTSSS  
    11   11 A L  E     -d  105   0B  58  494   23  QLLLLL  LLLL             LKLLLLLLL LV      L L LLLLLLLLLLLVLVVVVLLLL  
    12   12 A S  E     +d  106   0B  60  495   42  SAAAAA  SCPA             SSSPPSAAS SS      A S PSSLPTSASAASPSSSESAPP  
    13   13 A A  E     -d  107   0B   0  495   58  VKKAAV  VTVV             AVVVVLVVT VV      V V VVVIVVAVLVVVVAGAVLAIV  
    14   14 A S    >   -     0   0   47  496   31  TSSSSS  SSSS             TPSTSSSSS ST      S T TSSSTSSSSSSSTAAAASSTT  
    15   15 A V  T 3  S+     0   0   76  496   66  PQQQAP  PQRP             VVPPLPLLV IP      L I PLIIPPPLPVLLPVVVVPPPP  
    16   16 A G  T 3  S+     0   0   42  496    5  KGGGGG  GGGG             GGGGGGGGG GG      G G GGGGGGGGGGGGGGGGGGGGG  
    17   17 A E    <   -     0   0   71  496   36  EEEGEE  EEDD             DDEEDZQQD EE      Q Q EDEGEQEEEDEEESGSGEGEE  
    18   18 A T        -     0   0   69  496   62  KTTTRR  PTRT             RTPPQRRRR RS      R P PQRQPSRRRSRSPTTTTRMPP  
    19   19 A V  E     - B   0  75A  11  496   36  VVVVVV  AVVV             VVAAAAAAV VV      A A AAVAAAVVAVVVTVVVVAVAA  
    20   20 A T  E     - B   0  74A  67  495   29  TTTTTS  STTT             TTSSSATTS IF      T S SSISSTTDTTTTSTTTTTTSS  
    21   21 A I  E     - B   0  73A   1  494   17  IIIIML  IILI             LIIIILIIV II      I I IIIIIIIMLIIIIIIIILIII  
    22   22 A T  E     -AB   7  72A  29  494   59  TNNNSN  SSTR             LNSSSSSST NS      S S SSNSSSNKSNNKSSNSKSNSS  
    23   23 A b  E     -AB   6  71A   0  495    1  CCCCCC  CCCC             CCCCCCCCC CC      C C CCCCCCCCCCCCCCCCCCCCC  
    24   24 A R  E     -AB   5  70A 110  495   47  RKKKKK  RQRK             EQRRRRRRK HR      R K RRHRRRKTRKKKRQQQQRKRR  
    25   25 A A  E     -A    4   0A  10  495   28  AAAAAS  SAAA             AASSSAAAA AS      A S SSASSAAAASSASAAAAAAAS  
    26   26 A S  S    S+     0   0   66  495    4  SSSSSS  SSSS             SSSSSSSSS SS      S S SSSSSSSSSSSSSSSSSSSSS  
    27   27 A E  S    S-     0   0  101  495   38  QQQQQQ  QQQS             QQQQQQEEQ EK      E Q QQEQQEEQQQQQQQEQQQQQQ  
    28   28 A N        +     0   0   83  495   45  SSSSGS  SGGS             SSSSSSSSN NS      S S SSNSSNSSSSSSSSSSSSSSS  
    29   29 A I    >   -     0   0    5  496   32  IVVLIL  LIIL             VVNLLLVVV IL      V L LLILLIIVVLLLLVIVIVLLL  
    30   30 A Y  T 3   -     0   0  155  496   81  GSSySy  eSSt             lyLlvsvdG Nl      d l lvNvlgtYSflllySySdfll  
    31   31 A S  T 3  S+     0   0   53  471   64  SSNdNn  nNNq             tnDttnssT St      s t ntStthdHSnnttnNnSndtn  
    32   32 A Y    <   +     0   0   63  495   53  SYYLYY  FYYY             FRYYYYLFN WY      F Y YFWYYNLYSYYYYNWNYYYYY  
    33   33 A L  E     -E   90   0B   0  495    7  LLLLLL  LLLL             LLLLLLMMV LL      M L LLLLLLLLLLLLLLLLLLLLL  
    34   34 A A  E     -E   89   0B   0  495   71  HNSAHA  SNHA             AANNNAHHA SY      H N HQSHYHYAAAAEAAAAAGNDD  
    35   35 A W  E     -EF  88  48B   1  496    0  WWWWWW  WWWW             WWWWWWWWW WW      W W WWWWWWWWWWWWWWWWWWWWW  
    36   36 A Y  E     -EF  87  46B   0  496    8  YYYHYY  YYYY             YFYYYYFYY HF      Y L YYHFYYYYYYHFYFYFYYYYY  
    37   37 A Q  E     -EF  86  45B   7  496   27  QQQQQQ  QQQQ             QQLLLQQQQ QL      Q L LLQLLQQQQQQQLQQQQQQLL  
    38   38 A Q  E     -E   85   0B  21  496    4  QQQQQQ  QQQQ             QQQQQQQQK QQ      Q Q QQQQQQHQQQQQQQQQQQQQQ  
    39   39 A K    >   -     0   0   51  495    8  KKKKKK  KKKK             KKKKKKKKK KR      K R KKKKKKKKKKKKKKKKKRKKK  
    40   40 A Q  T 3  S+     0   0  190  496   18  PPPPAP  PPPS             PPAAAPPPP PP      P P PPPPPPPPPPPRPPPPPPPPP  
    41   41 A G  T 3  S+     0   0   86  496   10  DGGGGG  GGGG             KGGGGGGGG GG      G G GGGGGGGGGGGGGGGGGGGGG  
    42   42 A K  S <  S-     0   0  126  495   54  QQQQQQ  QQQQ             KQQQQQQQQ NQ      Q Q QQNQQQQQQQQKQQQQQQQQQ  
    43   43 A S        -     0   0   21  495   56  SAAAAS  SAAA             APSSSAPPS AS      P S SSASSRAAAAAFSPPPRAASS  
    44   44 A P        -     0   0    4  495   10  PPPPPP  PPPP             PPPPPPPPP PP      P P PPPPPPPPPPPIPPPPPPPPP  
    45   45 A Q  E     -F   37   0B  74  495   32  KKKKRK  QKKK             KKRQKRKKK QQ      K K RKQQQKRKRKKKQKKKKRKQQ  
    46   46 A F  E     +F   36   0B  25  495   41  LLLQLL  LLLL             LLLLLLLLP LL      L R LLLLLLCPLLQSLLPLLLLLL  
    47   47 A L  E     +     0   0B   4  495    9  LLLLLL  LLLL             LLLLLLLLL LL      L L LLLLLLLLLLILLLLLLLLLL  
    48   48 A V  E     -FG  35  54B   0  496    5  IIIIII  IIII             IIPIIMIIM II      I I IIIIIIIIIIIIIIIIIIIII  
    49   49 A Y  E >> S+ G   0  53B  39  496   17  KYYYRS  YYNY             YYEYYYYYY YY      Y Y YYYYYSYYYYLYYYYYYYYYY  
    50   50 A N  T 34 S-     0   0   52  496   91  YGKYYW  EYGL             DKQTKGGLS KR      R L LKKQESWSGWWRAAEARGLLL  
    51   51 A A  T 34 S+     0   0    3  496   44  AAAAAA  ANAG             AADLVVAAA AL      A V GVAVVAAAAAAVVAAAAAAGG  
    52   52 A K  T <4 S+     0   0  148  496   25  SSSSTS  TNSS             SSSSSSSSS SF      S S SSSSSSTSSSSSSSSSSSSSS  
    53   53 A T  E  <  -G   49   0B  47  496   68  QDSTTN  NSSS             NTQYNSNNY NH      N K NNNNNNNTSSTNYNKNTSKNN  
    54   54 A L  E     -G   48   0B  60  496   59  SRRRLR  RLLL             LLRRRRRLR YL      L L RRYRRLLRRRRLRLLLLRRRR  
    55   55 A G    >   -     0   0    9  495   70  IAAAHE  ALQQ             EAAAFAGEY HA      E D AFHFAGAPAAVHAAAAAADAA  
    56   56 A E  T 3  S+     0   0  192  495   35  SSSSSS  SSPS             TSSSSTSSS TS      S S SSTSSSSSTSSSSSSSSTSSS  
    57   57 A G  T 3  S+     0   0   70  496    5  GGGGGG  GGGG             GGGGGGGGG WG      G G GGWGGGGGGGGGGGGGGGGGG  
    58   58 A V    <   -     0   0   25  494   10  VVVVVV  VVVV             VVVVVIVVV VV      I V VVVVVVVIIVVVVVVVVVVVV  
    59   59 A P    >   -     0   0   47  495    7  PPPPPP  PPPP             PPPPPPPPP PP      P P PPPPPPPPPSPPPPPPSPPPP  
    60   60 A S  T 3  S+     0   0  115  496   56  SDDDAD  DLSS             SSDDDDAAD SD      D D DDSDDAADDDDPDSSSSDDDD  
    61   61 A R  T 3  S+     0   0   44  496    4  RRRRRR  RRRR             RRRRRRRRR RR      R R RRRRRRRRRQRRRRQRRRRRR  
    62   62 A F  E <   +C   75   0A   5  496    1  FFFFFF  FFLF             FFFFFFFFF FF      F F FFFFFFFFFFYFFFFFFFFFF  
    63   63 A S  E     -C   74   0A  55  495   23  SSSSSS  SSSS             SKSSSSSST SS      S T SSSSSSSSSSSSSKKKKSSSS  
    64   64 A G  E     +C   73   0A  13  496    2  GGGGGG  GGGG             EGGGGGGGG GG      G G GGGGGAGGGGGGGGGGGAGGG  
    65   65 A S  E     +C   72   0A  63  496    6  SSSSSS  SSSS             SSSSSSSSS SS      S S SSSSSSSSSSSSSSSSSSSSS  
    66   66 A G  E     -C   71   0A  36  496   14  GGGGGG  GRGG             GGGGGGGGG GG      G G GGGGGGRGGGGGGGGGGGGGG  
    67   67 A S  E >   +C   70   0A  79  496    9  SSSSSS  SSSS             SSSSSSSSS SS      S S SSSSSSSSSSSSSSSSSSSSS  
    68   68 A G  T 3  S-     0   0   16  496   12  GGGGGG  GGGG             GGGGGGGRG GG      R G GGGGGGGGGGGGGGGGGGGGG  
    69   69 A T  T 3  S+     0   0   67  495   13  TTTTTT  TTTT             TTTTTATTT TT      T T TTTTTTTTTTTTTTTTTTTTT  
    70   70 A Q  E <   +BC  24  67A 110  496   29  DDDDDD  DDDD             DQDDDDDDD DA      D D DDDDDDDDEDDDDQQQQDDDD  
    71   71 A F  E     -BC  23  66A   2  494    5  FFFFFF  FYFF             FFFFFFFFF YF      F F FFYFFFFFFFFFFFFFFFFFF  
    72   72 A S  E     -BC  22  65A  26  495   30  TTTTST  TSTT             TTTTTTSTT ST      T T TTSTTTTTTTTTTTTTTTTTT  
    73   73 A L  E     -BC  21  64A   0  496    2  LLFLLL  LLLL             FLLLLLLLL LL      L L LLLLLLLLLLLLLLLLLLLLL  
    74   74 A K  E     -BC  20  63A  97  496   38  TTTTTT  KTTT             TTRKKTITT SR      T K KKSKKTSTTTTTKTTTTSTKK  
    75   75 A I  E     -BC  19  62A   0  496    1  IIIIII  IIII             IIIIIIIII SI      I I IISIIIIIIIIIIIIIIIIII  
    76   76 A N  S    S-     0   0   86  496   29  NNSSSS  SSSN             SSGSSSHDS SS      D S SSSSSNSSSSSSSNSNSSSSS  
    77   77 A S  S    S-     0   0   58  496   62  SNNNNS  RSSR             GDRRRRPPN SR      P R RRSRRPSNSSSSRGGGGRNRR  
    78   78 A L        -     0   0    0  496   27  LFFFVL  VLLV             LVVVVLMVV LV      V V VMLVVVMFLLLLVVVVVLFVV  
    79   79 A L    >   -     0   0   67  496   31  EQQQEQ  EEEE             ZQEQEZEEQ QE      E E EEQEEEEQEQQEEQQQEEQQE  
    80   80 A P  G >  S+     0   0   92  496   59  AAPAAA  APPA             PCAAAPEAS PA      A A AAPPAEPAPAAAACCCCPAAA  
    81   81 A E  G 3  S+     0   0  102  496   15  EDEEEE  EEEE             ZAEEEEDDE EE      D E DEEEETEEEEEEEDADDEEEE  
    82   82 A D  G <  S+     0   0    1  496    5  DDDDDD  DDDD             BDDDDDDDD DD      D D DDDDDDDDDDDDDDDDDDDDD  
    83   83 A F    <   +     0   0   29  495   73  AAAAAV  AVVA             FAAVLFSAL IV      V L VLILVAAAFVVVVAAAAFAAV  
    84   84 A G  E    S- H   0 105B  17  496   23  AAAAAA  GAAG             AAGGGAAAA AG      A G GGAGGAAAAAAAGAAAAAAGG  
    85   85 A S  E     -EH  38 104B  24  496   62  TVVVVA  VTND             VTIVIVMTE TV      T V IITVVNVVVVIIVTTTTVVVV  
    86   86 A Y  E     -EH  37 103B   0  496    0  YYYYYY  YYYY             YYYYYYYYY YY      Y Y YYYYYYYYYYYYYYYYYYYYY  
    87   87 A Y  E     -E   36   0B   5  495    4  YYYYYY  YFDY             YYYYFYFYF YY      Y Y YFYYYYYCYCYYYYYYYYYYY  
    88   88 A b  E     -E   35   0B   0  496    0  CCCCCC  CCCC             CCCCCCCCC SC      C C CCSCCCCCCCCCCCCCCCCCC  
    89   89 A Q  E     -EI  34  99B   0  494   48  QLQQQQ  QLQQ             QRMMSQHQQ VM      Q W MSVLMQQEQQQFMAQAQQMMM  
    90   90 A H  E     -E   33   0B  22  486   28  QQQQQQ  QQQQ             ZVQQQQQQQ QQ      Q Q QQQQQQQQQQQQQAHAQQQQQ  
    91   91 A H        +     0   0    0  423   89  SYSGYY  HNYT             YARRTYTNF AH      S G ATARGGDYYEFHARVRYYNAA  
    92   92 A Y  S    S+     0   0  104  454   87  SNYYDY  KDSL             DSSLTGKNN KL      N T LTKTIKYYSYHTLYMYYGYLL  
    93   93 A G  S    S-     0   0   34  421   71  SDNNNS  EDSS             TTFEHSEER SE      E H QHSHQEKGNSSHQSNSSSDEQ  
    94   94 A T  S    S-     0   0  104  444   88  LENTYF  SLYN             LNYIVSVDY LY      V F SVLNLSENWSAWAGYASSDVT  
    95   95 A P  S    S+     0   0    7  441   51  PPPPAP  PPPP             PNPPPPPPP PP      P P PPPPPPPPPPPPPPSPSFPPP  
    96   96 A P  S    S-     0   0   55  420   76  HPPPPP  PPPL             SIYYPFWLL PY      L Q YWPPPPPPHPPPPAiFNGP P  
    97   97 A L        -     0   0   21  151   88  .....Q  ...T             ......... ..      . . ...  ...T .  .f...     
    98   98 A T        -     0   0   40  278   41  .....C  ...V             TVTTTTTTT .T      T T TT.  T..V T  .GL..     
    99   99 A F  B     -I   89   0B  18  277   26  .....F  ...I             FFFFFFFFF .F      F F FF.   ..I F  .SF..     
   100  100 A G        -     0   0    3  285   38  .....S  ...Q             GGGGGGGGG .G      G G GG.   ..Q S  .NL..     
   101  101 A G        -     0   0   52  300   63  .....   .TTT             VGQQGQGAS .G      A G QG.   ..P    .PG.Q     
   102  102 A G        -     0   0   11  300   41  ..P..   .VVH             AGGGGGGGG .G      G G GG.   ..E    GGG.G     
   103  103 A T  E     - H   0  86B   0  360   19  TTTTT   TTTT             STTTTSTTT .T      T T TTT   .TT    STC.T     
   104  104 A K  E     -dH  10  85B  98  359   60  VVVVV   VQQK             KERKKKDKK .K      K K KKV   .VK     IS.K     
   105  105 A L  E     -dH  11  84B   4  343   39  LLLLL   IATT             VVLLLLLLL TL      L L LLI   .LT     VTVV     
   106  106 A E  E     -d   12   0B 108  326   52  QQQQQ   QMMS             EVEEEEEEE VE      D E EEK   T S     EDDE     
   107  107 A I  E      d   13   0B 113  295   51  PPAPP    TTL             SVVIIIILL II      L I IIV   V T     VM I     
   108  108 A K              0   0  145  261   18  RRRRR    KK              KKRRKK KK KK      K K KK    K R     R  K     
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30        DQ            E             E  QQQEEE Q Q                       
   111    2 B V        +     0   0   19  428   12        IV            V             E  VVVVVV V V                     VV
   112    3 B K  E     -J  134   0C 111  430   32        QQ            Q             K  QQQQQQ K Q                     TQ
   113    4 B L  E     -J  133   0C   3  452    1        LL            L             L  LLLLLL L L                     LL
   114    5 B Q  E     -J  132   0C  83  454   70        VQ            Q             V  QQQQQQ Q Q                     DQ
   115    6 B E  E     +J  131   0C   5  458   22        EQ            E             E  QQEEQQ E Q                     EQ
   116    7 B S  E     +J  130   0C  69  463   14        SP            S             S  PPSSSS S S                     SS
   117    8 B G        +     0   0   36  467    4        GG            G             G  GGGGGG G G                     RG
   118    9 B G        +     0   0   29  718   50        GA    TAPPAPPAPTTPT         G  AAPPPP P A                     GA
   119   10 B D        -     0   0   96  725   42        DE    EEEGEGGEGEDGE         G  EEEHEE G E                     GE
   120   11 B L  E     +n  224   0D  79  727   14        VL    LLLLLLLLLLLLL         L  LLLLLL L L                     LL
   121   12 B V  E     -n  225   0D  16  729   31        KV    MVVVVVVAVMVVM         V  VVVVVV V V                     QV
   122   13 B Q    >   -     0   0  114  730   53        RK    KKRARAQRAKAQK         E  KKKKKK A M                     TR
   123   14 B P  T 3  S+     0   0   66  730    7        PP    PPPPPPPPPPPPP         P  PPPPPP P P                     PA
   124   15 B G  T 3  S+     0   0   58  734   31        AG    GGGSGSSGSGSSG         G  GGGGGG S G                     GG
   125   16 B G    <   -     0   0   25  736   63        EA    AAAQAQQAQAQQA         G  AAAADD Q A                     GS
   126   17 B S        +     0   0   78  735   29        SS    SSSSSSSSSSSSS         S  SSSSSS S S                     SS
   127   18 B L  E     - K   0 192C  25  737   28        LV    VVVLVLLVLVLLL         L  VVVVVV L V                     LV
   128   19 B K  E     - K   0 191C  93  735   55        RK    KKKSKSSKSKSSK         R  KKKKKK S K                     TK
   129   20 B L  E     - K   0 190C   0  740   16        LL    ILMILIILIIIII         L  LLMMMM I M                     LM
   130   21 B S  E     -JK 116 189C  28  740   37        SS    SSSTSTTSTSTTS         S  SSSSSS T S                     VS
   131   22 B d  E     -JK 115 188C   0  740    0        CC    CCCCCCCCCCCCC         C  CCCCCC C C                     CC
   132   23 B A  E     -JK 114 187C  52  740   67        QK    KTKTKTTKTKTTK         V  KKKKKK T K                     KK
   133   24 B A  E     +J  113   0C   8  740   48        GA    AAAVAVVAVAVVA         G  AAAAAA V A                     GA
   134   25 B S  E     +J  112   0C  58  740   14        SS    TSSSLSSSSTSSS         S  SSSSSS S S                     SS
   135   26 B G  S    S+     0   0   56  739    3        GG    GGGGGGGGGGGGG         G  GGGGGG G G                     GG
   136   27 B F  S    S-     0   0   33  740   31        YY    YFYFYFFYFYFFY         F  YYYYYY F Y                     FY
   137   28 B T    >   -     0   0   93  740   53        NT    TNTSTSSTSTSSS         R  TTKTTT S T                     TT
   138   29 B F  G >  S+     0   0    2  740   28        FF    FIFLFLLFLFLLF         F  FFFFFF L F                     FF
   139   30 B S  G 3  S+     0   0   57  740   55        GT    SKTTTTTTTSTTS         S  TTSTTT T T                     ST
   140   31 B S  G <  S+     0   0   71  740   57        DS    SDDSDSSSSSSSS         G  SSSNDS S D                     SS
   141   32 B Y  S <  S-     0   0   44  738   42        YY    YTYYYYYYYYYYY         Y  YYSYYY Y H                     SY
   142   33 B T        -     0   0   30  739   92        HW    WYVGEGGWGWGGW         P  WWVVYV G W                     TG
   143   34 B M  E     -OP 160 207E   0  739   49        MM    IIIVVVVMVIVVI         I  MMMMMM V I                     MI
   144   35 B S  E     -OP 159 206E   0  740   72        SH    EHSHHHHQNEHHE         G  QHHHDH H H                     HN
   145   36 B W  E     +OP 158 205E   0  740    0        WW    WWWWWWWWWWWWW         W  WWWWWW W W                     WW
   146   37 B V  E     -OP 156 204E   0  740   17        IV    VVVVVVVVVVVVI         V  VVVVVV V V                     VV
   147   38 B R  E     -OP 155 203E  10  740   21        RK    KKKRKRRKRKRRK         R  KKKKKK R K                     RK
   148   39 B Q  E     -OP 154 202E   9  740    4        QQ    QQQQQQQQQQQQQ         Q  QQQQQQ Q Q                     QQ
   149   40 B T    >   -     0   0    9  739   74        AR    RRRPTPSRPRPSR         S  RRKMS. P R                     AR
   150   41 B P  T 3  S+     0   0   80  740   11        PP    PPTPPPPPPPPPP         P  PPAPHK P P                     PP
   151   42 B E  T 3  S-     0   0  151  740   29        GG    GEGGVGGGGGGGG         G  GGGGGL G G                     GG
   152   43 B K    <   +     0   0  121  740   37        KR    HQQKHKKQRHKKH         R  QRQQKE K Q                     KQ
   153   44 B R        -     0   0  113  739   42        GG    GGGGGGGGVGGGG         G  GGGGSG G G                     GG
   154   45 B L  E     -O  148   0E   9  740   13        LL    LLLLLLLLLLLLL         P  PLLLLL L L                     LL
   155   46 B E  E     -O  147   0E  44  739    4        EE    EEEEEEEEEEEEE         E  EEEEEE E E                     EE
   156   47 B W  E     +O  146   0E  15  739   11        WW    WWWWWWWWWWWWW         W  WWWWWW W W                     WW
   157   48 B V  E     -     0   0E   0  739   28        II    IIILILLILILLI         L  IIIIII L I                     VI
   158   49 B A  E     -O  145   0E   0  740   36        AG    GGGGGGGGAGVGG         A  GGGGGG G G                     AG
   159   50 B S  E     -OQ 144 168E   0  740   94        YR    EREVAVVAVEVVE         M  ERYYYY V A                     GY
   160   51 B I  E     -OQ 143 167E   4  739   18        II    IIIIIIIIIIIII         I  IIIIII I I                     II
   161   52 B N    >   -     0   0   47  740   85        SD    LDYWHWWYWLWWL         Q  DDNHYN W E                     YN
   162   53 B N  T 3  S+     0   0   65  740   86        YP    PSPAPASPGPSSP         S  PPPPPL A T                     SP
   163   54 B G  T 3  S-     0   0   65  740   68        NN    GAGGGGGGDGDGG         S  SNYYNY G S                     DG
   164   55 B G  S <  S+     0   0   30  740   50        GS    SNNGSGGDGSGGS         G  DSNNNN G D                     GN
   165   56 B G  S    S+     0   0   74  739   59        NG    GGGSGSSGTGSSG         n  IGDDGD S S                     SG
   166   57 B R        +     0   0  163  548   85        TG    TDN.G..D.T..Y         e  YGVGGG . Y                     YY
   167   58 B T  E     -Q  160   0E  62  724   48        QT    TSTTTTTTTTTTT         T  TTTSTT I T                     TT
   168   59 B Y  E     +Q  159   0E  53  723   87        YK    NKYNANDRNNTDN         K  DKKKSK N T                     YK
   169   60 B Y        -     0   0   44  737    7        YY    YYYYYYYYYYYYY         Y  YYYYYY Y Y                     YY
   170   61 B P    >>  -     0   0   20  737   66        AN    NDNNNNNTHNNNN         S  NNNDNN N N                     AN
   171   62 B D  T 34 S+     0   0  148  739   65        DE    EPESQSAQSESAE         D  QEGDQE S H                     PE
   172   63 B T  T 34 S+     0   0   90  739   62        VK    KKKAKAAKAKDAK         S  EKKKKK A K                     AK
   173   64 B V  T X> S+     0   0    1  740   43        VF    FFFLFLFFLFLFF         V  FFFFFF L F                     VF
   174   65 B K  B 3< S+l  177   0C 142  739   35        KK    KQKMKMIKIKKIK         R  KKKEKK M K                     KK
   175   66 B G  T 34 S+     0   0   74  739   36        GS    GGDSGSSGSGSSG         G  GSGGGG S G                     GG
   176   67 B R  T <4 S+     0   0   36  739   21        RK    KKMRKRRKRKRRK         R  KKKKKK R K                     RK
   177   68 B F  E  <  -lM 174 192C   2  740   67        FA    AAALALLALALLA         F  AAAAAA L A                     AT
   178   69 B T  E     - M   0 191C  79  740   38        TT    TTTSTSSTTTSST         T  TTTTTT S T                     TT
   179   70 B I  E     + M   0 190C   5  740   22        IL    FILILIILIFIIF         I  LLLLLL I L                     IL
   180   71 B S  E     - M   0 189C  51  736   45        ST    ITTSTSSTSISST         S  TTTTTT S T                     ST
   181   72 B R  E     - M   0 188C  30  739   68        RV    AAVKAKKAKAKKA         R  VVSSVS K V                     RV
   182   73 B D  E > > - M   0 187C  60  738    5        ND    DDDDDDDDDDDDD         D  DDDDDD D D                     DD
   183   74 B N  G > 5S+     0   0   48  739   59        NK    TTKNKNNKNTNNT         N  TKKKKK N K                     NK
   184   75 B A  G 3 5S+     0   0   99  739   41        PP    SSSSSSSSFSSSS         S  SPSSSS S S                     GS
   185   76 B K  G < 5S-     0   0  111  740   54        SS    SSSKSKKSKSKKS         Q  SSSSSS K S                     QS
   186   77 B N  T < 5 +     0   0   62  740   46        SS    NNNSSSSSRNSSN         G  SSSSSS S S                     SS
   187   78 B T  E   < -KM 132 182C  16  740   68        MT    TTTQTQQTQTQQT         T  TTTTTT Q T                     TT
   188   79 B L  E     -KM 131 181C   0  737   61        LA    AAAVAVVAVAVVA         S  AAAAAA V V                     VA
   189   80 B Y  E     -KM 130 180C  41  737   41        YY    YYYFYFFYFYFFY         Y  YYYYYY F Y                     KY
   190   81 B L  E     -KM 129 179C   0  739    8        LM    MLMLMLFMLMLFM         L  MMMMMM L M                     LM
   191   82 B Q  E     -KM 128 178C  76  739   41        QQ    QQQKEKKQKQKKQ         Q  QQEEEE K Q                     QQ
   192   83 B M  E     +KM 127 177C   0  740   11        ML    LLLMLMMLLLMML         M  LLLLLL M L                     LL
   193   84 B S        +     0   0   42  740   54        NS    SSTNSNNSTSNNS         N  SSSSHS N S                     NR
   194   85 B S  S    S-     0   0   68  739   23        GS    SSSSSSSSSSSSS         N  SSSSSS S S                     SS
   195   86 B L        -     0   0    3  740   16        LL    LLLLLLLLLLLLL         L  LLLLLL L L                     LL
   196   87 B K    >   -     0   0  102  740   70        KT    TTTQTQQAQTQQT         R  TTTTTT Q T                     KT
   197   88 B S  G >  S+     0   0   70  740   59        TS    SSSTSTASTSTAS         S  SSSSSS T S                     AS
   198   89 B E  G 3  S+     0   0  126  740   21        EE    EEEDEDNEDEDNE         E  EEEEEE D E                     EE
   199   90 B D  G <   +     0   0    2  740    3        DD    DDDDDDDDDDDDD         E  DDDDDD D D                     DD
   200   91 B T    <   +     0   0   32  740   32        TS    STSTSTTSTSTTS         S  SSSSSS T S                     TS
   201   92 B A  E    S- R   0 223E   8  737    4        AA    AAAAAAAAAAAAA         A  AAAAAA A A                     GA
   202   93 B M  E     -PR 148 222E  58  739   46        MV    VVVMVMIVTVMII         R  VVVVVV M V                     TV
   203   94 B Y  E     -PR 147 221E   0  739    1        YY    YYYYYYYYYYYYY         Y  YYYYYY Y Y                     YY
   204   95 B Y  E     -P  146   0E   7  740    4        YY    YYFYYYYYYYYYY         Y  YYYYYY Y Y                     FF
   205   96 B d  E     -P  145   0E   0  740    0        CC    CCCCCCCCCCCCC         C  CCCCCC C C                     CC
   206   97 B V  E     -PS 144 217E   0  740   24        AA    TAAATAAAAAAAA         V  AAAAAA A A                     AA
   207   98 B R  E     -PS 143 216E  21  739   39        rr    rRrvArrrrrRrS         r  Rrrrrr r r                     kr
   208   99 B H  E     + S   0 214E   6  629   94        rg    sDrgRthglsHr.         p  .yynyy g g                     ag
   209  100 B E  E  >  + S   0 213E  63  676   73        GS    GGGVAGGSRGPRG         R  RGYGSG L G                     RG
   210  101 B Y  T >4 S-     0   0   80  702   91        SS    QEARTGYSPQSYG         Y  YDDNYD R P                     GS
   211  102 B Y  T 34 S-     0   0  140  709   44        FY    SYYYYYYYFSYYI         Y  YYYFYP Y Y                     FY
   212  103 B Y  T 34 S+     0   0   39  264   90        ..    .D......Y.GYT         E  G.D.SN . .                     ..
   213  104 B A  E <<  -S  209   0E   0  447   85        ..    .WAAYA.GA.GAT         T  GAGYYA I Y                     .Y
   214  105 B M  E     +S  208   0E   0  580   59        .F    .FMMFMVFL.IMA         M  QMIFGM M F                     .F
   215  106 B D  E     +     0   0E  19  696   48        .D    DGDDDDDADDADD         S  DDADAD D D                     .D
   216  107 B Y  E     -S  207   0E  99  702   57        .Y    YYYYYYYYYYYYY         F  YYYYYY Y Y                     .Y
   217  108 B W  E     -S  206   0E  23  731    0        WW    WWWWWWWWWWWWW         W  WWWWWW W W                     WW
   218  109 B G        -     0   0    0  714   13        KG    GGGGGGGGGGGGG         G  GGGGGG G G                      G
   219  110 B Q        -     0   0   91  701   38        RQ    QQQQQQQQQQQQQ         P  QQQQQQ Q Q                      Q
   220  111 B G        -     0   0   16  687   10        NG    GGGGGGGGGGGGG         G  GGGGGG   G                      G
   221  112 B T  E     -R  203   0E  21  675   26        GT    TTTTTTTTTTTTT         V  TTTTTT   T                      T
   222  113 B T  E     -R  202   0E  72  661   75        MT    TLSSTSTLSTLST         E  SSTTLS   T                      T
   223  114 B V  E     -R  201   0E   0  654   18        VL    LVVVLVLVVLVVL         V  VVVLVV   V                      L
   224  115 B T  E     -n  120   0D  36  643   13         T    TTTTTTTTTTTAT         F  TTTTTT   T                      T
   225  116 B V  E     +n  121   0D   6  626    6         V    VVVVVVVVVVVVV         V  VVVV     V                      V
   226  117 B S        -     0   0   36  616    5         S    SSSSSSSSSSSSS         S  SSSS     S                      S
   227  118 B S  S    S+     0   0   84  597   20         S    SASSSSSASSASS         S  SSSS     S                      S
   228  119 B A  S    S+     0   0   70   97   58                                    A  EEG      G                       
   229  120 B W        -     0   0  123   87   40                                    P  SS                               
   230  121 B R        +     0   0  207   62   76                                    K  QQ                               
   231  122 B H              0   0  156   56   69                                    T  SS                               
   232  123 B P              0   0  155   28   53                                    A                                   
## ALIGNMENTS  841 -  910
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 A D              0   0  183  423   16   EED                                          Q  DDDDDDDD DD          
     2    2 A I        -     0   0   32  466   12   IIT                                          I LIIIIIIIV IV I        
     3    3 A E        -     0   0  117  468   68   VTV                                          V VVVVVVVVV VV V        
     4    4 A L  E     -A   25   0A  10  482    7   LMM                                         LMMMMLMMMMLM MM L        
     5    5 A T  E     -A   24   0A  64  482    8   TIT                                         TTTTTTTTTTTT TT T        
     6    6 A Q  E     -A   23   0A  13  482    0   QQQ                                         QQQQQQQQQQQQ QQ Q        
     7    7 A T  E    S+A   22   0A  64  482   35   SSS                                         TTTTSSSSATST TT S        
     8    8 A P        -     0   0   46  485    9   PSP                                         PPPPPPPPVAPP PP P        
     9    9 A V  S    S+     0   0   96  489   67   GSE                                         SSASTLLLFPAV LL A        
    10   10 A S  E     -d  104   0B  60  491   42   SSS                                         PSSPFSSSSSSS SS S        
    11   11 A L  E     -d  105   0B  58  494   23   LLL                                         VVVVLLLLNALL LL L        
    12   12 A S  E     +d  106   0B  60  495   42   ASS                                         SSESAPPPPLAP PP A        
    13   13 A A  E     -d  107   0B   0  495   58   AVV                                         AAVAVVVVVVVV VV V        
    14   14 A S    >   -     0   0   47  496   31   SSS                                         AAAATTTTTTSS SS S        
    15   15 A V  T 3  S+     0   0   76  496   66   QRA                                         VVVVAPPPLPLL LL L        
    16   16 A G  T 3  S+     0   0   42  496    5   GGG                                         GGGGSGGGGGGG GG G        
    17   17 A E    <   -     0   0   71  496   36   EDE                                         GGGGKEEETEQG DD Q        
    18   18 A T        -     0   0   69  496   62   RRS                                         TTTTKPPPSSRQ QQ R        
    19   19 A V  E     - B   0  75A  11  496   36   VVV                                         VVVVVAAAAVAA AA A        
    20   20 A T  E     - B   0  74A  67  495   29   TKT                                         TTTTTSSSSSTS SS T        
    21   21 A I  E     - B   0  73A   1  494   17   MII                                         IIIIIIIIIIII II I        
    22   22 A T  E     -AB   7  72A  29  494   59   TTR                                         SNKSSSSSSSSS SS S        
    23   23 A b  E     -AB   6  71A   0  495    1   CCC                                         CCCCCCCCCCCC CC C        
    24   24 A R  E     -AB   5  70A 110  495   47   TRK                                         QQQQTRRRRRKR RR K        
    25   25 A A  E     -A    4   0A  10  495   28   TSA                                         SSAAASSSSSAS SS A        
    26   26 A S  S    S+     0   0   66  495    4   SSS                                         TSSSSSSSSSSS SS S        
    27   27 A E  S    S-     0   0  101  495   38   SES                                         KQQQEQQQKKQQ QQ Q        
    28   28 A N        +     0   0   83  495   45   SDG                                         SSSSSNSSSSSS SS S        
    29   29 A I    >   -     0   0    5  496   32   VII                                         IVIVLLLLLLLL IL V        
    30   30 A Y  T 3   -     0   0  155  496   81   sSS                                         yySyyllllldv vv d        
    31   31 A S  T 3  S+     0   0   53  471   64   sSN                                         bgTnhbdnttst tt s        
    32   32 A Y    <   +     0   0   63  495   53   NYH                                         YRYNYYYYYYYY YY F        
    33   33 A L  E     -E   90   0B   0  495    7   LLI                                         LLLLLLLLLLML LL M        
    34   34 A A  E     -E   89   0B   0  495   71   HNA                                         ASSSADNDYYNH EH N        
    35   35 A W  E     -EF  88  48B   1  496    0   WWW                                         WWWWWWWWWWWW WW W        
    36   36 A Y  E     -EF  87  46B   0  496    8   YYY                                         YFYFYYYYYFYY YY Y        
    37   37 A Q  E     -EF  86  45B   7  496   27   QQQ                                         QQQQQLLLLLQL LL Q        
    38   38 A Q  E     -E   85   0B  21  496    4   QQQ                                         ZQQQKZQQQQQQ QQ Q        
    39   39 A K    >   -     0   0   51  495    8   KKK                                         KKKKKKKKKRKK KK K        
    40   40 A Q  T 3  S+     0   0  190  496   18   PPS                                         PPPPPPPPPPPP PP P        
    41   41 A G  T 3  S+     0   0   86  496   10   GGG                                         GGGGEGGQGGGG GG G        
    42   42 A K  S <  S-     0   0  126  495   54   AQK                                         QQQQQZQQQQQQ XQ Q        
    43   43 A S        -     0   0   21  495   56   SAA                                         PPRPSSSSSCPS XS P        
    44   44 A P        -     0   0    4  495   10   PPP                                         PPPPPPPPPPPP XP P        
    45   45 A Q  E     -F   37   0B  74  495   32   RKK                                         KKKKKZZQQQKQ KK K        
    46   46 A F  E     +F   36   0B  25  495   41   LLL                                         ARLLLLLLLLLL LL L        
    47   47 A L  E     +     0   0B   4  495    9   LLL                                         LLLLLLLLLLLL LL L        
    48   48 A V  E     -FG  35  54B   0  496    5   III                                         IIIIIIIILIII II I        
    49   49 A Y  E >> S+ G   0  53B  39  496   17   YYY                                         YYYYYYYYYYYY YY Y        
    50   50 A N  T 34 S-     0   0   52  496   91   RGE                                         TRRKGLALQRAR GK T        
    51   51 A A  T 34 S+     0   0    3  496   44   TTA                                         AAAAAGLGMMAV IV T        
    52   52 A K  T <4 S+     0   0  148  496   25   SNS                                         SSSSSSSSSSSS SS S        
    53   53 A T  E  <  -G   49   0B  47  496   68   TST                                         STTTNNNNNNNN NN N        
    54   54 A L  E     -G   48   0B  60  496   59   PLR                                         LLLLRRRRLLLR RR L        
    55   55 A G    >   -     0   0    9  495   70   AED                                         AAAAYAAAAAEF FF E        
    56   56 A E  T 3  S+     0   0  192  495   35   SST                                         SSSSISSSSSSS SS S        
    57   57 A G  T 3  S+     0   0   70  496    5   GGG                                         GGGGGGGGGGGG GG G        
    58   58 A V    <   -     0   0   25  494   10   VVV                                         VVVVVVVVVVIV VV I        
    59   59 A P    >   -     0   0   47  495    7   SPP                                         PSSPPPPPPPPP PP P        
    60   60 A S  T 3  S+     0   0  115  496   56   ASD                                         SSSSDNDDDDAD DD A        
    61   61 A R  T 3  S+     0   0   44  496    4   RRR                                         RRRRRRRRRRRR RR R        
    62   62 A F  E <   +C   75   0A   5  496    1   FFF                                         FFFFFFFFFFFF FF F        
    63   63 A S  E     -C   74   0A  55  495   23   SSS                                         TTKKTSSSSSSS SS S        
    64   64 A G  E     +C   73   0A  13  496    2   GGG                                         GGGGGGGGSGGG GG A        
    65   65 A S  E     +C   72   0A  63  496    6   SSS                                         SSSSSSSSSSSS SS S        
    66   66 A G  E     -C   71   0A  36  496   14   GGG                                         GGGGGGGGGGGG GG G        
    67   67 A S  E >   +C   70   0A  79  496    9   SSS                                         SSSSSSSSSSSS SS S        
    68   68 A G  T 3  S-     0   0   16  496   12   GGG                                         GGGGGGGGGGGG GG G        
    69   69 A T  T 3  S+     0   0   67  495   13   TTT                                         TTTTTTTTTTTT TT T        
    70   70 A Q  E <   +BC  24  67A 110  496   29   SDD                                         ZQEQDBDDDADD DD D        
    71   71 A F  E     -BC  23  66A   2  494    5   YYF                                         FFFFFFFFFFFF FF F        
    72   72 A S  E     -BC  22  65A  26  495   30   STT                                         TTTTTTTTTTTT TT T        
    73   73 A L  E     -BC  21  64A   0  496    2   LLF                                         LLLLLLLLLLLL LL L        
    74   74 A K  E     -BC  20  63A  97  496   38   TTT                                         TSTPTKKKRRNK KK N        
    75   75 A I  E     -BC  19  62A   0  496    1   III                                         LIIIIIIIIIII II I        
    76   76 A N  S    S-     0   0   86  496   29   SSS                                         SSSSSSSSSSHS SS H        
    77   77 A S  S    S-     0   0   58  496   62   SSR                                         DDGGSRRRRRPR RR P        
    78   78 A L        -     0   0    0  496   27   ILV                                         VVVVVVVVVVVV VV V        
    79   79 A L    >   -     0   0   67  496   31   EEE                                         ZQEEQZEEEEEE EE E        
    80   80 A P  G >  S+     0   0   92  496   59   APA                                         CCCCVAAAAAEP AA E        
    81   81 A E  G 3  S+     0   0  102  496   15   EED                                         DDADEZEEEEEE EE E        
    82   82 A D  G <  S+     0   0    1  496    5   DDD                                         DDDDDBDDDDDD DD D        
    83   83 A F    <   +     0   0   29  495   73   AVA                                         AAAALVVVVVAL VL T        
    84   84 A G  E    S- H   0 105B  17  496   23   TAG                                         AAAATGGGGGAG GG A        
    85   85 A S  E     -EH  38 104B  24  496   62   TTD                                         TTTTHVVVVVTD IV T        
    86   86 A Y  E     -EH  37 103B   0  496    0   YYY                                         YYYYYYYYYYYY YY Y        
    87   87 A Y  E     -E   36   0B   5  495    4   YFY                                         YYYYYYYYYYYY YF Y        
    88   88 A b  E     -E   35   0B   0  496    0   CCC                                         CCCCCCCCCCCC CC C        
    89   89 A Q  E     -EI  34  99B   0  494   48   QQQ                                         GLQQAMMMAMHL FS Q        
    90   90 A H  E     -E   33   0B  22  486   28   QQQ                                         GGQGQQZQHQQQ QQ Q        
    91   91 A H        +     0   0    0  423   89   WEY                                         ANGTFAAGNQSS GT S        
    92   92 A Y  S    S+     0   0  104  454   87   DPN                                         DYWNYLLLLRET IT N        
    93   93 A G  S    S-     0   0   34  421   71   SQN                                         YDSTSQQQEEDH HH E        
    94   94 A T  S    S-     0   0  104  444   88   SGW                                         TCSGYTATLYPF VV D        
    95   95 A P  S    S+     0   0    7  441   51   PHP                                         GSSNPPPPPPWP PP P        
    96   96 A P  S    S-     0   0   55  420   76   PhL                                         YsnNLLIQYYTP YP Y        
    97   97 A L        -     0   0   21  151   88   .gT                                         .fnI.......  .Y .        
    98   98 A T        -     0   0   40  278   41   .PV                                         STVVTTTTTT.  TT T        
    99   99 A F  B     -I   89   0B  18  277   26   .SI                                         FFFFFFFFFFF  FF F        
   100  100 A G        -     0   0    3  285   38   .SQ                                         GGGGGGGGGGG  GG G        
   101  101 A G        -     0   0   52  300   63   .NT                                         GGGTAGQQGGS  GG G        
   102  102 A G        -     0   0   11  300   41   .GN                                         GGGGGGGGGGG  GG G        
   103  103 A T  E     - H   0  86B   0  360   19   TST                                         TTTTTTTTTTT  TT T        
   104  104 A K  E     -dH  10  85B  98  359   60   RIK                                         EEEEKNRKKKK  RK K        
   105  105 A L  E     -dH  11  84B   4  343   39    LT                                         VVVVLVLVLLL  LL L        
   106  106 A E  E     -d   12   0B 108  326   52    DS                                         VVVVEEEEEEE  EE E        
   107  107 A I  E      d   13   0B 113  295   51    IL                                         VVVVLIIIIII  IM L        
   108  108 A K              0   0  145  261   18    K                                          KKKKKKKKKKK  KK K        
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30  Q                                                        E  E QQQQQQQD
   111    2 B V        +     0   0   19  428   12  V                                                        V  V VVVVVVVV
   112    3 B K  E     -J  134   0C 111  430   32  Q                                                        Q  K QQQQQQQQ
   113    4 B L  E     -J  133   0C   3  452    1  L                                                        L  L LLLLLLVL
   114    5 B Q  E     -J  132   0C  83  454   70  Q                                                        V  E QQQQQKQQ
   115    6 B E  E     +J  131   0C   5  458   22  Q                                                        K  E QQQQQEQE
   116    7 B S  E     +J  130   0C  69  463   14  P                                                        S  S PLPPPSSS
   117    8 B G        +     0   0   36  467    4  G                                                        V  G GGGGGGGG
   118    9 B G        +     0   0   29  718   50  A   AAPAPPPAPAAPPAAAT  PPA PPAPPPPAAAPPPAPPPP            G  P TAAAAPAP
   119   10 B D        -     0   0   96  725   42  E   EEGEGEGEEEEGGEEEEE GEE GGEDGDGEEEGGGEGGEG            D  P EEEEEGEG
   120   11 B L  E     +n  224   0D  79  727   14  F   LLLLLLLLLLLLLLLILLLLLLLLLLLLLLLLLLLLLLLLL            L  L LLLLLLLL
   121   12 B V  E     -n  225   0D  16  729   31  V   VVVVVVVAVAAVVVAVMVVVVMVVVVVVVVVVVVVVVVVVV            V  E VVVVVVAV
   122   13 B Q    >   -     0   0  114  730   53  K   RRAKAKARKGRAARKRKKQAKKAQARAAKARKKQAARAAKA            K  E KKKKKARK
   123   14 B P  T 3  S+     0   0   66  730    7  P   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP            P  S PPPPPPPP
   124   15 B G  T 3  S+     0   0   58  734   31  G   GGSRSGSGGGGSSGGGGGSSGGSSSGSSSSGGGSSSGSSGS            G  G GGGGGSWS
   125   16 B G    <   -     0   0   25  736   63  A   TTQAQAQAAAAQQAAAAAQQAAQQQSQQQQAAAQQQAQQAQ            G  G AAAAAQAQ
   126   17 B S        +     0   0   78  735   29  S   SSSSSSSSSSSSSLSLSSSSSSSSSSSSSSSSSSSSLSSSS            S  T SSSSSSST
   127   18 B L  E     - K   0 192C  25  737   28  V   VVLVLVLVVVVLLVVVVVPLVVLLLVLLLLVLVLLLVLLVL            L  V VVVVVLVV
   128   19 B K  E     - K   0 191C  93  735   55  K   KKSKSKSKKKKSSKKKKKSSKKSSSKSSSSTKKSSSKSSKS            R  K KKKKKSKS
   129   20 B L  E     - K   0 190C   0  740   16  L   IVILILILVLLIILMLILIIVIIIIIIILILLLIIILIIMI            A  I LLLLLILL
   130   21 B S  E     -JK 116 189C  28  740   37  S   SSTSTSTSSSSTTSSSSSTTSSTTTSTTTTSSSTTTSTTST            S  S SSSSSTST
   131   22 B d  E     -JK 115 188C   0  740    0  C   CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC            C  C CCCCCCCC
   132   23 B A  E     -JK 114 187C  52  740   67  K   KKTTTKTKKTKTTKKKKTTTKKTTTKTTTTKTTTTTKTTKT            A  K KKKKKTKT
   133   24 B A  E     +J  113   0C   8  740   48  A   AAVAVAVAAAAVVAAAAAVVAAVVVAIVVVAAAVVVAVVAI            A  A AAAAAVAV
   134   25 B S  E     +J  112   0C  58  740   14  S   SSSSSSSSSSSSSSSSTSSSSTSSSSSSTSSSSSSSSSSSS            S  S SSSSSSST
   135   26 B G  S    S+     0   0   56  739    3  G   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG            G  G GGGGGGGG
   136   27 B F  S    S-     0   0   33  740   31  Y   YYFFFYFYYYYFFFYFYFFFYYFFFYFFYFYFFFFFFFFYF            F  Y YYYYYFYI
   137   28 B T    >   -     0   0   93  740   53  T   TASNSTSTATTSSNTNTNSSATSSSASSSSTNNSSSNSSTS            T  T TTTTTPNS
   138   29 B F  G >  S+     0   0    2  740   28  F   FFLILFLFFFFLLIFIFILLFFLLLFLLILFIILLLILLFL            F  F FFFFFLFI
   139   30 B S  G 3  S+     0   0   57  740   55  T   TTTKTTTTTTTTTKTKSKTTTSTTSSTTTTIKKTTTKTTTT            S  T TTTTTTNT
   140   31 B S  G <  S+     0   0   71  740   57  S   NNSDSNNSSSSSSDSDSDSGSSSSRSSSsNDDDSSSDSSDS            S  Y SSSSSSSt
   141   32 B Y  S <  S-     0   0   44  738   42  Y   YYYTYYYYYYYYYYYYYTYYYYYYYYYYyYYTTYYYYYYYY            Y  S YYYYYHYy
   142   33 B T        -     0   0   30  739   92  L   WLGYGDGWNWWGGYWYWYGGNWGGSWGGSDEYYGGGYGGIG            N  S WWWWWGWR
   143   34 B M  E     -OP 160 207E   0  739   49  M   LIVMVIVMMMMVVMMMIMVVMIVVVMVVWVMIMVVVMVVIV            M  I MMMMMVMW
   144   35 B S  E     -OP 159 206E   0  740   72  H   GEHHHNHHYQLHHHHHEHHNYEHHHNHHHTHHHHHHHHNNH            N  H HQHHHSQS
   145   36 B W  E     +OP 158 205E   0  740    0  W   WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW            W  W WWWWWWWW
   146   37 B V  E     -OP 156 204E   0  740   17  V   VVVVVVVVVVVVVVVVVVVVVIVVVVVVIVVVVVVVVVVVV            V  V VVVVVVVI
   147   38 B R  E     -OP 155 203E  10  740   21  N   KKRKRRRKKKKRRKKKKKRRKKRRRKRRRRKRKRRRKRRKR            H  K KKKKKRKR
   148   39 B Q  E     -OP 154 202E   9  740    4  Q   QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ            K  Q QQQQQQQQ
   149   40 B T    >   -     0   0    9  739   74  R   RRPRPRPRSRRPPRRRRRSPSRPSPRPPFPTRRSPPRPPRP            S  A RRRRRPRF
   150   41 B P  T 3  S+     0   0   80  740   11  P   PPPPPPPPHPPPPPPPPPPPHPPPPPPPPPPPPPPPPPPTP            P  P PPPPPPPP
   151   42 B E  T 3  S-     0   0  151  740   29  G   GGGEGEGGGGGGGEGEGEGGGGGGGGGGGGVEEGGGEGGGG            G  G GGGGGGGG
   152   43 B K    <   +     0   0  121  740   37  R   HQKQKQKQKQQKKQQQHQKKKHKKKQKKNKHQQKKKQKKQK            K  K QQRRRKQN
   153   44 B R        -     0   0  113  739   42  G   GGGGGGGGSGGGGGGGGGGGSGGGGGGGKGGGGGGGGGGGG            G  G GGGGGGGK
   154   45 B L  E     -O  148   0E   9  740   13  L   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL            L  L LLLLLLLL
   155   46 B E  E     -O  147   0E  44  739    4  E   EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE            Q  K EEEEEEEE
   156   47 B W  E     +O  146   0E  15  739   11  W   WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWCWWWWWWWWW            W  W WWWWWWWW
   157   48 B V  E     -     0   0E   0  739   28  I   IILILILIIIILLIIIIILLIILLLILLMLIFILLLILLIL            V  M IIIIILII
   158   49 B A  E     -O  145   0E   0  740   36  G   GGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGV            T  G GGGGGGGG
   159   50 B S  E     -OQ 144 168E   0  740   94  R   DVVRVWVAYAAVVWYWEKVMYEVVMQVVYVARRVVVWVVEV            Y  W NERRRVAY
   160   51 B I  E     -OQ 143 167E   4  739   18  I   IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII            I  I IIIIIIII
   161   52 B N    >   -     0   0   47  740   85  D   YNWDWFWYDYYWWDNDLDWWDLWWWYWWHWDDDWWWDWWYW            S  N NDDDDWYY
   162   53 B N  T 3  S+     0   0   65  740   86  P   PPAPAPAPPPPAAPPPPPRGPPASGPSAYNPPPRAAPAGPS            Y  T PPPPPGPY
   163   54 B G  T 3  S-     0   0   65  740   68  N   GGGAGGGGYGGGGESEGAGDYGGGGGDGSDEAAGGGEGDGD            D  A SSNNNDGS
   164   55 B G  S <  S+     0   0   30  740   50  S   GSGNGDGDNDDGGNTNSNGGTGGGGDGGGGTKNGGGNGGSG            K  T NDSSSGDG
   165   56 B G  S    S+     0   0   74  739   59  G   GGSGSGSGGGGSSGGGGGSSGGSSSGSSSTGNGSSSGSTGS            S  G GSGGGNGT
   166   57 B R        +     0   0  163  548   85  G   YG.N.S.DGDD..NYNTN..GF...D....NNN...N..S.            .  E GYGGG.D.
   167   58 B T  E     -Q  160   0E  62  724   48  T   TTTTTNTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT            .  P TTTTTTTI
   168   59 B Y  E     +Q  159   0E  53  723   87  T   NNNKNNNRSRRNNIEINKDDSTNDDNTNNSAKKDNNINSYT            .  T NNKKKKST
   169   60 B Y        -     0   0   44  737    7  Y   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY            .  Y YYYYYYYY
   170   61 B P    >>  -     0   0   20  737   66  N   NNNGNNNANATNNDNDNDNNNNNNNNNNNHNDDNNNDNHNN            .  P NNNNNHTN
   171   62 B D  T 34 S+     0   0  148  739   65  E   EESPSESQQQQSSPQPEPASQESASGSSPSQPPASSPSSES            .  D EQEEESQP
   172   63 B T  T 34 S+     0   0   90  739   62  H   KKAKAKAYKKKAAKKKKKAAKQAAAKAASAKKKAAAKAAKA            .  D KKKKKAKS
   173   64 B V  T X> S+     0   0    1  740   43  F   FFLFLFLFFFFLLFFFFFFLFFLFLFLLLLFFFFLLFLLFL            V  F FFFFFLFL
   174   65 B K  B 3< S+l  177   0C 142  739   35  R   KKMQMKMKKKKMMQKQKQMKKRMIKKKMKIKQQMMMQMIKK            K  K KKKKKIRT
   175   66 B G  T 34 S+     0   0   74  739   36  S   GGSGSGSDGDGSSGDGGGSSGGSSSGSSSSGGGSSSGSSGS            G  G SGSSSSGS
   176   67 B R  T <4 S+     0   0   36  739   21  K   KKRKRKRRKKKRRKKKKKGRRKRRRKRRRRKKKRRRKRRKR            Q  R KKKKKRKR
   177   68 B F  E  <  -lM 174 192C   2  740   67  A   AALALALAAAALLAAAAALLAALLLALLILAAALLLALLAL            F  F AAAAALAT
   178   69 B T  E     - M   0 191C  79  740   38  T   TTSASTTTTTTSSSTSTTSSTTSSSTSSSTTTTSSSSSTTS            T  V TTTTTSTT
   179   70 B I  E     + M   0 190C   5  740   22  L   LLIIILIVLLLIIILIFIIILFIIILIIIILLIIIIIIILI            N  F LLLLLILI
   180   71 B S  E     - M   0 189C  51  736   45  T   TTSTSTSTTTTSSTTTITTSTTSSSTSSTSTTTTSSTSSTS            S  S TTTTTSTT
   181   72 B R  E     - M   0 188C  30  739   68  I   AAKAKTKAVAAKKAAAAAKKVAKKKAKKRKAAAKKKAKKAK            R  L VVVVVKAR
   182   73 B D  E > > - M   0 187C  60  738    5  D   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD            D  E DDDDDDDD
   183   74 B N  G > 5S+     0   0   48  739   59  K   TKNTNKNKKKKNNTKTTTNNKTNNNKNNTNKTTNNNTNNKN            N  S KTKKKNKT
   184   75 B A  G 3 5S+     0   0   99  739   41  P   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSYSS            G  S SSPPPSSS
   185   76 B K  G < 5S-     0   0  111  740   54  S   SSKSKSKSSSSKKSSSSSKKSSKKKSKKKKSSSKKKSKKSK            K  T SSSSSKSK
   186   77 B N  T < 5 +     0   0   62  740   46  S   SSSNSSSSSNSSSNSNNNSSSNSSSSSSNSSNNSSSNSRNS            N  S SSSSSSSN
   187   78 B T  E   < -KM 132 182C  16  740   68  T   TTQTQTQTTTTQQTTTTTQQTTQQQTQQQQTTTQQQTQQTQ            T  T TTTTTQTQ
   188   79 B L  E     -KM 131 181C   0  737   61  A   AAVAVVLAAAAVVAAAAAVVAAVVVAVVFVAAAVVVAVVAV            L  A AAAAAVAF
   189   80 B Y  E     -KM 130 180C  41  737   41  Y   YYFYFYFYYYYFFYYYYYFFYYFFFYFFFYYYYFFFYFFYF            Y  Y CYYYYFYF
   190   81 B L  E     -KM 129 179C   0  739    8  M   MMLLLMLMMMMLLLMLMLFLMMLFLMLLLLMLLFLLLLLML            L  L TMMMMLML
   191   82 B Q  E     -KM 128 178C  76  739   41  Q   QQKQKHKQHQQKKQQQQQKKHQKKKQKKQKEHQKKKQKKLK            Q  E QQQQQKQE
   192   83 B M  E     +KM 127 177C   0  740   11  L   LLMLMLMLLLLMMLLILLMMLLMMMLMMLLLLLMMMLMLLM            M  I LLLLLLLM
   193   84 B S        +     0   0   42  740   54  S   SSNSNSSNNSSNNSSSSSNNNSNNNSNNNNRSTNNNSNNSN            N  N SSSSSNSN
   194   85 B S  S    S-     0   0   68  739   23  S   SSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSS            I  N SSSSSSSS
   195   86 B L        -     0   0    3  740   16  L   LLLLLLLLLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLL            L  L LLLLLLLL
   196   87 B K    >   -     0   0  102  740   70  T   TTQTQTQATAAQQTTTTTQQTTQQQTQQTQTTTQQQTQQTQ            R  K TTTTTQAT
   197   88 B S  G >  S+     0   0   70  740   59  S   SSTSTSTSSSSTTSSSSSATSSTATSTTTSSSSATTSTSST            A  N SSSSSTSA
   198   89 B E  G 3  S+     0   0  126  740   21  E   EDDEDEDEEEEDDEEEEEDDEEDNDEDDEDEEEDDDEDDED            E  E EEEEEEEE
   199   90 B D  G <   +     0   0    2  740    3  D   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD            D  D DDDDDDDD
   200   91 B T    <   +     0   0   32  740   32  S   SSTTTSTSSSSTTTSTSTTTSSTTTSTTTTSTTTATTTTST            T  T SSSSSTST
   201   92 B A  E    S- R   0 223E   8  737    4  A   AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAVAAAAA            A  D AAAAAAAA
   202   93 B M  E     -PR 148 222E  58  739   46  V   VVMVMVMVVVVMMVVVVVIRVVMIMVMMTTVVVIMMAMTVM            V  T VVVVVTVT
   203   94 B Y  E     -PR 147 221E   0  739    1  Y   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYFY            Y  Y YYYYYYYY
   204   95 B Y  E     -P  146   0E   7  740    4  Y   FFYFYFYYYYYYYYYYYYYYFYYYYFYYYYYYYYYYYYYFY            Y  F YYYYYYYY
   205   96 B d  E     -P  145   0E   0  740    0  C   CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC            G  C CCCCCCCC
   206   97 B V  E     -PS 144 217E   0  740   24  A   AAAAAAAAAGAAAASAAAAAAAAAAAAAAATVAAAAAAAAA            A  A AAAAAAAA
   207   98 B R  E     -PS 143 216E  21  739   39  r   RRrrRrRrrYrrtrLrrkkrRrrrrrrrRrRrrkrrnrrir            k  P RSRRKrrR
   208   99 B H  E     + S   0 214E   6  629   94  l   .Dys.gGhk.dsry.yslyyWtghnyyyWrLwhsdtsrrrg            h  . ..F.Ryv.
   209  100 B E  E  >  + S   0 213E  63  676   73  G   .GGS.AGSG.GSVG.GGGGDGLSSGGGVLPADDSGGSGPTG            E  . .HY.SAGD
   210  101 B Y  T >4 S-     0   0   80  702   91  R   .NSF.VDPL.NPYRRWQAYLYASSYSNWRLHHWYGGSRLDN            G  . NYD.NNGY
   211  102 B Y  T 34 S-     0   0  140  709   44  Y   .YRY.lLFY.FYYVFYSYYYYYYYYSYYYYYWFYYYYLYYY            F  y WyYWYYYY
   212  103 B Y  T 34 S+     0   0   39  264   90  .   R...Dp............YY....A.W...W..Y..WL..G            .  y .sE.G...
   213  104 B A  E <<  -S  209   0E   0  447   85  .   LYTPHPG.G..AAW....AAGGGYWCYAAAYY.AAAYAAAG            .  A DSY.AA.A
   214  105 B M  E     +S  208   0E   0  580   59  F   GFMMEMF.MV.MMF.F..MMIVGFFFFMMMFF.MMMFMMMF            .  G FSF.FMFM
   215  106 B D  E     +     0   0E  19  696   48  D   DDDDDDADDADDDADDD.DDDDDDADDDDDDDVDDDDDDDD            .  F DDDDDDDD
   216  107 B Y  E     -S  207   0E  99  702   57  Y   YYYYYYYYYYYYYYYVC.YYYFYYYYVYYYVVYYYYVYYSY            .  Y YYVYVYYY
   217  108 B W  E     -S  206   0E  23  731    0  W   WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW            W  W WWWWWWWW
   218  109 B G        -     0   0    0  714   13  G   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG            T  G GGGGGGGG
   219  110 B Q        -     0   0   91  701   38  Q   QQQQQQQQQQQQQQQAQQQQQQQQQQAQQQAAQQQQAQQQQ            S  Q QQTQTQQQ
   220  111 B G        -     0   0   16  687   10  G   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG            R  G GGGGGGGG
   221  112 B T  E     -R  203   0E  21  675   26  T   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTITTTTTATTTTT            G  T TTTTTTTT
   222  113 B T  E     -R  202   0E  72  661   75  T   LTSSSSLTSLTSSLTTTLSSASTTLTTSSSTTLSSSTSSST            R  L TTTTTSTS
   223  114 B V  E     -R  201   0E   0  654   18  L   VLVVVVVLVVLVVVLVLVVVLVLLVLVVVVVVVVVVVVVVL            T  V LLVLVVLV
   224  115 B T  E     -n  120   0D  36  643   13  T   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT            P  T TTTTTTTT
   225  116 B V  E     +n  121   0D   6  626    6  V   VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV            L  V VVVVVVVV
   226  117 B S        -     0   0   36  616    5  S   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS            T  S SSSSSSSS
   227  118 B S  S    S+     0   0   84  597   20  S   ASSSSSASSTSSSASSSASSSSSSASSSSSS ASSSSSSSS            S  A SSSSSSSS
   228  119 B A  S    S+     0   0   70   97   58                                                           S    EEEEEG  
   229  120 B W        -     0   0  123   87   40                                                                SSSSS   
   230  121 B R        +     0   0  207   62   76                                                                QQQQQ   
   231  122 B H              0   0  156   56   69                                                                SSSSS   
   232  123 B P              0   0  155   28   53                                                                        
## ALIGNMENTS  911 -  980
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 A D              0   0  183  423   16  E   DDDD EDQEDED    QQ             DDDQ                   DDD DDDDDDQ 
     2    2 A I        -     0   0   32  466   12  L   IVIIIVIVLITI    VI             IIVI                   III IIIIIVI 
     3    3 A E        -     0   0  117  468   68  V   VVQVVVVVVQVV    VV             VVQV                   TVV VVVVVVT 
     4    4 A L  E     -A   25   0A  10  482    7  L   MMMMMLMMLMMM    ML             MMML                   LMM MMMMMMV 
     5    5 A T  E     -A   24   0A  64  482    8  T   TTTTTTTTTTTT    TT             TTTT                   TTT TTTTTTT 
     6    6 A Q  E     -A   23   0A  13  482    0  Q   QQQQQQQQQQQQ    QQ             QQQQ                   QQQ QQQQQQQ 
     7    7 A T  E    S+A   22   0A  64  482   35  S   STSSTSTTTSST    TT             TAST                   TTT TTTTTTS 
     8    8 A P        -     0   0   46  485    9  P   PPPPPPPPPPPP    PP             PAPP                   PPP PPPPPPP 
     9    9 A V  S    S+     0   0   96  489   67  L   SVSDAALPSAAL    EE             AFSD                   TLL LLPLLLS 
    10   10 A S  E     -d  104   0B  60  491   42  S   SSSSSSSSPLTS    SS             SSYS                   FCS SSSSSSS 
    11   11 A L  E     -d  105   0B  58  494   23  L   LLMLLVLVVLLL    LL             VNLL                   LLL LLLLLLK 
    12   12 A S  E     +d  106   0B  60  495   42  P   TSSARSPSSSSP    SA             SPAS                   SAP PPPPSPS 
    13   13 A A  E     -d  107   0B   0  495   58  V   VVVVEVFAAALV    VV             EVAV                   VVV VVVVIVV 
    14   14 A S    >   -     0   0   47  496   31  T   TSSSKSTAASST    PS             PTSS                   ATT TTTTTTL 
    15   15 A V  T 3  S+     0   0   76  496   66  P   ALLLVLPVVVPP    VP             VLPP                   LLP PPPPPPP 
    16   16 A G  T 3  S+     0   0   42  496    5  G   GGGGTGGGGGGG    GG             GGGG                   GGG GGGGGGG 
    17   17 A E    <   -     0   0   71  496   36  E   EGDQIEESGEEE    GD             GTEE                   EEE EEEEEEE 
    18   18 A T        -     0   0   69  496   62  P   KQTRSRATTSRP    RT             TSSR                   KPP PPPPPPS 
    19   19 A V  E     - B   0  75A  11  496   36  A   VTVVVVAVVVAA    VV             VAVV                   VVA AAAATVI 
    20   20 A T  E     - B   0  74A  67  495   29  S   TSTENTSTTTTS    ST             TSST                   TSS SSSSSST 
    21   21 A I  E     - B   0  73A   1  494   17  I   MIIM.IIIIILI    II             IFII                   III IIIIIII 
    22   22 A T  E     -AB   7  72A  29  494   59  S   SSTK.KSNNTSS    NR             KSSN                   NSS SSSSSST 
    23   23 A b  E     -AB   6  71A   0  495    1  C   CCCC.CCCCCCC    CC             CCCC                   CCC CCCCCCC 
    24   24 A R  E     -AB   5  70A 110  495   47  R   KRRK.KRQKQRR    KK             QRKK                   KRR RRRRRRR 
    25   25 A A  E     -A    4   0A  10  495   28  S   SSAA.ASATSAS    AA             ASAA                   ASS SSSSSAT 
    26   26 A S  S    S+     0   0   66  495    4  S   SSSS.SSESSSS    SS             SSSS                   SSS SSSSSSS 
    27   27 A E  S    S-     0   0  101  495   38  Q   QQQQ.QQNQQQQ    TS             QKNT                   QQQ QQQQQQS 
    28   28 A N        +     0   0   83  495   45  S   SSDS.SSISNSS    SS             SSKS                   DSS SSSSSSS 
    29   29 A I    >   -     0   0    5  496   32  L   LLVVILLYVIVL    IL             ILSI                   VLL LLLLLLV 
    30   30 A Y  T 3   -     0   0  155  496   81  l   lvGSDllSyDSl    St             FqiS                   Nll llllllG 
    31   31 A S  T 3  S+     0   0   53  471   64  n   ntINStt.nNSt    Nq             BtnN                   Ktt ttttttS 
    32   32 A Y    <   +     0   0   63  495   53  F   YYYYWYYGFISY    SL             BYNY                   EYY CYYYYYY 
    33   33 A L  E     -E   90   0B   0  495    7  M   LLVLLLLLLLLL    LL             LLLL                   VLL LLLLLLM 
    34   34 A A  E     -E   89   0B   0  495   71  D   TYNDAHDASAAY    HA             AYAG                   SDY DYYDYHH 
    35   35 A W  E     -EF  88  48B   1  496    0  W   WWWWWWWWWWWW    WW             WWWW                   WWW WWWWWWF 
    36   36 A Y  E     -EF  87  46B   0  496    8  Y   HYFYYFYYYCYY    YY             YYYY                   YYY YYYYYYY 
    37   37 A Q  E     -EF  86  45B   7  496   27  L   QLQQQQLQQQQL    QQ             QLZQ                   QLL LLLLLLQ 
    38   38 A Q  E     -E   85   0B  21  496    4  Q   QQQQQQQQQQQQ    QQ             KQZQ                   EQQ QQQQQQQ 
    39   39 A K    >   -     0   0   51  495    8  R   KKKKPKKKKKKK    KK             .KKK                   KKK KKKKKKK 
    40   40 A Q  T 3  S+     0   0  190  496   18  P   PPPPPPPPPTPP    PS             PPPP                   PPP PPPPPPP 
    41   41 A G  T 3  S+     0   0   86  496   10  G   GGGVGGGGGQGG    GG             GGGG                   GGG GGGGGGG 
    42   42 A K  S <  S-     0   0  126  495   54  Q   QQKKKKQQQNQQ    KQ             ZQKQ                   LQQ QQQQQRQ 
    43   43 A S        -     0   0   21  495   56  S   PSSAPSSPPPAS    AA             PSAA                   PSP SPPSSSA 
    44   44 A P        -     0   0    4  495   10  P   PPPPPIPPPPPP    PP             PPNP                   IPP PPPPPPP 
    45   45 A Q  E     -F   37   0B  74  495   32  Q   KQRKKKQKKKRQ    KK             KQKK                   KRR QQRQQQK 
    46   46 A F  E     +F   36   0B  25  495   41  L   MLHLLRLLLLLL    LL             GLLL                   SLL LLLLRLL 
    47   47 A L  E     +     0   0B   4  495    9  L   LLMLLMLLLLLL    LL             LLLL                   LLL LLLLLLL 
    48   48 A V  E     -FG  35  54B   0  496    5  I   IIIIIIIIIIII    II             LIII                   VII IIIIIIL 
    49   49 A Y  E >> S+ G   0  53B  39  496   17  Y   YYYYYYYYYCYH    AY             YYSY                   HYY YYYYYYY 
    50   50 A N  T 34 S-     0   0   52  496   91  L   WKRAAQAAKYGE    YD             TQSD                   AER ERREKKA 
    51   51 A A  T 34 S+     0   0    3  496   44  G   AVAAAVVAAAAV    AG             BMGS                   AVV VVVVVVV 
    52   52 A K  T <4 S+     0   0  148  496   25  S   SSTSDSSSSYSS    SS             YSST                   SSS SSSSSSS 
    53   53 A T  E  <  -G   49   0B  47  496   68  N   TNNSENNNTSSN    SS             TNTN                   TKN NNNNNNS 
    54   54 A L  E     -G   48   0B  60  496   59  R   RRLRLLRLLLRR    LL             LLLH                   LLR RRQRQRL 
    55   55 A G    >   -     0   0    9  495   70  A   EFAAEDAEEVAA    QQ             AAQY                   SVF VFFADEQ 
    56   56 A E  T 3  S+     0   0  192  495   35  S   SSDSSSSTSDTS    SS             SSSS                   PSS SSSSSSS 
    57   57 A G  T 3  S+     0   0   70  496    5  G   GGGGGGGGGGGG    GG             GGGG                   GGG GGGGGGG 
    58   58 A V    <   -     0   0   25  494   10  V   VVVVVVVVVIIV    VV             VVTT                   AVV VVVVVVV 
    59   59 A P    >   -     0   0   47  495    7  P   PPPPPPPPPPPP    PP             SPPP                   PSP PPPPPPP 
    60   60 A S  T 3  S+     0   0  115  496   56  D   DDSDASDSSSDD    AS             SDSA                   ADD DDDDDDN 
    61   61 A R  T 3  S+     0   0   44  496    4  R   RRRRHRRRRRRR    RR             RRRW                   RRR RRRRRRR 
    62   62 A F  E <   +C   75   0A   5  496    1  F   FFFFFFFFFFFF    FF             FFFF                   FFF FFFFFFF 
    63   63 A S  E     -C   74   0A  55  495   23  S   TSSSSSSKKSSS    SS             SSSS                   SSS SSSSSSS 
    64   64 A G  E     +C   73   0A  13  496    2  G   GGGGGGGgGgGG    GG             GGGG                   GGG GGGGGGG 
    65   65 A S  E     +C   72   0A  63  496    6  S   SSSSSSSsSsSS    SS             GSSS                   SSS SSSSSSS 
    66   66 A G  E     -C   71   0A  36  496   14  G   GGRGGGGGGGGG    GG             GGGG                   GGG GGGGGGG 
    67   67 A S  E >   +C   70   0A  79  496    9  S   SSSSSSSSSSSS    SS             SSSS                   SSS SSSSSSS 
    68   68 A G  T 3  S-     0   0   16  496   12  G   GGGGGGGGGGGG    GG             GGDG                   GGG GGGDGGG 
    69   69 A T  T 3  S+     0   0   67  495   13  T   TTSTTTTTTTTT    TT             TTTT                   STT TTTTTTT 
    70   70 A Q  E <   +BC  24  67A 110  496   29  D   DDDDDDDEQQED    DD             BDDD                   DDD DDDDNDD 
    71   71 A F  E     -BC  23  66A   2  494    5  F   FFYFYFFYFYFF    FF             FFFF                   YFF FFFFFFF 
    72   72 A S  E     -BC  22  65A  26  495   30  T   TTSTTTTTTSTT    TT             TTTT                   ITT TTTTTTS 
    73   73 A L  E     -BC  21  64A   0  496    2  L   LLLLLLLLLLLL    LL             LLLL                   FLL LLLLLLF 
    74   74 A K  E     -BC  20  63A  97  496   38  K   TKTTTTKTTKTK    TT             TRTT                   TQK KKKKKKT 
    75   75 A I  E     -BC  19  62A   0  496    1  I   IIIIIIIIIIII    II             IIII                   III IIIIIII 
    76   76 A N  S    S-     0   0   86  496   29  S   SSSSSSSSSSSS    SN             SSRS                   SSS SSSSSSS 
    77   77 A S  S    S-     0   0   58  496   62  R   SRSSSSRGGGSR    SR             DRSN                   RRR RRRRKRN 
    78   78 A L        -     0   0    0  496   27  V   VVLLVLVVVLLV    IV             LVLF                   VVV VVVVVLV 
    79   79 A L    >   -     0   0   67  496   31  E   QEEQEEEQQQEE    EE             EEEE                   EEE EEEEEQQ 
    80   80 A P  G >  S+     0   0   92  496   59  A   APSAAPACCPPA    AA             CAFT                   AAA AAAAAAI 
    81   81 A E  G 3  S+     0   0  102  496   15  E   EEEEEEEDDEEE    DE             AEQE                   DEE EEEEEEE 
    82   82 A D  G <  S+     0   0    1  496    5  D   DDDDDDDDDDDD    DD             BDDD                   DDD DDDDDDD 
    83   83 A F    <   +     0   0   29  495   73  V   LLVVVVVAAIVV    AA             AVFA                   IVV VVVVAVA 
    84   84 A G  E    S- H   0 105B  17  496   23  G   AGAAGAGAAAGG    GG             AGAG                   AGG GGGGGGG 
    85   85 A S  E     -EH  38 104B  24  496   62  V   VVDVHIVTTTVV    DD             TVVN                   NVV VVVVVVD 
    86   86 A Y  E     -EH  37 103B   0  496    0  Y   YYYYYYYYYYYY    YY             YYYY                   YYY YYYYYYY 
    87   87 A Y  E     -E   36   0B   5  495    4  Y   YYHSYYYYYYYY    YY             YYYY                   YYY YYYYYYY 
    88   88 A b  E     -E   35   0B   0  496    0  C   CCCCCCCCCCCC    CC             CCCC                   CCC CCCCCCC 
    89   89 A Q  E     -EI  34  99B   0  494   48  M   QYLQQYLQAQQM    QQ             EAZH                   MMM MMMMALQ 
    90   90 A H  E     -E   33   0B  22  486   28  Q   NQQQEQQHGQQQ    QQ             XNZQ                   HQQ QQQQQQQ 
    91   91 A H        +     0   0    0  423   89  G   DGYRTHAGEAEG    SY             TLYR                   DGA SAAAAGY 
    92   92 A Y  S    S+     0   0  104  454   87  L   YTDYVSLYYVII    SR             GQNL                   YSL ILLLTTS 
    93   93 A G  S    S-     0   0   34  421   71  Q   RHESSHQSSSEQ    SS             VEES                   GQQ EQQEQHS 
    94   94 A T  S    S-     0   0  104  444   88  T   SYYSSSAYSTSL    WS             SLPY                   WRT FNTFWRF 
    95   95 A P  S    S+     0   0    7  441   51  P   VPPPDPPSSPPP    PP             ZPYP                   PPP PPPPPPP 
    96   96 A P  S    S-     0   0   55  420   76  Y   TPPPKV StPEP    LL             bYYV                   PPP  PP PPL 
    97   97 A L        -     0   0   21  151   88  .   .TT... .t..     T.             k..T                   . .  .. Q.T 
    98   98 A T        -     0   0   40  278   41  T   .VV.LS .T..     V.             GTTV                   T T  TT W.V 
    99   99 A F  B     -I   89   0B  18  277   26  F   FMI.LL .V..     I.             FFFI                   D L  LL Y.I 
   100  100 A G        -     0   0    3  285   38  G   GQQ.GV GG.S     Q.             GGGQ                   G       N.Q 
   101  101 A G        -     0   0   52  300   63  Q   STQ.GA DS.Q     T.             GGAT                   S       P.T 
   102  102 A G        -     0   0   11  300   41  G   GLN.GG  G.G     S.             GGGI                   G       E.N 
   103  103 A T  E     - H   0  86B   0  360   19  T   TTLTTK  TTS     TT              TTT                   T       HTT 
   104  104 A K  E     -dH  10  85B  98  359   60  K   KKTVKK  EVR     KV              KMK                   S       KVK 
   105  105 A L  E     -dH  11  84B   4  343   39  L   LMVLRK  YIN     TV              LLT                   V       LV  
   106  106 A E  E     -d   12   0B 108  326   52  E   E QQES  TQN     SQ              EES                   Q        Q  
   107  107 A I  E      d   13   0B 113  295   51  I   I Q  L  L V     LT              ILL                               
   108  108 A K              0   0  145  261   18  K   K K  K           R              KK                                
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30   Q Q            QEEE                   Q QQQQQQQQQ QQQQQQQ   E       Q
   111    2 B V        +     0   0   19  428   12   V V            VAVV                   V VVVVVVVVV VVVVVVV   V       V
   112    3 B K  E     -J  134   0C 111  430   32   Q R            QQQQ                   Q QQQQQQQQQ QHQQQRQ   Q       Q
   113    4 B L  E     -J  133   0C   3  452    1   L L            LLLL                   L LLLLLLLLL LLLLLLL   L       L
   114    5 B Q  E     -J  132   0C  83  454   70   L Q            QQQQ                   Q QQQQQQQVQVKVQQQQQ   V       Q
   115    6 B E  E     +J  131   0C   5  458   22   E E            QQQQ                   Q QQQQQQQEEQEQEEGEE   E       Q
   116    7 B S  E     +J  130   0C  69  463   14   SSS            WSSS                   P PPPPPPPSSSSSSSSSS   S       S
   117    8 B G        +     0   0   36  467    4   GGG            GGGG                   G GGGGGGGGGGGGGGGGG   G       G
   118    9 B G        +     0   0   29  718   50   APP            AAAP  PAAAAAAAPAAAA    A AATAAAAAPAPAPPPPP   G       P
   119   10 B D        -     0   0   96  725   42   VGS            GEEE  EEEEEEEEGDEEE    EEEEEEEEEEGEGECSSSS   D       E
   120   11 B L  E     +n  224   0D  79  727   14   LLL            LLLL  LLLVLLLLLLLXL    LLLLLLLLLVLVLVLLLLL   L       L
   121   12 B V  E     -n  225   0D  16  729   31   AVV            VVVV  VMVVVVVAVVVVV    VVVVVVVVVRVKVKVVVVV   G       K
   122   13 B Q    >   -     0   0  114  730   53   RAK            KRRK  KKKKKKRRARRKR    KKKKKKKKKKKKAKKKKKK   K       K
   123   14 B P  T 3  S+     0   0   66  730    7   PPP            PPAP  PPPPPPPPPPSPP    PPPPPPPPPPPPPPPPPPP   P       P
   124   15 B G  T 3  S+     0   0   58  734   31   GSS            SGGG  GGGGGGGGSGGGG    GGGGGGGGGGSGSGSSSSS   G       G
   125   16 B G    <   -     0   0   25  736   63   TQQ            ETSA  AAATAAAAQAAAA    AAAAAAAAAAESQAQQQQQ   G       E
   126   17 B S        +     0   0   78  735   29   SST            TSSS  SSSSSSLSSSSSS    SSSSSSSSSSTSSSTTTTT   P       T
   127   18 B L  E     - K   0 192C  25  737   28   VLL            LVVV  VVVVVVVVLVVVV    VVVVVVVVVVLVLVLLLLL   L       V
   128   19 B K  E     - K   0 191C  93  735   55   KSS            SKKK  KKKKKKKKSKKKT    KKKKKKKKKRSKSKSSFSS   T       K
   129   20 B L  E     - K   0 190C   0  740   16   IIL            LIMI  IILLLLLLILLLL    MLLLLLLLLVLVIVLLLLL   L       I
   130   21 B S  E     -JK 116 189C  28  740   37   STT            TSSS  SSSSSSSSTSSSS    SSSSSSSSSSTSTSTTTTT   S       S
   131   22 B d  E     -JK 115 188C   0  740    0   CCC            CCCC  CCCCCCCCCCCCC    CCCCCCCCCCCCCCCCCCC   C       C
   132   23 B A  E     -JK 114 187C  52  740   67   KTT            AKKK  KKTTTTKKTTTTK    KTKKTKKKKKTKTKTTTTT   V       K
   133   24 B A  E     +J  113   0C   8  740   48   AVV            VAAA  AAAAAAAAIAAAA    AAAAAAAAAAVAIAVVVVV   A       A
   134   25 B S  E     +J  112   0C  58  740   14   SSS            FASS  STSSSSSSSSSSL    SSSSSSSSSSSSSSSSSSS   S       S
   135   26 B G  S    S+     0   0   56  739    3   GGG            GGGG  GGGDGGGGGGGGG    GGGGGGGGGGGGGGGGGGG   G       G
   136   27 B F  S    S-     0   0   33  740   31   YFF            GYYY  YYFFFFFYFYFFY    FFYYYYYYYYGGFDFFFFF   F       Y
   137   28 B T    >   -     0   0   93  740   53   NSS            STTT  STNNNNNTSNNNT    SNTTTTTTTTSTSSSSSSS   T       P
   138   29 B F  G >  S+     0   0    2  740   28   FLL            FFFF  FFIIIIIFLIIIF    FIFFFFFFFFIFLFLFLLL   F       F
   139   30 B S  G 3  S+     0   0   57  740   55   TTT            STTT  TSKKKKKSTEKKT    TKTTTTTTTTCSTSTSTTT   S       T
   140   31 B S  G <  S+     0   0   71  740   57   SST            GNSD  GSDDDDDDSDDDD    SDSSSSSSSGSSSSSNSSS   N       N
   141   32 B Y  S <  S-     0   0   44  738   42   YYY            YYYY  YYTITTYYYTYTY    YTYYYYYYYYYYYYRNYNG   Y       Y
   142   33 B T        -     0   0   30  739   92   WGS            YWGY  FWYYYYYYGYYYE    KYWWWWWWWYYAGAGAAAA   A       G
   143   34 B M  E     -OP 160 207E   0  739   49   MVV            WIIM  MIIMIMLIVIMMM    IMMMMMMMMMWIVIVVVVV   M       M
   144   35 B S  E     -OP 159 206E   0  740   72   LHG            SGNN  NEHHHHHNHHNHH    LHHHHHHHHNSSHHNGNGG   N       N
   145   36 B W  E     +OP 158 205E   0  740    0   WWW            WWWW  WWWWWWWWWWWWW    WWWWWWWWWWWWWWWWWWW   W       W
   146   37 B V  E     -OP 156 204E   0  740   17   VVV            IVVV  VVMVVVVVVVVVV    VVVVVVVVVVIVVVVVVVV   T       V
   147   38 B R  E     -OP 155 203E  10  740   21   KRR            RKKK  MKKKKKRNRKKKK    KKKKKKKKKRRRRRRRRPR   R       K
   148   39 B Q  E     -OP 154 202E   9  740    4   QQQ            QEQQ  QQQQQQQQQQQQQ    QQQQQQQQQQQQQQQQQQQ   Q       Q
   149   40 B T    >   -     0   0    9  739   74   RPA            PRRS  SRRRRRRRPRRRT    TRRRRRRRRAPAPAAAAAA   Y       A
   150   41 B P  T 3  S+     0   0   80  740   11   PPP            PPPH  HPPPPPPTPPPPP    SPPPPPPPPPPPPPPPPPP   P       P
   151   42 B E  T 3  S-     0   0  151  740   29   GGG            GGGG  GGEEEEEGGEEEV    GEGGGGGGGGGGGGGGGGR   G       G
   152   43 B K    <   +     0   0  121  740   37   QKK            RHQK  KHQQQRQQKQQQH    QQRRRRRRRHKQKQKKKKK   K       Q
   153   44 B R        -     0   0  113  739   42   GGA            GGGS  SGGGGGGGGGGGG    GGGGGGGGGGGGGRSTAVA   G       G
   154   45 B L  E     -O  148   0E   9  740   13   LLL            LLLL  LLLLLLLLLLLLL    LLLLLLLLLLLLLLLLLAL   L       L
   155   46 B E  E     -O  147   0E  44  739    4   EEE            EEEE  EEEEEEEEEEEEE    EEEEEEEEEEEEEAEEEEE   E       K
   156   47 B W  E     +O  146   0E  15  739   11   WWW            WWWW  WWWWWWWWWWWWW    WWWWWWWWWWWWWWWWWWW   W       W
   157   48 B V  E     -     0   0E   0  739   28   ILL            IIII  IIIIIIIILIVII    VIIIIIIIIIIMLMVVVLV   L       M
   158   49 B A  E     -O  145   0E   0  740   36   GGG            GGGG  GGGGGGGGVGGGG    GGGGGGGGGGGGVGGGGGS   A       G
   159   50 B S  E     -OQ 144 168E   0  740   94   AVG            EDYD  REKRRRLEVRWRA    TRRRRRRRRYYRVWGNNGS   V       W
   160   51 B I  E     -OQ 143 167E   4  739   18   LII            IIII  IIIIIIIIIIIII    IIIIIIIIIIIIIIIIIMI   M       I
   161   52 B N    >   -     0   0   47  740   85   FWE            NYNN  NLDDDDDYWDDDD    YDDDDDDDDNYIWIWWLNG   R       N
   162   53 B N  T 3  S+     0   0   65  740   86   PAN            HPPP  PPPPPPPPSPPPP    PPPPPPPPPPYPSASSNNT   Y       T
   163   54 B G  T 3  S-     0   0   65  740   68   GGD            SGGN  YGAAAAEGDAEAE    GANNNNNNNSSIDDDDDGS   D       S
   164   55 B G  S <  S+     0   0   30  740   50   NGG            GGNN  NSNNNNNSGHNNT    NNSSSSSSSRGLGNGGGGG   G       T
   165   56 B G  S    S+     0   0   74  739   59   SSC            SGGG  GGGDAGGGSGGGG    GXGGGGGGGGSGSGSSNTG   S       g
   166   57 B R        +     0   0  163  548   85   D..            .FYG  DSNNNYNY.NDNR    DNGGGGGGGY.I.N.....   Q       s
   167   58 B T  E     -Q  160   0E  62  724   48   TTA            TTIT  TTTTATKTTCTTT    TSTTITTTTTTATTTTT.L   Q       T
   168   59 B Y  E     +Q  159   0E  53  723   87   TNG            NNNS  FNKKKEMYTKEKA    SKKKIKKKKNNNTKDYYYY   Y       .
   169   60 B Y        -     0   0   44  737    7   YYY            YYYY  YYYYYYYYYYYYY    YYYYYYYYYYYYYYYYYYY   Y       F
   170   61 B P    >>  -     0   0   20  737   66   KNH            KNNN  NNDDDDDNNDADN    NGNNNNNNNNTANSKNNNN   V       A
   171   62 B D  T 34 S+     0   0  148  739   65   ESP            TDEQ  QEPPPPPESPPPQ    QPEEEEEEEQPQSQPPPPP   D       D
   172   63 B T  T 34 S+     0   0   90  739   62   MAA            SNKK  KKKKKKKKAKNKK    KKKKKKKKKKSKAKAAAAA   S       D
   173   64 B V  T X> S+     0   0    1  740   43   LLL            LLFF  FFFFFFFFLFFFF    FFFFFFFFFFLFLFLLLLL   L       F
   174   65 B K  B 3< S+l  177   0C 142  739   35   KMK            KKKK  KKQQQQRKKQQQK    KQKKKKKKKKKQKQKKKKK   K       K
   175   66 B G  T 34 S+     0   0   74  739   36   GSS            SGGG  GGGGGVAGSGGGD    GGSSTSSSSDSGSGSSSSS   G       G
   176   67 B R  T <4 S+     0   0   36  739   21   RRR            RKKK  KKKKKKKKRKKKK    RXKKKKKRKRRRRRRRRRR   Q       R
   177   68 B F  E  <  -lM 174 192C   2  740   67   ALL            VATA  AAAAAAAALAAAA    AAAAAAAAAVVVLVLLLLL   F       F
   178   69 B T  E     - M   0 191C  79  740   38   KSS            TTTT  TTTTTTSTSTTTT    ATTTTTTTTTTTSTSSSSS   T       D
   179   70 B I  E     + M   0 190C   5  740   22   LII            ILLL  LFIIIIILIILIL    LILLLLLLLMIIIIIIIII   I       F
   180   71 B S  E     - M   0 189C  51  736   45   TST            STTT  TTTTTTTTSTTTT    TTTTTTTTTTSTSTTTSTT   S       S
   181   72 B R  E     - M   0 188C  30  739   68   AKR            LAVV  VAPASAAAKASAA    AAVVVVVVVTVAKRRRRRR   R       L
   182   73 B D  E > > - M   0 187C  60  738    5   ADD            DDDD  DDDDDDDDDDDDD    DDDDDDDDDDDDDDDDDDD   D       E
   183   74 B N  G > 5S+     0   0   48  739   59   TNT            TTKK  KTTTTTTKNTTTQ    KTKKKKKKKKRKNTTTTPT   N       T
   184   75 B A  G 3 5S+     0   0   99  739   41   SSS            SSSS  SSSSSSSSSSSSS    SSPPPPPPPSSSSSSSSSS   S       S
   185   76 B K  G < 5S-     0   0  111  740   54   AKK            KSSS  SSSSSSSSKSSSS    SSSSSSSSSFKTKARKKKK   K       A
   186   77 B N  T < 5 +     0   0   62  740   46   SSS            NSSS  SNNNNSNSSNNNS    SSSSTSSSSSNSSSSSSSS   H       N
   187   78 B T  E   < -KM 132 182C  16  740   68   IQQ            LTTA  TTTTTTTTQTTTT    TAATTTTTTTQTQTQQQQQ   I       T
   188   79 B L  E     -KM 131 181C   0  737   61   AVV            FAAT  AAAAAATAVAAAA    AAAAAAAAAAFAVAVVVVV   V       A
   189   80 B Y  E     -KM 130 180C  41  737   41   YFS            SYYY  HYYYYYNYFYYYY    YYYYYYYYYYSYFYSSSSS   Y       Y
   190   81 B L  E     -KM 129 179C   0  739    8   LLL            LIMM  MMLLLLLMLLLLM    MLMMMMMMMMLMLLLLLLL   L       L
   191   82 B Q  E     -KM 128 178C  76  739   41   EKS            KQQE  EQQQQQQQKHQQE    RQQQQQQQQDKEKESSSST   Q       Q
   192   83 B M  E     +KM 127 177C   0  740   11   FML            LLLL  LLLLLLLLMLLLL    LLLLLLLLLLLLVLLLLLV   M       I
   193   84 B S        +     0   0   42  740   54   SNS            SSRR  RSSNSSISNNSSR    SSSSSSSSSRTSNSSSSSS   E       N
   194   85 B S  S    S-     0   0   68  739   23   SSS            SSSS  SSSSSSSRSSSSS    SSSSSSSSSSSSSSSSSSG   S       N
   195   86 B L        -     0   0    3  740   16   LLV            VLLL  LLLLLLLLLLLLL    LLLLLLLLLLLLLLVVVVV   L       L
   196   87 B K    >   -     0   0  102  740   70   TQT            TTTT  ATSTTTTTQTTTT    TTTTTTTTTRTRQTTSTTT   R       K
   197   88 B S  G >  S+     0   0   70  740   59   NTS            ASSS  SSFSSSSSTSSSS    SSSSSSSSSSASASSITST   T       S
   198   89 B E  G 3  S+     0   0  126  740   21   EDE            AEEE  EEEEEEEEDEEEE    EEEEEEEEEAAEDEEDEEE   R       E
   199   90 B D  G <   +     0   0    2  740    3   DDD            DDDD  DDDDDDDDDDDDD    DDDDDDDDDDDDDDDDDDD   D       D
   200   91 B T    <   +     0   0   32  740   32   STT            TSSS  SSTTTTTSTATTS    STSSSSSSSSTTTTTTTTA   T       M
   201   92 B A  E    S- R   0 223E   8  737    4   AAA            AAAA  AAAAAAAAAAAAA    AAAAAAAAAAAAAAAAAAA   A       A
   202   93 B M  E     -PR 148 222E  58  739   46   VMM            VIVV  VVVVVVVVMVVVV    VVVVVVVVVVVVMMMVVVV   M       T
   203   94 B Y  E     -PR 147 221E   0  739    1   YYY            YYYY  YYYYYYYYYYYYY    YYYYYYYYYYYYYYYYYYY   Y       Y
   204   95 B Y  E     -P  146   0E   7  740    4   YYY            YHFY  YYYYYFYFYYYYS    YYYYYYYYYYFYYYYYYYY   R       F
   205   96 B d  E     -P  145   0E   0  740    0   CCC            CCCC  CCCCCCCCCCCCC    CCCCCCCCCCCCCCCCCCC   C       C
   206   97 B V  E     -PS 144 217E   0  740   24   AAV            AAAA  AAAASAAAASNAT    TTAAAAAAAAAAAAAAAAA   N       A
   207   98 B R  E     -PS 143 216E  21  739   39   RRr            rrrr  RrrRDvRrrRgrR    rrKsrRrLrrrsrrKrrrr   h       r
   208   99 B H  E     + S   0 214E   6  629   94   ..g            vsgy  Rgy.Lw.yy.lg.    frRgg.g.sdwwdt.gygg   a       y
   209  100 B E  E  >  + S   0 213E  63  676   73   G.G            DSGD  YPG.GD.DGSAV.    LDSSDDS.SDGGPE.WSYA   P       H
   210  101 B Y  T >4 S-     0   0   80  702   91   D.K            YPSP  DGN.PD.WNGWRS    LANSGDS.LHPPPASTTLP   G       G
   211  102 B Y  T 34 S-     0   0  140  709   44   F.Y            YYYF  YFYfYF.YYRFYY    wVYYVYY.YYYYFFYyWyY   F       Y
   212  103 B Y  T 34 S+     0   0   39  264   90   GE.            Y...  D..y....W....    w.GW...L...W...gTh.   K       .
   213  104 B A  E <<  -S  209   0E   0  447   85   AA.            G.D.  G..D....YG...    N.AY.G.AYCYY...GGHS   G       .
   214  105 B M  E     +S  208   0E   0  580   59   MLW            MFF.  M..A.FLFFL.FF    F.FFMRFEFLFF..FIIII   L       V
   215  106 B D  E     +     0   0E  19  696   48   DRG            DDDD  DAVP.DDDDDLDD    DDDDDTDADDDDADEDNDD   A       P
   216  107 B Y  E     -S  207   0E  99  702   57   YLY            VSYV  YYYL.SYVVYYVY    VYVVYFYYYYYLYIYYYYY   S       Y
   217  108 B W  E     -S  206   0E  23  731    0   WWW            WWWW  WWWWWWWWWWWWW    WWWWWWWWWWWWWWWWWWW   Y       W
   218  109 B G        -     0   0    0  714   13   GGG            GGGG  GGGGGGGGGGGGG    GGGGGGGGGGGGGGGGGGG   A       G
   219  110 B Q        -     0   0   91  701   38   QQP            QQQT  QQQQQQQAAQQAQ    AQTTQQQQQQQRQQPPPPP   H       Q
   220  111 B G        -     0   0   16  687   10   GGG            GGGG  GGGGGGGGGGGGG    GGGGGGGGGGGGGGGGGGG   G       G
   221  112 B T  E     -R  203   0E  21  675   26   TTL            TTTT  ATTTTTTTTTTTT    TTTTTTTTTTTTTTLLLLL   T       T
   222  113 B T  E     -R  202   0E  72  661   75   LLL            TTPT  SLLTTTSTTTLTT    TSTTSTTLTTLLLMLLLLL   I       T
   223  114 B V  E     -R  201   0E   0  654   18   VVV            VLLV  VVVLLLVVVLVVL    VVVVVLLVLVVVVVVVVVV   Q       V
   224  115 B T  E     -n  120   0D  36  643   13   TTT            TTTT  TTTTTTTTTTTTT    TTTTTTTTTTTTTTTTTTT   S       T
   225  116 B V  E     +n  121   0D   6  626    6   VVV            VVVV  VVVVVVVVVVVVV    VVVVVVVVVVVVVVVVVVV   I       V
   226  117 B S        -     0   0   36  616    5   SSS            SSSS  SSSSSSSSSSSSS    SSSSSSSSSSSSSSSSSSS   S       S
   227  118 B S  S    S+     0   0   84  597   20   SAS            SSSS  SAASSSSSSSASS     SSSSSSASSSSASSSSSS   I       S
   228  119 B A  S    S+     0   0   70   97   58                                          AEEEEEEE             T       A
   229  120 B W        -     0   0  123   87   40                                           SSSSSSS             V       S
   230  121 B R        +     0   0  207   62   76                                           QQQQQQQ             H       T
   231  122 B H              0   0  156   56   69                                           SSSSPSS             R       K
   232  123 B P              0   0  155   28   53                                                               N       G
## ALIGNMENTS  981 - 1050
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    1 A D              0   0  183  423   16                  DQD           E   DDD     E                 DDE   D   
     2    2 A I        -     0   0   32  466   12                  IIV           I   III     I                IVII   V   
     3    3 A E        -     0   0  117  468   68                  VVV           V   IVV     I                VVVV   V   
     4    4 A L  E     -A   25   0A  10  482    7                  MLMM          M   LLM     L                MMLM   M   
     5    5 A T  E     -A   24   0A  64  482    8                  TTTT          T   TTT     T                TTTT   T   
     6    6 A Q  E     -A   23   0A  13  482    0                  QQQQ          Q   QQQ     Q                QQQQ   Q   
     7    7 A T  E    S+A   22   0A  64  482   35                  TSTT          S   STT     T                TSST   S   
     8    8 A P        -     0   0   46  485    9                  PPPP          P   PPP     P                PPPP   P   
     9    9 A V  S    S+     0   0   96  489   67                  LDVE          G   ALL     K                SLAL   L   
    10   10 A S  E     -d  104   0B  60  491   42                  SYSS          S   SSS     V                SFSS   S   
    11   11 A L  E     -d  105   0B  58  494   23                  LVLL          L   LLL     Q                KLLL   L   
    12   12 A S  E     +d  106   0B  60  495   42                  SSSA          A   ASA     S                SPAS   P   
    13   13 A A  E     -d  107   0B   0  495   58                  VVVV          G   AVV     A                VVVV   V   
    14   14 A S    >   -     0   0   47  496   31                  SSSS          S   SFT     V                PTST   T   
    15   15 A V  T 3  S+     0   0   76  496   66                  PPLP          A   PPP     P                VLLP   L   
    16   16 A G  T 3  S+     0   0   42  496    5                  GGGG          G   GGG     G                GGGG   R   
    17   17 A E    <   -     0   0   71  496   36                  EEGD          E   EEE     Q                DEQE   Q   
    18   18 A T        -     0   0   69  496   62                  PTQR          S   TTP     T                TPRP   P   
    19   19 A V  E     - B   0  75A  11  496   36                  AVVV          V   VAA     V                VAAA   A   
    20   20 A T  E     - B   0  74A  67  495   29                  STST          S   TSS     S                TSTS   S   
    21   21 A I  E     - B   0  73A   1  494   17                  IFII          I   III     V                IIII   I   
    22   22 A T  E     -AB   7  72A  29  494   59                  STSN          N   NSS     R                NQSS   S   
    23   23 A b  E     -AB   6  71A   0  495    1                  CCCC          C   CCC     S                CCCC   C   
    24   24 A R  E     -AB   5  70A 110  495   47                  RKRK          K   KRR     K                QRRR   R   
    25   25 A A  E     -A    4   0A  10  495   28                  AASA          S   ATA     A                ASAA   S   
    26   26 A S  S    S+     0   0   66  495    4                  SSSS          S   SSS     S                ASSS   S   
    27   27 A E  S    S-     0   0  101  495   38                  QSQS          Q   QQK     S                QQZQ   Q   
    28   28 A N        +     0   0   83  495   45                  SHSS          S   SSS     S                SSSS   S   
    29   29 A I    >   -     0   0    5  496   32                  LVFT          L   LLL     M                VLVL   P   
    30   30 A Y  T 3   -     0   0  155  496   81                  lSvG          l   sel     S                yvnl   v   
    31   31 A S  T 3  S+     0   0   53  471   64                  tNtN          n   dtt     N                ntst   t   
    32   32 A Y    <   +     0   0   63  495   53                  YLYH          Y   VYY     Y                RYFY   Y   
    33   33 A L  E     -E   90   0B   0  495    7                  LLLL          L   LLL     L                LLML   L   
    34   34 A A  E     -E   89   0B   0  495   71                  YANN          A   VSH     L                SBZN   N   
    35   35 A W  E     -EF  88  48B   1  496    0                  WWWW          W   WWW     W                WWWW   W   
    36   36 A Y  E     -EF  87  46B   0  496    8                  FYYY          Y   HHF     Y                FYYY   F   
    37   37 A Q  E     -EF  86  45B   7  496   27                  RQLQ          Q   QLL     L                QLZR   Q   
    38   38 A Q  E     -E   85   0B  21  496    4                  QQQQ          Q   QQQ     Q                QQZQ   Q   
    39   39 A K    >   -     0   0   51  495    8                  KKKK          K   KKK     K                KKKK   R   
    40   40 A Q  T 3  S+     0   0  190  496   18                  PSPS          P   PPP     P                PPPP   P   
    41   41 A G  T 3  S+     0   0   86  496   10                  GGGG          G   GSG     S                GGGG   G   
    42   42 A K  S <  S-     0   0  126  495   54                  QQQQ          E   QQR     E                QQZQ   Q   
    43   43 A S        -     0   0   21  495   56                  SASA          R   ASS     A                PSPS   S   
    44   44 A P        -     0   0    4  495   10                  PPPP          P   PPP     P                PPPP   P   
    45   45 A Q  E     -F   37   0B  74  495   32                  QKQK          K   KQQ     K                KEKQ   R   
    46   46 A F  E     +F   36   0B  25  495   41                  GLLL          L   RLL     L                GLLL   R   
    47   47 A L  E     +     0   0B   4  495    9                  LLLL          L   LLL     L                LLLL   L   
    48   48 A V  E     -FG  35  54B   0  496    5                  IIII          I   III     V                IIII   I   
    49   49 A Y  E >> S+ G   0  53B  39  496   17                  YYYY          Y   YYY     Y                YYYY   Y   
    50   50 A N  T 34 S-     0   0   52  496   91                  LYKH          L   GLL     Y                YLRL   K   
    51   51 A A  T 34 S+     0   0    3  496   44                  VAVG          A   AVV     A                ASAV   V   
    52   52 A K  T <4 S+     0   0  148  496   25                  SSSS          S   SSS     T                SSSS   S   
    53   53 A T  E  <  -G   49   0B  47  496   68                  NTNT          S   NNN     S                TYNN   N   
    54   54 A L  E     -G   48   0B  60  496   59                  RRRL          W   RRR     R                LRLR   R   
    55   55 A G    >   -     0   0    9  495   70                  FHLA          A   AAA     Q                ADZF   D   
    56   56 A E  T 3  S+     0   0  192  495   35                  STSS          S   SSS     S                SSST   S   
    57   57 A G  T 3  S+     0   0   70  496    5                  WGGG          G   GGG     G                gGGG   G   
    58   58 A V    <   -     0   0   25  494   10                  VTVV          V   VVV     V                dVIV   V   
    59   59 A P    >   -     0   0   47  495    7                  PPPP          P   PPP     S                PPPP   P   
    60   60 A S  T 3  S+     0   0  115  496   56                  DEDA          A   DDD     D                SDAD   D   
    61   61 A R  T 3  S+     0   0   44  496    4                  RRRR          R   RRR     R                RRRR   R   
    62   62 A F  E <   +C   75   0A   5  496    1                  FIFF          F   FFF     F                FFFF   F   
    63   63 A S  E     -C   74   0A  55  495   23                  SSSS          S   STS     S                KSSS   S   
    64   64 A G  E     +C   73   0A  13  496    2                  GGGg          S   GGG     G                GDGG   G   
    65   65 A S  E     +C   72   0A  63  496    6                  SSSs          S   SSS     S                SSSS   S   
    66   66 A G  E     -C   71   0A  36  496   14                  GGGG          G   GGG     G                GGGG   G   
    67   67 A S  E >   +C   70   0A  79  496    9                  SSSS          S   SSS     S                SSSS   S   
    68   68 A G  T 3  S-     0   0   16  496   12                  GGGG          G   GGG     G                GGRG   G   
    69   69 A T  T 3  S+     0   0   67  495   13                  TTTY          T   TTT     T                TTTT   T   
    70   70 A Q  E <   +BC  24  67A 110  496   29                  DDDt          D   DDD     D                QDBD   D   
    71   71 A F  E     -BC  23  66A   2  494    5                  FFFy          F   FFF     F                FFFF   F   
    72   72 A S  E     -BC  22  65A  26  495   30                  TTTT          T   TTT     T                TTTT   T   
    73   73 A L  E     -BC  21  64A   0  496    2                  LLLL          L   LFL     L                LLLL   L   
    74   74 A K  E     -BC  20  63A  97  496   38                  RTKT          T   TKK     T                TKTR   K   
    75   75 A I  E     -BC  19  62A   0  496    1                  IIII          I   III     I                IIII   I   
    76   76 A N  S    S-     0   0   86  496   29                  SSSS          N   SSS     S                STBS   S   
    77   77 A S  S    S-     0   0   58  496   62                  RRRS          N   NRR     G                DRPR   R   
    78   78 A L        -     0   0    0  496   27                  VMVA          L   FVV     V                VVVV   V   
    79   79 A L    >   -     0   0   67  496   31                  EEEE          Q   QEQ     Q                qQZE   E   
    80   80 A P  G >  S+     0   0   92  496   59                  AAHT          A   AAA     A                bAAA   A   
    81   81 A E  G 3  S+     0   0  102  496   15                  DEDE          E   EEE     E                BEBD   E   
    82   82 A D  G <  S+     0   0    1  496    5                  DDDD          D   DDD     D                ADDD   D   
    83   83 A F    <   +     0   0   29  495   73                  AALA          V   AAA     A                AVVM   V   
    84   84 A G  E    S- H   0 105B  17  496   23                  GAGG          G   AGG     G                TGAG   G   
    85   85 A S  E     -EH  38 104B  24  496   62                  VDVD          D   VVV     V                VVTV   V   
    86   86 A Y  E     -EH  37 103B   0  496    0                  YYYY          Y   YYY     Y                YYYY   Y   
    87   87 A Y  E     -E   36   0B   5  495    4                  YYYY          Y   YYY     Y                YYFY   Y   
    88   88 A b  E     -E   35   0B   0  496    0                  CCCC          C   CCC     C                CCCC   C   
    89   89 A Q  E     -EI  34  99B   0  494   48                  GQGQ          Q   QQM     H                QMZG   M   
    90   90 A H  E     -E   33   0B  22  486   28                  QQQQ          Q   QQH     Q                GQZQ   Q   
    91   91 A H        +     0   0    0  423   89                  NGAS          H   GSD     S                YASN   G   
    92   92 A Y  S    S+     0   0  104  454   87                  LYSY          Y   KIL     Y                KTBL   T   
    93   93 A G  S    S-     0   0   34  421   71                  QSKS          S   EQE     S                SZZQ   H   
    94   94 A T  S    S-     0   0  104  444   88                  FGIF          S   LAA     F                SSAS   W   
    95   95 A P  S    S+     0   0    7  441   51                  PSPP          P   PPP     P                DPPP   P   
    96   96 A P  S    S-     0   0   55  420   76                  SHPL          P   PPH     f                TYWP   P   
    97   97 A L        -     0   0   21  151   88                   .TT          .   ...     h                R..T   W   
    98   98 A T        -     0   0   40  278   41                   .VV          .   .TT     Q                ATTV   T   
    99   99 A F  B     -I   89   0B  18  277   26                   .MI          .   .VV     F                FFFV   F   
   100  100 A G        -     0   0    3  285   38                   .QP          .   .GG     G                GGGQ   G   
   101  101 A G        -     0   0   52  300   63                   STT          .   .QQ     Q                GQSA   Q   
   102  102 A G        -     0   0   11  300   41                   DLH          .   .GP                      GGGG   G   
   103  103 A T  E     - H   0  86B   0  360   19                   TTT          T   TSS                      TTTT   T   
   104  104 A K  E     -dH  10  85B  98  359   60                   EKK          M   VRQ                      EKKQ   K   
   105  105 A L  E     -dH  11  84B   4  343   39                   LMT          F   LMM                      VLL    V   
   106  106 A E  E     -d   12   0B 108  326   52                   N S          Q   QKE                      VZE    E   
   107  107 A I  E      d   13   0B 113  295   51                     L          S   PLT                      VII    I   
   108  108 A K              0   0  145  261   18                                R   RRQ                      KKK    K   
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30                 Q    QQQQQEQQQQ Q Q     EQQ               QQ    D   EQQ
   111    2 B V        +     0   0   19  428   12                 V    IVVVVVLLVV V V     VVV               VV    V   VVI
   112    3 B K  E     -J  134   0C 111  430   32                 Q    HQQQQQKRQK Q Q     QQQ               QQ    Q   QQQ
   113    4 B L  E     -J  133   0C   3  452    1  V              L    LLLLLLLLLL LLL   LLLLL L             LL    LL  LLL
   114    5 B Q  E     -J  132   0C  83  454   70  E              Q    VQQQQVKQQL QTK   TTQKL Q             VV    QQ  VQV
   115    6 B E  E     +J  131   0C   5  458   22  E              E    QQQQQEEEEE EQE   EQQEQ E             QQ    EQ  EQQ
   116    7 B S  E     +J  130   0C  69  463   14  S              S    SPPPPSSSSS SSS   SSSSP S             SS    SP  SSS
   117    8 B G        +     0   0   36  467    4  G              G    GGGGGGGGGG GEG   EEGGG G             GG    GG  GDG
   118    9 B G        +     0   0   29  718   50  GPPPPPP  DAPPPPP    PAAAAAPPPP PAP   SPAPT PPPPPP APPAAPAAA    PTP AAP
   119   10 B D        -     0   0   96  725   42  RGGESGGG DEEEGGG    EEEEEENGSG GVG   VVEGE GGGGGG EGEEEEEEE    GEE EEE
   120   11 B L  E     +n  224   0D  79  727   14  LLLLLLLL LLQLLLQ    LLLLLVLLLL LIV   VVLLL LLLLLL LLLLLLLLL    LLL VLL
   121   12 B V  E     -n  225   0D  16  729   31  VVVVVVVV VMVEVVV    KVVVVKVVVV VKV   KKVVV VVVVVV VVVVVGVRR    VVV KVK
   122   13 B Q    >   -     0   0  114  730   53  TAKKKQAA KKKKAAK    KRKKKKKKKK KRK   RRKAK KQAQAAKKQRKRKRKK    KKK KKT
   123   14 B P  T 3  S+     0   0   66  730    7  PPPPPPPPPPPPPPPP    PPPPPPPPPP PPP   PPAPP PPPPPPPPPPPPPPPP    PPP PPP
   124   15 B G  T 3  S+     0   0   58  734   31  TSSGSSSSSGGGGSSS    GGGGGGGSSS SES   GGGSG SSSSSSGGSGGGGGGG    SGG GGG
   125   16 B G    <   -     0   0   25  736   63  PQQAQQQQQAAAAQQQ    ETAAAAAEQQ QEQ   EESQA QQQQQQAAQVAVAAAA    QAA AAE
   126   17 B S        +     0   0   78  735   29  GSTLTSSSSSSSSSST    TSSSSSSTTS TST   SSSSS TSSSSSLSSSSSSSSS    SSS SST
   127   18 B L  E     - K   0 192C  25  737   28  LLVVLLLLLVVVVLLL    VVVVVVVLLL LHL   HHVLV LLLLLLVVLVVVVVVV    LVV VVV
   128   19 B K  E     - K   0 191C  93  735   55  TSSKSSSSSKKKKSSS    KKKKKKKSSS TRS   RTKSN SSSSSSKKSKKKKKKK    SKK KKK
   129   20 B L  E     - K   0 190C   0  740   16  LILILIIIILIIIIIL    ILMLLVILLL LLL   LLMIL LIIIIIILIILIILII    LLI VII
   130   21 B S  E     -JK 116 189C  28  740   37  TTTSTTTTTSSSSTTT    SSSSSSSTTT TTT   TTSTS TTTTTTSSTSSSSSSS    TSS SSS
   131   22 B d  E     -JK 115 188C   0  740    0  CCCCCCCCCCCCCCCC    CCCCCCCCCC CCC   CCCCC CCCCCCCCCCCCCCCC    CCC CCC
   132   23 B A  E     -JK 114 187C  52  740   67  TTTKSTTTTKKKKNTT    KKKKKKKSTT STA   SSKTK ATTTTTKTTKTKKKKK    SQK KKK
   133   24 B A  E     +J  113   0C   8  740   48  VIVAVVVVVAATAVVV    AAAAAAAVVV VTV   AAAVA VVVVVVAAVGAGAAAA    VAA AAA
   134   25 B S  E     +J  112   0C  58  740   14  SSTSTSSSSSTSSSSS    SSSSSSSSST SSS   SSTSS SSSSSSSSSSSSSLSS    TSS SSS
   135   26 B G  S    S+     0   0   56  739    3  GGGGGGGGGGGGGGGG    GGGGGGGGGG GGG   GGGGG GGGGGGGGGGGGGGGG    GGG GGG
   136   27 B F  S    S-     0   0   33  740   31  FFIYDFFFFYYYYFFF    YYYYYYYGFY FFF   FFYFY FFLFFFYFFYFYYYYY    YYY YYY
   137   28 B T    >   -     0   0   93  740   53  SSSTSSSSSTTTSSSS    TTTTTTSSSS STS   TTTST SSSSSSTNSTNTSTTT    STT TTT
   138   29 B F  G >  S+     0   0    2  740   28  LLIFILLLLFFFFLLL    FFFFFFFVLI IFL   FFFLF ILLLPLFILFIFFFFF    IFF FFF
   139   30 B S  G 3  S+     0   0   57  740   55  STTTTTTTTTSTTTTT    TTTTTTTSTT TST   SSSTT TTTTTTTKTTKTTTTT    TTS TTT
   140   31 B S  G <  S+     0   0   71  740   57  SStSSSSSSSDEGRGN    SSSSSGGsSs tSS   SDSGS tNSSRSSDSDDDGDDD    sSN GDD
   141   32 B Y  S <  S-     0   0   44  738   42  YYyYGYYYYYYYYYYN    YYYYYYYlNy yYY   YYYYY yYYYYYYTYYTYHYYY    yFS YHY
   142   33 B T        -     0   0   30  739   92  DGRDYGGGGWWTNGAG    GWWWWYYYAA SED   GGEGW RGGGGGDYGAYANEYY    YWW YAS
   143   34 B M  E     -OP 160 207E   0  739   49  MVWIWVVVVIIIMVVV    LMIMMMIWVW WMV   MMLVM WVVVVVIIVMIMMMMM    WMM MII
   144   35 B S  E     -OP 159 206E   0  740   72  GHSNNHSHNNEHNHNH    THTRHHHGGN SHG   NHYNH SHNHSSNHHHNHYHYY    NHN HHH
   145   36 B W  E     +OP 158 205E   0  740    0  WWWWWWWWWWWWWWWW    WWWWWWWWWW WWW   WWWWW WWWWWWWWWWWWWWWW    WWW WWW
   146   37 B V  E     -OP 156 204E   0  740   17  VVIVIVVVVIVVVVVT    VVVVVVVVVI IIV   VVVVI IVVVVLVVVVVVVMVV    IVV VVV
   147   38 B R  E     -OP 155 203E  10  740   21  RRRKRRRRRKKKKRRR    IKKKKRKRRR RRR   RRRRR RRRRRRKKRKKKKKRR    RKK RKK
   148   39 B Q  E     -OP 154 202E   9  740    4  QQQQKQQQQQQQQQQQ    QQQQQQQQQQ QQQ   QQQQQ QQQQQQQQQQQQQQQQ    QQL QQQ
   149   40 B T    >   -     0   0    9  739   74  APFRFSPPPRRSSPPA    SRRRRASPAF FAA   AAAPR PSPSPPRRSSRSSTAA    FRR ANA
   150   41 B P  T 3  S+     0   0   80  740   11  PPPPPPPPPPPHNPPP    PPPPPPHPPP PPP   PPPPP PPPPPPPPPHPHHPPP    PPP PPP
   151   42 B E  T 3  S-     0   0  151  740   29  GGGGGGGGGGGGGGGG    GGGGGGVGGG RGG   GGGGG GGGGGGGEGAEARVGG    GGG GEG
   152   43 B K    <   +     0   0  121  740   37  KKNQNKKKKQHKKKKK    KQQRRQKKKN KKK   KKQKQ KKRKKKQQKKQKKHQQ    NQQ QQK
   153   44 B R        -     0   0  113  739   42  GGKGKGGGGGGSSGGG    DGGGGGSGAK GGG   GGGGG RGGGGGGGGSGSSGGG    KGG GGD
   154   45 B L  E     -O  148   0E   9  740   13  LLLLLLLLLLLFLLLL    LLLLLLLLLL LLL   LLLLL LLLLLLLLLLLLLLLL    LLL LLL
   155   46 B E  E     -O  147   0E  44  739    4  EEEEEEEEEEEEEEEE    KEEEEEKEEE EEE   EEEEE EEEEEEEEEEEEEEEE    EEE EEK
   156   47 B W  E     +O  146   0E  15  739   11  WWWWYWWWWWWWWWWW    WWWWWWWWWW FWW   WWDWW WWWWWWWWWWWWWWWW    WWW WWW
   157   48 B V  E     -     0   0E   0  739   28  ILIIMLLLLIIIILLV    MIIIIMIIVM IIV   IILLI ILLLLLIILIIIIIMM    MII MIM
   158   49 B A  E     -O  145   0E   0  740   36  GVGGGGGGGGGGGGGG    GGGGGGGGGG GAG   ASGGG GGAGGGGGGGGGGGGG    GGG GGG
   159   50 B S  E     -OQ 144 168E   0  740   94  IVYWYVVVVREGNVMV    WVDRRWRSFY EYA   YAYTG GVVVVVWRVVRVYAYY    YNR WYW
   160   51 B I  E     -OQ 143 167E   4  739   18  IIIIIIIIIIIIIIII    IIIIIIIIII III   IIIII IMIIIIIIIIIIIIII    III IFI
   161   52 B N    >   -     0   0   47  740   85  YWYYSWWWWALNDWWW    NDYDDNNFYT YSD   CNSWN RWWWWWYDWSDSDHYY    SYY NSN
   162   53 B N  T 3  S+     0   0   65  740   86  ASYPYSGAAPPPPTGS    TPPPPPPYTY NTN   TTSGP NSGSGGPPSTPTPPPP    YPP PPT
   163   54 B G  T 3  S-     0   0   65  740   68  SDSGSGDGGGGNYGDG    FSGNNNYSRS DSG   SDSNS DGDGDDGAGYAYYGGG    DSG NGE
   164   55 B G  S <  S+     0   0   30  740   50  GGGDGGGGGSSSYGGG    SDSSSSNGGG GGG   SGSGN GGGGGGDNGYNYNSNN    GND SNT
   165   56 B G  S    S+     0   0   74  739   59  SSTGSSSSSGDGGISS    GSGGGGGSSR SSS   SSASG DSTSSSGGSGGGGGSS    SGG Wdg
   166   57 B R        +     0   0  163  548   85  ...S.....STGS...    VYSGGGA... .T.   PIY.G ......SN.NNDGGNN    .DD Tfp
   167   58 B T  E     -Q  160   0E  62  724   48  TTITTTTTTTTTTTTK    PTTTTTTTIT TIT   IQPTT TTTTTTTSTTTATTTT    HTA TKT
   168   59 B Y  E     +Q  159   0E  53  723   87  YTTKYDNNNYNNSNDD    TNNKKNSYYT YNC   YYNDN KDNDNNKKDNRSSANN    NNY N..
   169   60 B Y        -     0   0   44  737    7  YYYYYYYYYYYYYYYY    YYYYYYYYYY YYY   YYYYY YYYYYYYYYYYYYYYY    YYY YYY
   170   61 B P    >>  -     0   0   20  737   66  ANNNNNHNNNNNNNNN    ANNNNANNNN SSN   SSANN NNHNHHNDNNDNNNAA    NNN ANA
   171   62 B D  T 34 S+     0   0  148  739   65  SSPEPASSSEEQQSSP    DQEEEQQPPP PPP   QEQSE PASASSEPAQPQQQQQ    PEG QED
   172   63 B T  T 34 S+     0   0   90  739   62  WASKSAAAAMKKKAAA    DKKKKKNSAS SSA   SSKTK SAAAAAKKAKKKKKKK    SKK KRD
   173   64 B V  T X> S+     0   0    1  740   43  ALLFLFLLLFFFFLLL    FFFFFVFLML LVL   VVFLF LFLFLLFFFFFFSFFF    LFF FFF
   174   65 B K  B 3< S+l  177   0C 142  739   35  KKTKKIIMMKKKKMKK    KKKKKQNKKK KKK   QKQKK KIIIIIKQIKQKKKQQ    KKK QKT
   175   66 B G  T 34 S+     0   0   74  739   36  GSSGGSSSSGGGGSSS    GGSSSGDSSS SGS   GGGSS SSSSSSGGSGGGGGGG    NSG GGG
   176   67 B R  T <4 S+     0   0   36  739   21  RRRKRRRRRKKKKRRR    RKKKKRKRRR RRR   RRRRK RRRRRRKKRKKKKKRR    RKK KKR
   177   68 B F  E  <  -lM 174 192C   2  740   67  FLTAILLLLAAAALLL    FAAAAVAVLI TFL   FFVLA VLLLLLATLAAAAAVV    IAA VAF
   178   69 B T  E     - M   0 191C  79  740   38  TSTTSSSSSTTTTTSS    ATTTTTSTSS STS   SITTT SSTSSSTTSTTTTTTT    STT TTA
   179   70 B I  E     + M   0 190C   5  740   22  IIILIIIIILFLLIII    FLLLLMLIII III   IIIIL IIIIIILIIMIMLLMM    ILL MLF
   180   71 B S  E     - M   0 189C  51  736   45  SSTTTSSSSTTTTSNT    STTTTTTSTT SST   SSTTT SSSSSSTNSTTTTTTT    TTT TTS
   181   72 B R  E     - M   0 188C  30  739   68  KKRARKKKKVAIVRKR    LVVVVRVVRR RRR   RRAKV RKKKKKATKVAVVAAA    RVA KAL
   182   73 B D  E > > - M   0 187C  60  738    5  .DDDDDDDDDDDDDDD    DDDDDDDDDD DDD   DDDDD DDDDDDDDDDDDDDDD    DDD DDE
   183   74 B N  G > 5S+     0   0   48  739   59  .NTKTNNNNTTKKNNT    TTKKKTKTTT TNT   DNENK TNNNNNKTNKTKKKKK    TKK TKT
   184   75 B A  G 3 5S+     0   0   99  739   41  .SSSSSSSSSSSSSSS    SSPPPTSLSS SPS   SNSSS SSFSSSSSSSSSSSSS    SYS SSS
   185   76 B K  G < 5S-     0   0  111  740   54  TKKSKKKKKSSSSKKK    TSSSSISKKK KSK   SRTKS KKKKKKSSKSSSSSSS    KSS ISA
   186   77 B N  T < 5 +     0   0   62  740   46  SSNSNSSSSSNSSSSS    SSSSSSSNSN NSS   SANSS NSRSSSSNSSNSSSSS    NSS SSS
   187   78 B T  E   < -KM 132 182C  16  740   68  TQQTQQQQQTTTTQQQ    TTTTTTTNQQ QKQ   KQTQA QQQQQQTTQTTTTTTT    QTT TTT
   188   79 B L  E     -KM 131 181C   0  737   61  TVFAYVVVVAAATVVV    AAAAAAAFVF FLV   LLAVT FVVVVVAAVATAAAAA    FAA AAA
   189   80 B Y  E     -KM 130 180C  41  737   41  VFFYYFFFFYYYYFFY    YYYYYYYSSF SYY   YNYFY SFFFFFYYFYYYYCYY    FYY YYY
   190   81 B L  E     -KM 129 179C   0  739    8  DLLMLFLLLIMMMLLL    LMMMMMMLLL LLL   LLMLM LFLFLLMLFMLMMMMM    LMM MVL
   191   82 B Q  E     -KM 128 178C  76  739   41  LKEQQKKKKQQDQKKI    QQQQQEEKSQ QQQ   QQEKQ QKKKKKQQKEHEHEEE    KQQ EQQ
   192   83 B M  E     +KM 127 177C   0  740   11  KMMLLMLMMLLLLMML    ILLLLLLLLL LML   MMLML LMLMLLLLMLLLLLLL    LLL LLI
   193   84 B S        +     0   0   42  740   54  TNNSNNNNNSSRANNS    DSSSSSHSSN SNT   NNSNS SNTNNNSNNASANSSS    NSS SNN
   194   85 B S  S    S-     0   0   68  739   23  SSSSSSSSSSSSSSSS    NSSSSRSSSS SSS   SSSST SSSSSSSSSRSRSSSS    SSS RSN
   195   86 B L        -     0   0    3  740   16  LLLLVLLLLLLLLLLL    LLLLLLLVVV MLV   LLLLP MLLLLLLLLLLLLLLL    VLL LLL
   196   87 B K    >   -     0   0  102  740   70  PQTTTQQQQSTTTQQT    KTTTTRTTTT TKN   RKRQT TQQQQQTTQTTTTTRR    TTT RTK
   197   88 B S  G >  S+     0   0   70  740   59  TTASTATTTSSSSTIV    NSSSSSSATT TTP   MTSTS TATATTSSASSSSSAA    ISS SSN
   198   89 B E  G 3  S+     0   0  126  740   21  EDEEENDDDEEEEDDE    EEEEEDEAEE EEE   EEEDE ENDDDDEEDEEEEEEE    EEV DEE
   199   90 B D  G <   +     0   0    2  740    3  DDDNDDDDDDDDDDDD    DDDDDDDDDD DDD   DDDDD DDDDDDNDDDDDDDDD    DDD DDD
   200   91 B T    <   +     0   0   32  740   32  TTTSTTTTTSSSSTTT    TSSSSTSTTT TST   TSTTS TTTTTTSTTSTSSSTT    TSS TST
   201   92 B A  E    S- R   0 223E   8  737    4  AAAAAAAAAAAAAAAA    AAAAAAAAAA AAA   AAAAA AAAAAAAAAAAAAAAA    AAA AAS
   202   93 B M  E     -PR 148 222E  58  739   46  TMTVTITMMVVVVVKT    TVVVVVVVVT MVV   VVVRV TITITTVVIVVIIVMM    TVV VVT
   203   94 B Y  E     -PR 147 221E   0  739    1  YYYYYYYYYYYYYYYY    YYYYYYYYYY YYY   YYYYY YYYYYYYYYYYYYYYY    YYY YYY
   204   95 B Y  E     -P  146   0E   7  740    4  FYYFYYYYYFYYYYYY    FYYYYYYYYY YYY   YYFYY YYYYYYFYYYYYYYYY    YYF YFF
   205   96 B d  E     -P  145   0E   0  740    0  CCCCCCCCCCCCCCCC    CCCCCCCCCC CCC   CCCCC CCCCCCCCCCCCCCCC    CCC CCC
   206   97 B V  E     -PS 144 217E   0  740   24  AAAAAAAAAAATAVAA    SAAAAAATAA AAA   AAAAA AAAAAAAAAASAATAA    ATA ATA
   207   98 B R  E     -PS 143 216E  21  739   39  rrrrrrkrrrrRRrrr    tpprrrirrR rRk   rrvsr RrrrkkrrrFtrrrss    rrR rri
   208   99 B H  E     + S   0 214E   6  629   94  hyryha.ddtsDQgia    gdnvggvkgG hDr   ysisg .prynnmyy.gyqdww    es. r.y
   209  100 B E  E  >  + S   0 213E  63  676   73  LGPYDI.GGGDYGSST    GDHANDERYI QAE   LSSDD .GPGGGIGGNNNAGGG    ESS G.Y
   210  101 B Y  T >4 S-     0   0   80  702   91  ASYDGN.SSDRKGSFS    FWLPWADVAS EQR   VLRKR .ALSYYGPSYRYLLRR    YGN L.A
   211  102 B Y  T 34 S-     0   0  140  709   44  FYYYYY.YYYYyYYFy    iYYFYFYWyY CyL   FYYYY .YYRYYFWRyFYYFYY    YFw W.y
   212  103 B Y  T 34 S+     0   0   39  264   90  .WYDY.gWW..e.VYy    t.......c. .v.   V..F. A........s......    Y.v .ld
   213  104 B A  E <<  -S  209   0E   0  447   85  .YAAYAPYY..GYGAG    A.....ANSG TNL   F..T. T.AI....IS.AG...    A.R .NP
   214  105 B M  E     +S  208   0E   0  580   59  VFMFFMMFF.FVFFMM    LFF.F.VMIL LCR   I.FLF VFLM...FMY.MM...    M.F FML
   215  106 B D  E     +     0   0E  19  696   48  DDDADDDDD.DDDADD    DDDDDDDDDA GHK   KNDDD SDDDDDDADPADDA..    DVA DAD
   216  107 B Y  E     -S  207   0E  99  702   57  VVYYYYYVV.VYFYYY    TVYYVIYLYY YDL   FFGYV LYYYYYYYYYYYCY..    YYY PYY
   217  108 B W  E     -S  206   0E  23  731    0  WWWWWWWWWWWWWWWW    WWWWWWWWWW WWW   WFWWW WWWWWWWWWWWWWWWW    WWW WWW
   218  109 B G        -     0   0    0  714   13  GGGGGGGGGGGGGGGG    GGGGGGGGGG  TG   LSGGG EGGGGGGGGGGGGGGG    GGG GGG
   219  110 B Q        -     0   0   91  701   38  PAQQQQQAAQAQQQQL    QTQQTQQQPQ  TQ   KSQQT GQQQQQQQQQQQQQQQ    QQQ QQQ
   220  111 B G        -     0   0   16  687   10  GGGGGGGGGGGGGGGG    GGGGGGGGGG  A    GPGGG SGGGGGGGGGGGGGGG    GGG GGG
   221  112 B T  E     -R  203   0E  21  675   26  TTTTTTTTTTTTTTTT    TTTTTTTTLT  L    IPTTT  TTTTTTATTTTTTTT    TTT TTT
   222  113 B T  E     -R  202   0E  72  661   75  LASLTSSTTTTTTLSL    STTTTMTTLL  M    ILLST  TSSTTTLSSLSSLLL     LL LSS
   223  114 B V  E     -R  201   0E   0  654   18  VVVVLVVVVLVLLVVV    LVLLVVVVVV  T     VVVV  LVVLLLVVVVVVVVV     VV VVV
   224  115 B T  E     -n  120   0D  36  643   13  TTTTTTTTTTTTTTTT    TTTTTTTTTT  G     T TT  TTTTTTTTTTTTTTT     TT TTT
   225  116 B V  E     +n  121   0D   6  626    6  VVVVVVVVVVVVVVVV    VVVVVVVVVV  L     L VV  VVVVVVVVVVVVVVV     VV VVV
   226  117 B S        -     0   0   36  616    5  SSSSSSSSSSSSSSSS    SSSSSSSSSS  T     G SS  SSSSSSSSSSSSSSS     SS SSS
   227  118 B S  S    S+     0   0   84  597   20   SSASSSSSSSSSASS    SSSSSSSSSA  T     G SS  SSSSSSASSASSASS     AA SSS
   228  119 B A  S    S+     0   0   70   97   58                 V    AEEEE                                VV     A     
   229  120 B W        -     0   0  123   87   40                 D     SSSS                                DD     K     
   230  121 B R        +     0   0  207   62   76                 P     QQQQ                                PP     T     
   231  122 B H              0   0  156   56   69                 N     SSSS                                NN     T     
   232  123 B P              0   0  155   28   53                 S                                         SS     P     
## ALIGNMENTS 1051 - 1120
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    1 A D              0   0  183  423   16       DDD  D               DDD               D         DD              
     2    2 A I        -     0   0   32  466   12       VVI  I               IIV               VV        II              
     3    3 A E        -     0   0  117  468   68       VLV  I               VVV               VA        VV              
     4    4 A L  E     -A   25   0A  10  482    7       MLM  M               IIL               LV        MM              
     5    5 A T  E     -A   24   0A  64  482    8       TTT  T               TTT               TK        TT              
     6    6 A Q  E     -A   23   0A  13  482    0       QQQ  Q               QQQ               QE        QQ              
     7    7 A T  E    S+A   22   0A  64  482   35       TTT  S               DDT               TP        ST              
     8    8 A P        -     0   0   46  485    9       PPP  P               EEP               PP        PP              
     9    9 A V  S    S+     0   0   96  489   67       VLL  A               LLG               VE        AL              
    10   10 A S  E     -d  104   0B  60  491   42       SFS  S               SSS               AF        TS              
    11   11 A L  E     -d  105   0B  58  494   23      LLLL  L               NKL               MR        ML              
    12   12 A S  E     +d  106   0B  60  495   42      APPP  T               PPS               PA        AA              
    13   13 A A  E     -d  107   0B   0  495   58      VVVV  A               VVV               VV        VV              
    14   14 A S    >   -     0   0   47  496   31      SSST  S               TTT               TS        ST              
    15   15 A V  T 3  S+     0   0   76  496   66      LLLP  P               SSL               LA        PP              
    16   16 A G  T 3  S+     0   0   42  496    5      GGGG  E               GGG               GG        GG              
    17   17 A E    <   -     0   0   71  496   36      QSDE  G               EED               DE        EE              
    18   18 A T        -     0   0   69  496   62      RQQP  T               SSQ               QT        RP              
    19   19 A V  E     - B   0  75A  11  496   36      AVAA  V               VVA               AV        VA              
    20   20 A T  E     - B   0  74A  67  495   29      TSSS  T               SSS               ST        TS              
    21   21 A I  E     - B   0  73A   1  494   17      IIII  I               III               II        II              
    22   22 A T  E     -AB   7  72A  29  494   59      STSS  N               SSS               SN        HS              
    23   23 A b  E     -AB   6  71A   0  495    1      CCCC  C               CCC               CC        CC              
    24   24 A R  E     -AB   5  70A 110  495   47      RRSR  K               RRR               RK        KK              
    25   25 A A  E     -A    4   0A  10  495   28      ASSS  A               SSS               SS        SA              
    26   26 A S  S    S+     0   0   66  495    4      SSSS  S               SSS               SS        SS              
    27   27 A E  S    S-     0   0  101  495   38      QHQQ  Q               KKQ               QQ        QK              
    28   28 A N        +     0   0   83  495   45      SSSS  S               SSS               SS        SS              
    29   29 A I    >   -     0   0    5  496   32      VLLL  L               LLL               LL        LL              
    30   30 A Y  T 3   -     0   0  155  496   81      svvl  f               lle               vl        fl              
    31   31 A S  T 3  S+     0   0   53  471   64      ntst  d               ttt               tn        ht              
    32   32 A Y    <   +     0   0   63  495   53      LYYY  Y               YYY               YY        LY              
    33   33 A L  E     -E   90   0B   0  495    7      MLLL  L               LLL               LL        LL              
    34   34 A A  E     -E   89   0B   0  495   71      HSED  N               NNE               EA        SY              
    35   35 A W  E     -EF  88  48B   1  496    0      WWWW  W               WWW               WW        WW              
    36   36 A Y  E     -EF  87  46B   0  496    8      YYHY  Y               FFY               YY        YF              
    37   37 A Q  E     -EF  86  45B   7  496   27      QLLL  Q               LLL               LQ        QL              
    38   38 A Q  E     -E   85   0B  21  496    4      QQQQ  Q               QQQ               QQ        QQ              
    39   39 A K    >   -     0   0   51  495    8      KKKK  K               RGK               KK        KK              
    40   40 A Q  T 3  S+     0   0  190  496   18      PPSP  P               PPP               PP        PP              
    41   41 A G  T 3  S+     0   0   86  496   10      GGGG  G               GQG               GG        GG              
    42   42 A K  S <  S-     0   0  126  495   54      QQQQ  Q               QQQ               QQ        QR              
    43   43 A S        -     0   0   21  495   56      QDSS  A               SSS               SS        SS              
    44   44 A P        -     0   0    4  495   10      PPLP  P               PPP               PP        PP              
    45   45 A Q  E     -F   37   0B  74  495   32      KQQQ  K               QRQ               QK        KQ              
    46   46 A F  E     +F   36   0B  25  495   41      LPLL  L               LLL               LL        LH              
    47   47 A L  E     +     0   0B   4  495    9      LLLL  L               LLL               LL        LL              
    48   48 A V  E     -FG  35  54B   0  496    5      IIII  I               III               II        II              
    49   49 A Y  E >> S+ G   0  53B  39  496   17      YYYY  Y               SYY               YY        YY              
    50   50 A N  T 34 S-     0   0   52  496   91      RKEE  F               LLG               EL        WG              
    51   51 A A  T 34 S+     0   0    3  496   44      AVVV  A               MMV               VA        AG              
    52   52 A K  T <4 S+     0   0  148  496   25      SSSS  S               SSS               SS        SS              
    53   53 A T  E  <  -G   49   0B  47  496   68      NNKN  N               TTN               NT        TN              
    54   54 A L  E     -G   48   0B  60  496   59      LRRR  R               RRR               QR        RL              
    55   55 A G    >   -     0   0    9  495   70      AFHA  D               AAF               FE        AD              
    56   56 A E  T 3  S+     0   0  192  495   35      SSSS  S               SSS               SS        SS              
    57   57 A G  T 3  S+     0   0   70  496    5      GGGG  G               GGG               GG        GG              
    58   58 A V    <   -     0   0   25  494   10      IVVV  V               VVV               VV        VV              
    59   59 A P    >   -     0   0   47  495    7      PPPP  P               SSP               PP        PP              
    60   60 A S  T 3  S+     0   0  115  496   56      ADDD  D               DDD               DD        DD              
    61   61 A R  T 3  S+     0   0   44  496    4      RRRR  R               RRR               RR        RR              
    62   62 A F  E <   +C   75   0A   5  496    1      FFFF  F               FFF               FF        FF              
    63   63 A S  E     -C   74   0A  55  495   23      SSSS  S               SSI               II        SS              
    64   64 A G  E     +C   73   0A  13  496    2      GGGG  G               GGG               GG        GG              
    65   65 A S  E     +C   72   0A  63  496    6      SSSS  S               SSS               SS        SS              
    66   66 A G  E     -C   71   0A  36  496   14      GRGG  G               GGG               GG        GR              
    67   67 A S  E >   +C   70   0A  79  496    9      SSSS  S               SSS               SS        SS              
    68   68 A G  T 3  S-     0   0   16  496   12      GGGD  G               RGG               GG        GG              
    69   69 A T  T 3  S+     0   0   67  495   13      TSTT  T               TTT               TT        TT              
    70   70 A Q  E <   +BC  24  67A 110  496   29      DYDD  D               DDD               DD        DD              
    71   71 A F  E     -BC  23  66A   2  494    5      FFFF  F               FFF               FF        FF              
    72   72 A S  E     -BC  22  65A  26  495   30      TTTT  T               TTT               TT        TT              
    73   73 A L  E     -BC  21  64A   0  496    2      LLLL  L               LLL               LL        LL              
    74   74 A K  E     -BC  20  63A  97  496   38      TKKK  T               EEK               KT        TK              
    75   75 A I  E     -BC  19  62A   0  496    1      IIII  I               III               II        II              
    76   76 A N  S    S-     0   0   86  496   29      DSSS  S               SSS               SS        SS              
    77   77 A S  S    S-     0   0   58  496   62      PRRR  N               RRR               RS        SR              
    78   78 A L        -     0   0    0  496   27      VGVV  F               VVV               VV        LV              
    79   79 A L    >   -     0   0   67  496   31      QEEE  Q               KKE               EQ        QQ              
    80   80 A P  G >  S+     0   0   92  496   59      APPA  A               AAP               PA        AP              
    81   81 A E  G 3  S+     0   0  102  496   15      DEEE  E               EEE               EE        EE              
    82   82 A D  G <  S+     0   0    1  496    5      DDDD  D               DDD               DD        DD              
    83   83 A F    <   +     0   0   29  495   73      ILLV  A               VVL               LL        VA              
    84   84 A G  E    S- H   0 105B  17  496   23      AGGG  A               GGG               GA        AG              
    85   85 A S  E     -EH  38 104B  24  496   62      AVVV  V               VVV               VD        DV              
    86   86 A Y  E     -EH  37 103B   0  496    0      YYYY  Y               YYY               YY        YY              
    87   87 A Y  E     -E   36   0B   5  495    4      YYYY  Y               YYY               YY        FY              
    88   88 A b  E     -E   35   0B   0  496    0      CCCC  C               CCC               CC        CC              
    89   89 A Q  E     -EI  34  99B   0  494   48      QGFM  M               QQF               FQ        QM              
    90   90 A H  E     -E   33   0B  22  486   28      QQQQ  Q               QQQ               QQ        QQ              
    91   91 A H        +     0   0    0  423   89      SRGE  N               LLA               AH        FA              
    92   92 A Y  S    S+     0   0  104  454   87      RTTF  Y               VVT               TY        IL              
    93   93 A G  S    S-     0   0   34  421   71      EHHE  D               EEH               HS        SE              
    94   94 A T  S    S-     0   0  104  444   88      SYLI  D               YYD               FY        AF              
    95   95 A P  S    S+     0   0    7  441   51      PPPG  P               PPP               PP        PP              
    96   96 A P  S    S-     0   0   55  420   76      PPPQ  P               LLP               PP        PH              
    97   97 A L        -     0   0   21  151   88      .TT.  M               ..T               TT        ..              
    98   98 A T        -     0   0   40  278   41      TVVT  V               TTV               VV        ..              
    99   99 A F  B     -I   89   0B  18  277   26      VMMA  L               FFM               ML        ..              
   100  100 A G        -     0   0    3  285   38      GQQG  Q               GGQ               QQ        ..              
   101  101 A G        -     0   0   52  300   63      TTTM  S               AAT               TP        ..              
   102  102 A G        -     0   0   11  300   41      GLLG  R               GGL               LP        ..              
   103  103 A T  E     - H   0  86B   0  360   19      NTTT  T               TTT               TT        TT              
   104  104 A K  E     -dH  10  85B  98  359   60      KKKS  K               KKK               KQ        VV              
   105  105 A L  E     -dH  11  84B   4  343   39      LMLK  T               LLM               MT        II              
   106  106 A E  E     -d   12   0B 108  326   52       SSE  S               EES               SS        QQ              
   107  107 A I  E      d   13   0B 113  295   51       VLH  S               LLL               LL        P               
   108  108 A K              0   0  145  261   18         R  R               KK                 R        R               
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30  EQQQ    QQ  QEQ              QDDE EEQ  QQQQQ   QQEQEKQ   DEDDQQ  Q   Q
   111    2 B V        +     0   0   19  428   12  VLVV    VV  VVV              LVVVVIVV  VVVVV   IVVVVVV   VVVVVV  V   V
   112    3 B K  E     -J  134   0C 111  430   32  QKKQ    QQ  QQQ              QQQQQQQQ  HKRKK   RQRQKQQ   QQQHQQ  Q   R
   113    4 B L  E     -J  133   0C   3  452    1  LLLL    LL LLLL              LLLLLLLL  LLLLL  LLLLLLLL   LLLLLLMML   L
   114    5 B Q  E     -J  132   0C  83  454   70  QQLE    QV QQQQ              QQQEQQQV  QLQLL  VEVLQQQK   QVQQQQLLQ   Q
   115    6 B E  E     +J  131   0C   5  458   22  EEEE    EQ EQEQ              EEEQEQQQ  QEEEE  EEQEEEEE  EEQEEQQEEQ   E
   116    7 B S  E     +J  130   0C  69  463   14  SSSS    SS SSSP              SSSSSSSS  WSSSS  SSSSSSSS  SSSSSWSSSS   S
   117    8 B G        +     0   0   36  467    4  GGAG    GG GGGG              GGGGGGGG GGGGGG  GGGGGGGG  EGGGGGGGGG   G
   118    9 B G        +     0   0   29  718   50  PPPP    PA PPPAPPPAPAAPAPP   PPPPPTPAPPTPPPP  GGAGPPPP  GPAPPAPPPAPPPP
   119   10 B D        -     0   0   96  725   42  GEGS    GE GESEDGGEGEEGEES   GGGQGEEEQGGGSGS  AGEGGGSG  GGEGGGQGGEGGGS
   120   11 B L  E     +n  224   0D  79  727   14  ILLL    LV TVLLLLLLLLLLLLL   LLLLLLLVLLLLLLL  VVVMLLLV  LLVLLLLLLLLLLL
   121   12 B V  E     -n  225   0D  16  729   31  LVVV    VR VVVVVVVMVVVVMVV   VVVKVVEKVVLVVVV  KKKKVVVV  FVRVVLVVVVVVVV
   122   13 B Q    >   -     0   0  114  730   53  KKKK    KK KRKKKAAKARRAKKK   KKKTKKKKRKKKKQQ  LKKYKKKK  KKKKKKRKKREKQK
   123   14 B P  T 3  S+     0   0   66  730    7  PPPP    PP PPPPPPPPPSSPPPP   PPPPPPPPPPPPPPP  AVPSPPPP  PPPPPPPPPPXPPP
   124   15 B G  T 3  S+     0   0   58  734   31  SGSS    SG SGSGGSSGSGGSGGS   SSSGSGGGGSSSSSS  GGGGSSSS  TSGSSSGSSGSSSS
   125   16 B G    <   -     0   0   25  736   63  QAEQ    QA EVQAAQQAQAAQATQ   EQQEQAAAAEEEQQQ  EEAEQQQQ  DQAQQETEQTQQQQ
   126   17 B S        +     0   0   78  735   29  TSTT    TS SSTSSSSSSSSSSST   TSSTSSSSSTTTTSS  SSSSTTTT  TSSSSTSTTSTTTT
   127   18 B L  E     - K   0 192C  25  737   28  LVLL    LV LVLVVLLVLVVLVVL   LLLVLVVVVLLLLLL  LLVLLLLL  LLVLLLVLVVLLLL
   128   19 B K  E     - K   0 191C  93  735   55  SESS    SK RKSQKSSKSKKSKKS   SSSESKKKKSSSSSS  FSKHTSSS  TSKSSSKSSKSSSS
   129   20 B L  E     - K   0 190C   0  740   16  LILL    LV LILLMIIMVLLIIML   LLLILIIVILLLLII  LLVLVLLL  LLILLLILLVLLLL
   130   21 B S  E     -JK 116 189C  28  740   37  TSTT    TS TSTSSTTSTSSTSST   STTSTSSSSTTTITT  SSSSTTTT  TTSTTSSTSSTTTT
   131   22 B d  E     -JK 115 188C   0  740    0  CICC    CC CCCCCCCCCCCCCCC   CCCCCCCCCCCCCCC  CCCCCCCC  CCCCCCCCCCCCCC
   132   23 B A  E     -JK 114 187C  52  740   67  SKTT    SK TKSKKTTKTTTTKKS   TSSKSKKKKTATTTT  TKKQTTTA  TSKSSAKTTKAAAT
   133   24 B A  E     +J  113   0C   8  740   48  FAVV    VA VGVAAVVAVATVGAV   VVVAVAAAAVVVVVV  ATAAVVTF  VVAVVVAVVAIIIV
   134   25 B S  E     +J  112   0C  58  740   14  SSSS    SS SSTSSSSTSSSSTST   STTSTSSSSSYSSSS  SSSSSTSS  STSTTYSSSSSSSS
   135   26 B G  S    S+     0   0   56  739    3  GGGG    GG GGGGGGGGGGGGGGG   GGGVDGGGGGGGGGG  GGGWGGGG  GGGGGGGGGGGGGG
   136   27 B F  S    S-     0   0   33  740   31  FYGF    FY FYDHDFFYFFVFYYD   GYNYFYYYYGGGLFF  FFYFFYFF  FYYYYGYYAYDDDF
   137   28 B T    >   -     0   0   93  740   53  SSSS    PT ETSTTSSTSNNSTIS   SSSTSSSTSSSSSSS  NSTDSSSS  SSTSSSSSSGSSSS
   138   29 B F  G >  S+     0   0    2  740   28  LFVL    IF LFIFFLLFLIILFFI   IIILIFFFFIFILLL  FFFFLILL  LIFIIFFVILVVVL
   139   30 B S  G 3  S+     0   0   57  740   55  STRT    TT TTTTTTASTKKTSAT   SATTTTTSTSSSSTT  GDTGTTTT  STTITSTSNTSSST
   140   31 B S  G <  S+     0   0   71  740   57  tYsS    tS SDSNDSSVSDDSNDS   sssDsGGNSsDSSTT  DSSGSsSS  SsSsrGSstNstsS
   141   32 B Y  S <  S-     0   0   44  738   42  mYyN    gY YYDYSYYYYYYYYYG   yyyYyYYYYyYFYYY  YYNYYyYY  YyYyyYYyyEaaaN
   142   33 B T        -     0   0   30  739   92  GYYN    YW YAYWVGGWGYYGWVY   YYYSYNNYWYYYGGG  EWFTHCGV  TFNYNYWYYLATSD
   143   34 B M  E     -OP 160 207E   0  739   49  VMWV    WM VMWIIVVIVMMVIIW   WWWLWMMMMWWWVII  MMMMMWVV  VWMWWWMWWIWWWV
   144   35 B S  E     -OP 159 206E   0  740   72  GHSG    NH YHNHTHSESHNSESN   GSSHHNNNHGSSTHH  GYHSHSSS  ANHNNNHSSESNNV
   145   36 B W  E     +OP 158 205E   0  740    0  WWWW    WW WWWWWWWWWWWWWWW   WWWWWWWWWWWWWWW  WWWWWWWW  WWWWWWWWWWWWWW
   146   37 B V  E     -OP 156 204E   0  740   17  IMIV    IV IVIVMVVVVVVVVVI   IFIVIVVVVIIIVVV  YYVYIVVV  VIVIIIVIIIIIIV
   147   38 B R  E     -OP 155 203E  10  740   21  RKRR    RR RKRKKRRKRKKRKKR   RRRKRKKRKPRRRRR  RRRRRRRR  RRRRRRKRRKRRRR
   148   39 B Q  E     -OP 154 202E   9  740    4  QQQQ    QQ QQKQQQQQQQQQQQK   QQQQQQQQQQQHQQQ  KQQQQQQQ  QQQQRQQQQKQQQQ
   149   40 B T    >   -     0   0    9  739   74  PSPA    PT PSFRRPPRPRRPRRF   PFFGFSSARPPPAPP  APAAPPAA  AFAFFPRHHRSSSA
   150   41 B P  T 3  S+     0   0   80  740   11  SHPP    PP PHPPTPPPPPPPPTP   PPPPPHNPPPPPPPP  SPPPLPPP  PPPPPPPPPPPPPP
   151   42 B E  T 3  S-     0   0  151  740   29  GVGG    GG RAGGGGGGGEEGGGG   EGGGGGGGGGGGGGG  GGGGWGGG  GGGGGGGGGGSSSG
   152   43 B K    <   +     0   0  121  740   37  KKKK    KQ KKNQQKKHKQQKHQN   KDNKNKKQQKKKEKK  RKQKKKKK  ZNQDNKQRRQRRRK
   153   44 B R        -     0   0  113  739   42  GSGA    GG TSKGGGGGGGGGGGK   GKKGKSSGGGGGAGG  GEGSGGAG  GKGKKGDGGGGGXV
   154   45 B L  E     -O  148   0E   9  740   13  LLLL    LL LLLLLLLLLLLLLLL   LLLLLLLPLLLLPLL  PPLRLLLL  LLLLLLLLLLLLLP
   155   46 B E  E     -O  147   0E  44  739    4  EEEE    EE EEEEEEEEEEEEEEE   EEEREEEEEEEEEEE  EQEEEEEE  EEEEEEEEEEEEEE
   156   47 B W  E     +O  146   0E  15  739   11  WWYW    WW WWHWWWWWWWWWWWY   WWWWWWWWWWWWWWW  WLWFWWWW  WWWWWWWWWWWWWW
   157   48 B V  E     -     0   0E   0  739   28  LIIV    MV IIMIILLILIVLIIM   IMMMMVIMIIIILLL  VVMVMMLV  ILIMMIIIIILLLL
   158   49 B A  E     -O  145   0E   0  740   36  AGGG    GG GGGGGGGGGGGGGGG   GGGGGGGGGGGGGGG  SAGAGGGG  GGGGGGGGGGGGGA
   159   50 B S  E     -OQ 144 168E   0  740   94  HRYD    CW VVYEEVVEVWWVEEY   SYYWYDNVMSEFAVV  HYGSRCGA  IFQFYEMFFVRRRQ
   160   51 B I  E     -OQ 143 167E   4  739   18  IIII    IV VIIIIIIVIIIIIII   LIIIIIIIIIIITII  IIIIIVII  LIIIIIIIINTTTI
   161   52 B N    >   -     0   0   47  740   85  WNSY    WD RSSNYWWLWDDWLYS   HSKNSNDNDYNSRWW  DDYSNNDA  KKYRNNDSSNYYYS
   162   53 B N  T 3  S+     0   0   65  740   86  WPYA    YP TTYPPAGPGPPGPSY   NFYTYPPPPYDHKSS  PTLSNNSG  SYPYYHPNNPYYYP
   163   54 B G  T 3  S-     0   0   65  740   68  DYRG    DS DYSNGGDGDEEDGGS   SDDEDYYSSSSLNNN  TVGGNDGS  SDGDDSSNNGRRRR
   164   55 B G  S <  S+     0   0   30  740   50  DNGG    GD GNGDSGGTGNNGSSG   GGGTGYYGDGGGGGG  GPNDGGGG  GGNGGGDGGSSSSG
   165   56 B G  S    S+     0   0   74  739   59  DGSS    NG SGSGDSSGSGGSGGS   SNNGSGGGSNITDRR  RtGGDnSG  SSSSSSSDDDkqkN
   166   57 B R        +     0   0  163  548   85  .V..    .E .N..S..G.DD.N..   ...ENGG.E......  ..N....S  ..D...E..Gyfy.
   167   58 B T  E     -Q  160   0E  62  724   48  KITK    TA TTTrTTTTTTTTTsT   DINPGTTsTNTTTII  n.T.T.TT  TNTNNTVPPTNTNT
   168   59 B Y  E     +Q  159   0E  53  723   87  YSNE    YN ASYnYNNKNEENHyY   YNSA.RSrRYNKNDD  qyN.YyGY  YGDNNNKFFDDDSY
   169   60 B Y        -     0   0   44  737    7  YYYY    YY IYYYNNYYYYYYHYY   YYYYYYYYLYYYYYY  YYYTYYYY  YYYYYYLYYYYYYY
   170   61 B P    >>  -     0   0   20  737   66  NNNS    SA ANNNNNHNHAAHNNN   NNNANSNSNNNNSNN  AAADSTNN  ANANNNNNNNAAAN
   171   62 B D  T 34 S+     0   0  148  739   65  PQPP    PQ DQPEESSESPPSEEP   PPPDPQQQQPPPPAA  EDQKPPPP  SPQPPPQPPEVVVQ
   172   63 B T  T 34 S+     0   0   90  739   62  SNSA    SK SKSKKAAKAKNAKKS   SSSDSKKKKSSSTAA  ASKSSSGA  WSESSSRSSKSSSA
   173   64 B V  T X> S+     0   0    1  740   43  LFLL    LF LFLFFLLFLFFLFFL   LLLFLFFFFLLLLFF  VVFYLLLL  ALFLLLLLLFMVVL
   174   65 B K  B 3< S+l  177   0C 142  739   35  KKKK    KQ KKKKKMIRIQQIKKK   KKKKKKKQKKKQKII  RQQAKKKK  KKQKKKKKKKKRKK
   175   66 B G  T 34 S+     0   0   74  739   36  SDSP    SG NGSNGSSGSGGSGGS   SNNGNDGGDSSSSSS  GGGDSSSS  SNGTNSDSSGSSSS
   176   67 B R  T <4 S+     0   0   36  739   21  QKRR    RR RKRKKRRKRKKRKKR   RRRRRKKRKRRRRRR  RRRARRRR  RRRRRRKRRKRRRR
   177   68 B F  E  <  -lM 174 192C   2  740   67  LAVL    TV VAIAALLALAALAAI   VIIFIAALAVVVLLL  FAVVTTLL  SVVIIVAFFAIIIL
   178   69 B T  E     - M   0 191C  79  740   38  TSTS    SS TTSTTSSTSTSSTIS   TSSASTTTTTTSSSS  TTTKSSSS  TSTSSTITTTTATS
   179   70 B I  E     + M   0 190C   5  740   22  ILMI    II IMILLIIFIMMIFLI   IIIFILLMLIIIIII  IIMIIIII  IIIIVILIILIIII
   180   71 B S  E     - M   0 189C  51  736   45  STST    ST TTTTTSSTSTTSTAT   STTSTTTTTSSSTTT  SSTSSSTT  .TTTTSTSSTNNNT
   181   72 B R  E     - M   0 188C  30  739   68  KVVR    RR KVRVAKKAKASKAVR   VRRLRVVRVVVQRKK  RRARRRRK  .RARRVVIIAPPPR
   182   73 B D  E > > - M   0 187C  60  738    5  DDDD    DD DDDDDDDDDDDDDDD   DDDEDDDDDDDDDDD  DNDDDDDD  .DDDDDDDDDDDDD
   183   74 B N  G > 5S+     0   0   48  739   59  TKKT    TM NKTKKNNTNTTNTKT   TTTTTKKTKTTTTNN  NNTNTTNT  TTKTTTKTTKTTTT
   184   75 B A  G 3 5S+     0   0   99  739   41  SSSS    SS GSSSSSSSSSSSSSS   SSSSSSSSSSSSSSS  TASTSSSS  RSSSSSSSSSSSSS
   185   76 B K  G < 5S-     0   0  111  740   54  RSKK    KR KSKSSKKSKSSKSSK   KKKAKSSTSKKKKKK  KQTNKKKK  TETKKKSKKSKKKK
   186   77 B N  T < 5 +     0   0   62  740   46  NSNS    NS KSNSNSSNSNNSNNN   NNNTNRSSSNNRSSS  DSSSNNSS  QNSNNNNNNSNNNS
   187   78 B T  E   < -KM 132 182C  16  740   68  QTQQ    QT QTQTTQQTQTTQTTQ   QQQTQTTTTQQQQQQ  QSTRQQQQ  NQTQQQTQQTQQQQ
   188   79 B L  E     -KM 131 181C   0  737   61  VAFV    FA VVYAAVVAVAAVAAY   FFFAFAAVAFFFVVV  LLALVFVV  TFAFFLAFFAFLFV
   189   80 B Y  E     -KM 130 180C  41  737   41  FYSS    SY YHYYYFFYFYYFYYY   SFFYFYYYYSSSSFF  YHYYSSSY  VFYFFSYTTYSSSS
   190   81 B L  E     -KM 129 179C   0  739    8  LMLL    LM LMLMMLLMLLLLMML   LLLLLMMMMLLLLFF  LLMLMLLL  NLVLLLMLLMLLLL
   191   82 B Q  E     -KM 128 178C  76  739   41  KENS    QE QEQQQKKQKRQKQHQ   RRKQKQQDQKKKSKK  VQEQQQSQ  LKERKKQRRRQQHS
   192   83 B M  E     +KM 127 177C   0  740   11  ILLL    LL MLLLLMLLLLLLLLL   LLLILLLLLLLLLMM  LMLMLLVL  MLLLMLFLLLLLLL
   193   84 B S        +     0   0   42  740   54  THTS    SS NANSSNNSNSSNSSN   SNNNNNKSSSSTSNN  DQSDSSST  BNNNNSSYYSNSNN
   194   85 B S  S    S-     0   0   68  739   23  SSSS    SS GRSSSSSSSSSSSGS   SSSNSSSSSSSSSSS  NNSSSSSS  SSSSSSGSSSSSSS
   195   86 B L        -     0   0    3  740   16  VLVV    LL MLVLLLLLLLLLLLV   VVVLVLLLPVVVVLL  LLLLVVVV  LVLVVVPVVLVVVV
   196   87 B K    >   -     0   0  102  740   70  DTTT    TR ETTTTQQTQTTQTTT   TTTKTTTRTTTTTQQ  QKRRITTN  TTRTTTTTTTTTTT
   197   88 B S  G >  S+     0   0   70  740   59  TSAT    SA VSSPSTTSTSSTSST   APTNTSSSSPAATDD  ALPVTTPP  ATATTASSSVPPPT
   198   89 B E  G 3  S+     0   0  126  740   21  AEAE    EE KEEEEDDEDKEDEEE   AEEEEEEDEAAAEDD  GEEEEEEE  ZEEEEAEAADEEEE
   199   90 B D  G <   +     0   0    2  740    3  DDDD    DD DDDEDDDDDDDDDDD   DDDDDDDDDDDDDDD  DDDDDDDD  DDDDDDDDDDDDDD
   200   91 B T    <   +     0   0   32  740   32  TSTT    TT TSTFSTTSTTTTSST   TTTTTSSTSTTTTTT  SSTITTTT  TTTTTTSTTSTTTT
   201   92 B A  E    S- R   0 223E   8  737    4  AAAA    AA AAAAAAAAAAAAAAA   AAAAAAAAAAAAAAA  GAAAAAAA  AAAAAAAAATAAAA
   202   93 B M  E     -PR 148 222E  58  739   46  TVVV    VV MNTVVMTVTVVTVVT   VTTTTVVVVVLMVII  RVVWVMTV  TTVTTVVKKVVVVV
   203   94 B Y  E     -PR 147 221E   0  739    1  YYYY    YY YLYYYYYYYYYYYYY   YYYYYYYYYYYYYYY  YYYYYYYY  YYYYYYYYYYYYYY
   204   95 B Y  E     -P  146   0E   7  740    4  YYYY    YY YYYYFYYYYYYYYFY   YFYFYYYFYYYYYYY  YYYIYYYY  FYYYYYYYYCYYYF
   205   96 B d  E     -P  145   0E   0  740    0  CCCC    CC CCCCCCCCCCCCCCC   CCCCCCCCCCCCCCC  CCCCCCCC  CCCCCCCCCCCCCC
   206   97 B V  E     -PS 144 217E   0  740   24  AAAA    AA TATAAAAAANNAATA   AVAATAAAAAAAVAA  VCVSATAA  AAAAAATAAVAVAV
   207   98 B R  E     -PS 143 216E  21  739   39  Rrrr    rr srSrsrkrkagkprr   rrrGRrvrrrrrgrr  rirtrrkk  rgrvrrrrrrsrsr
   208   99 B H  E     + S   0 214E   6  629   94  Rtyf    ge ty.dylypytlykfi   mee.Gesksdsaayy  lnvhlwrf  tdtmyaekkhrgpa
   209  100 B E  E  >  + S   0 213E  63  676   73  GVTG    KA AG.GESYTYTARGGT   GEE.DGPGSHGDLDD  DGESTGGR  HHTDESVAADGNGT
   210  101 B Y  T >4 S-     0   0   80  702   91  GDRD    SS GN.YGSDGDSWGANY   AYY.GCAFLTANVSS  PKNTSIRN  GLLYDYSAAYYSTG
   211  102 B Y  T 34 S-     0   0  140  709   44  KFYY    YY YY.YYYyFyWFYYYY   FYYyYFWyYFYWYLL  CWWYWYHy  yYFYYyWYYYYWyI
   212  103 B Y  T 34 S+     0   0   39  264   90  G.G.    .. ..LD..a.a..W...   .YDyH..y.....TT  .......g  g...Yy....Y.y.
   213  104 B A  E <<  -S  209   0E   0  447   85  A.R.    .. ..RW..P.P..Y...   .AVDF..GY.Y.EWW  .A.L.S.L  LY.AAY...TG.S.
   214  105 B M  E     +S  208   0E   0  580   59  M.F.    .. FFFFF.L.LF.FFLF   .TMGF.FMF.PFVFF  LK.A.L.V  MF.MMMFFFVMLM.
   215  106 B D  E     +     0   0E  19  696   48  DDDD    P. EDAVD.CGCAIDDDD   DDDATAADDDYGETT  SLGP.M.P  DDDDDDADDDDDDD
   216  107 B Y  E     -S  207   0E  99  702   57  YYYY    F. HYYYV.YDYYYVYYY   FYYYYYYVYYYPYYY  HFPE.I.L  VYVYYVYSSYVYVY
   217  108 B W  E     -S  206   0E  23  731    0  WWWW    WW WWWWWWWWWWWWWWW   WWWWWWWWWWWWWWW  WFWWWWWW  WWWWWWWWWWWWWW
   218  109 B G        -     0   0    0  714   13  GGGG    TG GGGGGGGGGGGGGGG   GGGGGGGGGGGGGGG  GGSGGSAG  GGGGG GGGGGGGG
   219  110 B Q        -     0   0   91  701   38  QQQP     K QQQQAQQQQQQAQQQ   HQQQQQQQQQQQPQQ  QKREQEVP  PQPQQ QQQQQQQP
   220  111 B G        -     0   0   16  687   10  GGGG     G GGGGGGGGGGGGGGG   GGGGGGGGGGGGGGG  EGGS  GA  GGGGG GGGGGGGG
   221  112 B T  E     -R  203   0E  21  675   26  TTTL     Q TTTTTTTTTTTTTTT   TATTTTTTTTNTLTT   TTY   C  TTTTT TATTTTTL
   222  113 B T  E     -R  202   0E  72  661   75  STLL     E MTLLTLTLTLLTSTT   M  LLLLTTLLLLLL   QSS   I  LTL   LLLTTLTL
   223  114 B V  E     -R  201   0E   0  654   18  VVVV     V VLVVVVLVLVVVLLL   V  VVVVVLV VVVV   ICL   V  VLV   VVVVVVVI
   224  115 B T  E     -n  120   0D  36  643   13  TTTT     A TTTTTTTTTTTTTAT   T  TTTTTTT TTTT   TVM      TTT   TTTTTTTT
   225  116 B V  E     +n  121   0D   6  626    6  VVVV     V VVVFVVVVVVVVVVV   V  VVVVVVV VVVV   VII      VVV   VVVVVVVV
   226  117 B S        -     0   0   36  616    5  SSSS       TSSSSSSSSSSSSSS   S  SSSSSSS SSSS   SSP      SSS   SSSSSSSS
   227  118 B S  S    S+     0   0   84  597   20  SSSS       SSAASASASAASSSS   S  AAA SSS SSAA   P         SS   ASSSSSSS
   228  119 B A  S    S+     0   0   70   97   58                               G      H G                   V       GGG 
   229  120 B W        -     0   0  123   87   40                               S      P S                   D       SSS 
   230  121 B R        +     0   0  207   62   76                               A      R R                   P           
   231  122 B H              0   0  156   56   69                               S      P S                   N           
   232  123 B P              0   0  155   28   53                               A      A A                   S           
## ALIGNMENTS 1121 - 1190
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    1 A D              0   0  183  423   16            DE                      D     D               D D      DD   
     2    2 A I        -     0   0   32  466   12            IK                      I     I               I V      VV   
     3    3 A E        -     0   0  117  468   68       V    VL                      V     V               V L      VV   
     4    4 A L  E     -A   25   0A  10  482    7       L    ML                      M     M               M M      MM   
     5    5 A T  E     -A   24   0A  64  482    8       T    TT                      T     T               T T      TT   
     6    6 A Q  E     -A   23   0A  13  482    0       Q    QQ                      Q     Q               Q Q      QQ   
     7    7 A T  E    S+A   22   0A  64  482   35       S    TT                      T     A               T T      TT   
     8    8 A P        -     0   0   46  485    9       P    PP                      P     P               P P      PP   
     9    9 A V  S    S+     0   0   96  489   67       T    LG                      L     L               L H      LL   
    10   10 A S  E     -d  104   0B  60  491   42       S    SA                      S     S               S S      SS   
    11   11 A L  E     -d  105   0B  58  494   23       V    LQ                      L     V               L L      LL   
    12   12 A S  E     +d  106   0B  60  495   42       S    PS                      P     S               P S      PP   
    13   13 A A  E     -d  107   0B   0  495   58       V    VV                      V     V               V V      VV   
    14   14 A S    >   -     0   0   47  496   31       S    NV                      T     T               T S      TT   
    15   15 A V  T 3  S+     0   0   76  496   66       P    PQ                      L     P               P P      PP   
    16   16 A G  T 3  S+     0   0   42  496    5       G    GG                      G     G               G G      GG   
    17   17 A E    <   -     0   0   71  496   36       E    QQ                      E     E               Q E      EE   
    18   18 A T        -     0   0   69  496   62       R    LT                      P     S               P P      PP   
    19   19 A V  E     - B   0  75A  11  496   36       V    AV                      A     A               A A      AA   
    20   20 A T  E     - B   0  74A  67  495   29       T    SS                      T     S               S T      SS   
    21   21 A I  E     - B   0  73A   1  494   17       I    II                      I     I               I I      II   
    22   22 A T  E     -AB   7  72A  29  494   59       S    SR                      S     S               S S      SS   
    23   23 A b  E     -AB   6  71A   0  495    1       C    CC                      C     C               C C      CC   
    24   24 A R  E     -AB   5  70A 110  495   47       Q    RK                      K     R               K R      RR   
    25   25 A A  E     -A    4   0A  10  495   28       A    SA                      S     S               S S      AA   
    26   26 A S  S    S+     0   0   66  495    4       S    SS                      S     S               S S      SS   
    27   27 A E  S    S-     0   0  101  495   38       Q    QS                      E     K               Q Q      QQ   
    28   28 A N        +     0   0   83  495   45       S    SS                      S     S               S S      SS   
    29   29 A I    >   -     0   0    5  496   32       V    LV                      L     L               L L      LL   
    30   30 A Y  T 3   -     0   0  155  496   81       k    lG                      v     l               l l      ll   
    31   31 A S  T 3  S+     0   0   53  471   64       d    tT                      t     t               t t      tt   
    32   32 A Y    <   +     0   0   63  495   53       P    YC                      Y     S               Y Y      YY   
    33   33 A L  E     -E   90   0B   0  495    7       L    LL                      L     L               L F      LL   
    34   34 A A  E     -E   89   0B   0  495   71       S    HN                      S     Y               Y N      NN   
    35   35 A W  E     -EF  88  48B   1  496    0       W    WW                      W     W               W W      WW   
    36   36 A Y  E     -EF  87  46B   0  496    8       Y    YY                      Y     Y               Y L      YY   
    37   37 A Q  E     -EF  86  45B   7  496   27       Q    LL                      Q     L               L V      LL   
    38   38 A Q  E     -E   85   0B  21  496    4       H    QQ                      Q     Q               Q Q      QQ   
    39   39 A K    >   -     0   0   51  495    8       K    KK                      K     R               K K      KK   
    40   40 A Q  T 3  S+     0   0  190  496   18       P    PN                      P     P               P P      PP   
    41   41 A G  T 3  S+     0   0   86  496   10       G    GG                      G     G               G G      GG   
    42   42 A K  S <  S-     0   0  126  495   54       Q    KE                      Q     K               Q Q      QQ   
    43   43 A S        -     0   0   21  495   56       A    SS                      P     S               S V      SS   
    44   44 A P        -     0   0    4  495   10       P    PP                      P     P               P P      PP   
    45   45 A Q  E     -F   37   0B  74  495   32       R    QK                      R     Q               Q S      RR   
    46   46 A F  E     +F   36   0B  25  495   41       L    LL                      L     L               L L      RR   
    47   47 A L  E     +     0   0B   4  495    9       L    LL                      L     L               L I      LL   
    48   48 A V  E     -FG  35  54B   0  496    5       I    II                      I     I               I I      II   
    49   49 A Y  E >> S+ G   0  53B  39  496   17       S    YY                      Y     Y               Y Y      YY   
    50   50 A N  T 34 S-     0   0   52  496   91       W    RS                      E     R               E E      KK   
    51   51 A A  T 34 S+     0   0    3  496   44       A    VA                      V     M               V V      VV   
    52   52 A K  T <4 S+     0   0  148  496   25       T    ST                      S     S               S S      SS   
    53   53 A T  E  <  -G   49   0B  47  496   68       N    SN                      N     N               N K      NN   
    54   54 A L  E     -G   48   0B  60  496   59       L    HR                      R     L               R R      RR   
    55   55 A G    >   -     0   0    9  495   70       A    FQ                      L     A               A D      DD   
    56   56 A E  T 3  S+     0   0  192  495   35       S    SS                      S     S               S S      SS   
    57   57 A G  T 3  S+     0   0   70  496    5       G    GG                      G     G               G W      GG   
    58   58 A V    <   -     0   0   25  494   10       V    VV                      V     V               V V      VV   
    59   59 A P    >   -     0   0   47  495    7       P    PS                      P     P               P S      PP   
    60   60 A S  T 3  S+     0   0  115  496   56       A    DS                      D     D               D D      DD   
    61   61 A R  T 3  S+     0   0   44  496    4       R    RH                      R     R               R R      RR   
    62   62 A F  E <   +C   75   0A   5  496    1       F    FF                      F     F               F F      FF   
    63   63 A S  E     -C   74   0A  55  495   23       S    SS                      V     S               S S      SS   
    64   64 A G  E     +C   73   0A  13  496    2       G    GG                      G     G               G G      GG   
    65   65 A S  E     +C   72   0A  63  496    6       S    SS                      S     S               S S      SS   
    66   66 A G  E     -C   71   0A  36  496   14       R    GG                      G     G               G G      GG   
    67   67 A S  E >   +C   70   0A  79  496    9       S    SS                      S     S               S S      SS   
    68   68 A G  T 3  S-     0   0   16  496   12       G    GG                      G     E               G W      GG   
    69   69 A T  T 3  S+     0   0   67  495   13       T    ST                      T     T               T T      TT   
    70   70 A Q  E <   +BC  24  67A 110  496   29       D    DD                      D     D               D D      DD   
    71   71 A F  E     -BC  23  66A   2  494    5       F    FF                      F     F               F F      FF   
    72   72 A S  E     -BC  22  65A  26  495   30       T    TT                      T     T               T T      TT   
    73   73 A L  E     -BC  21  64A   0  496    2       L    LL                      L     L               L L      LL   
    74   74 A K  E     -BC  20  63A  97  496   38       S    KT                      K     K               K K      RR   
    75   75 A I  E     -BC  19  62A   0  496    1       I    IL                      I     I               I I      II   
    76   76 A N  S    S-     0   0   86  496   29       S    SS                      S     S               S S      SS   
    77   77 A S  S    S-     0   0   58  496   62       S    WG                      R     K               R R      RR   
    78   78 A L        -     0   0    0  496   27       M    VI                      V     V               V V      VV   
    79   79 A L    >   -     0   0   67  496   31       K    EE                      E     E               E E      EE   
    80   80 A P  G >  S+     0   0   92  496   59       P    AP                      A     T               A A      AA   
    81   81 A E  G 3  S+     0   0  102  496   15       E    EE                      D     E               E E      DD   
    82   82 A D  G <  S+     0   0    1  496    5       D    DH                      D     D               D D      DD   
    83   83 A F    <   +     0   0   29  495   73       A    VA                      V     V               V A      VV   
    84   84 A G  E    S- H   0 105B  17  496   23       A    GG                      A     G               R G      GG   
    85   85 A S  E     -EH  38 104B  24  496   62       V    VV                      V     V               V V      VV   
    86   86 A Y  E     -EH  37 103B   0  496    0       Y    YY                      Y     Y               Y Y      YY   
    87   87 A Y  E     -E   36   0B   5  495    4       Y    YY                      Y     Y               Y Y      YY   
    88   88 A b  E     -E   35   0B   0  496    0       C    CC                      C     C               C C      CC   
    89   89 A Q  E     -EI  34  99B   0  494   48       Q    MQ                      M     G               M Q      LQ   
    90   90 A H  E     -E   33   0B  22  486   28       Q    QQ                      Q     H               Q Q      QQ   
    91   91 A H        +     0   0    0  423   89       G    AC                      D     R               G G      GG   
    92   92 A Y  S    S+     0   0  104  454   87       Y    TN                      T     S               I T      TT   
    93   93 A G  S    S-     0   0   34  421   71       K    QS                      K     R               Q H      KH   
    94   94 A T  S    S-     0   0  104  444   88       E    FL                      V     I               L V      YA   
    95   95 A P  S    S+     0   0    7  441   51       P    PP                      P     S               P P      PP   
    96   96 A P  S    S-     0   0   55  420   76       P    NF                      P     s               P P      TR   
    97   97 A L        -     0   0   21  151   88            ..                      .     t               . .      ..   
    98   98 A T        -     0   0   40  278   41            ..                      .     A               . .      ..   
    99   99 A F  B     -I   89   0B  18  277   26            ..                      .     L               . .      ..   
   100  100 A G        -     0   0    3  285   38            .T                      .     N               . .      ..   
   101  101 A G        -     0   0   52  300   63            .H                      .     K               . .      ..   
   102  102 A G        -     0   0   11  300   41            .Q                      .     N               . .      ..   
   103  103 A T  E     - H   0  86B   0  360   19            TT                      T     T               T T      TT   
   104  104 A K  E     -dH  10  85B  98  359   60            VK                      V     M               V V      VV   
   105  105 A L  E     -dH  11  84B   4  343   39            VL                      V     L               V L      VV   
   106  106 A E  E     -d   12   0B 108  326   52            QK                      Q     E               Q Q      QQ   
   107  107 A I  E      d   13   0B 113  295   51             L                            V               T P      PP   
   108  108 A K              0   0  145  261   18             N                                            N R      RR   
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30  QQQQQ QQQQ      QQ   QQQQQQQQQ  QD QQ    QQ      QQQEQQQ Q QQ      Q  
   111    2 B V        +     0   0   19  428   12  VVVVL VVVV      VV   VVVVVVVIL  VV VV    IV      VVVVVVV V VV   V  V  
   112    3 B K  E     -J  134   0C 111  430   32  RQRRQ QQQQ      QQ   QRRRRRRTQ  QQ QT    TH      KKKQQQQ Q QT   Q  Q  
   113    4 B L  E     -J  133   0C   3  452    1  LLLLL LLLL      LLM  LLLLLLLLLLLLL LL    LL      LLLLLLL L LL L L  L  
   114    5 B Q  E     -J  132   0C  83  454   70  QQQQQ QQQR      QQL  QQQQQQQEQVQVQ QT    KQ      LLLVQQR K MR V Q  Q  
   115    6 B E  E     +J  131   0C   5  458   22  EEEEE EEEE      QQE  EEEEEEEEEEEQE EE    EQ      EEEQEEE E QEEE E  Q  
   116    7 B S  E     +J  130   0C  69  463   14  SSSSS SSSS      SSS  SSSSSSSSSSSSS SS    SS      SSSSSSS S SSSF S  S  
   117    8 B G        +     0   0   36  467    4  GGGGG GGGG      GGG  GGGGGGGGGGGGG GG    GG      GGGGGGG G GGEG G  G  
   118    9 B G        +     0   0   29  718   50  PPPPP PPPP  PPAATPPPPPPPPPPPPPGPAP PPPPP PPPPPPPPPPPAPPP P APGGPS  PP 
   119   10 B D        -     0   0   96  725   42  SSNSG GGGS  EEEEVGGGGSSSSSSSGGAGEG GASGG TEGGGGGGGGGEGGS G EAGAGK  GGG
   120   11 B L  E     +n  224   0D  79  727   14  LLLLL LLLL  LLLLLLLLLLLLLLLLILVTVL LLLLL LLLLLLLLLLLVLLL V VLLELV  LLL
   121   12 B V  E     -n  225   0D  16  729   31  VVVVV VVVV  EVMVAVVVVVVVVVVVLVKVRV VVVVV VVVVVVVVVVVKVVV V KVFKVV  VVV
   122   13 B Q    >   -     0   0  114  730   53  KKKKK KKKK  KKKKRKKKEKKKKKKKQKPRKK KKKKK KKKKKKKKKKKRKKK K KRKKKQ  KKK
   123   14 B P  T 3  S+     0   0   66  730    7  PPPSP PPPP  PPPPPPPPPPPPPPPPPPAPPP PPPPP PPPPPPPPPPPPPPP P PPPAPP  PPP
   124   15 B G  T 3  S+     0   0   58  734   31  SSSSS STSS  GGGGGSSSSSSSSSYSSSGSGS SKSSS TGSSSSSSSSSGSSS S GTMGSS  SSS
   125   16 B G    <   -     0   0   25  736   63  QQQQE QQQQ  AAAATQQQQQQQQQQQQEEEAK EQQQQ QPQQQQQQEEEEQQQ Q SQDDQQ  EQQ
   126   17 B S        +     0   0   78  735   29  TTTTT TTTT  SSSSSTTTTTTTTTTTTTSSST TPTST TSTTTTTTTTTSTTT T STTSST  TTT
   127   18 B L  E     - K   0 192C  25  737   28  LLLLL LLLL  VVVVVLVLLLLLLLLLLLLLVL LLLLV LVLLLLLLLLLLLLL L VLLLLL  LLL
   128   19 B K  E     - K   0 191C  93  735   55  SSSSP SSSS  KKKKKSSSSSSSSSSSSSHRKS STSSS TKSXSSXSSSSKSSS S RTTRSS  SSS
   129   20 B L  E     - K   0 190C   0  740   16  VLLLL LLLL  IIILMLLLLLLLLLLLLLLLVL LLLLL LMLLLLLLLLLILLL L VLLLLL  LLL
   130   21 B S  E     -JK 116 189C  28  740   37  TTTTT TTTT  SSSSSTSTTTTTTTTTTTSTST TTTTT TSTTTTTTNNTSTTT T STTFTT  TTT
   131   22 B d  E     -JK 115 188C   0  740    0  CCCCC CCCC  CCCCCCCCCCCCCCCCCCCCCC CCCCC CCCCCCCCCCCCCCC C CCCCCC  CCC
   132   23 B A  E     -JK 114 187C  52  740   67  TTTTA TSST  KKKKKATAATTTTTATSATTKT ATSST TKAAAAAATTTKSTT A KTTKTA  TAA
   133   24 B A  E     +J  113   0C   8  740   48  VVVVV VVVV  AAAATIVIIVVVVVVVFVAVAV VFVVV FAIIIIIIVVVTVVV F TFVAVI  VII
   134   25 B S  E     +J  112   0C  58  740   14  SSSSS SSSS  SSTSSSSSSSSSSSSSSSSSSS SSTTT SSSSSSSSSSSSSSS S SSSSTS  SSS
   135   26 B G  S    S+     0   0   56  739    3  GGGGG GGGG  GGGGDGGGGGGGEGGGGGSGGG GGGGG GGGGGGGGGGGGGGG G GGGGGG  GGG
   136   27 B F  S    S-     0   0   33  740   31  FFFFA FYYF  YYYYYDADDFFFFFFFFGFFYF YFDYI FYDGDDDDRRAYFFF F GFFFYD  GDD
   137   28 B T    >   -     0   0   93  740   53  SSSSS SSSS  SSTTTSSSSSSSSSPSSSIETS SSSSS STSSSSSSSSSSSSS S TSSNSS  SSS
   138   29 B F  G >  S+     0   0    2  740   28  LLLLI IIIL  FFFFFVIVVLLLLLLLLIFLFI ILIII LFVVVVVVIIIFILL L FLLFIV  IVV
   139   30 B S  G 3  S+     0   0   57  740   55  TSTTS TTTS  TTSTTSNSSATTTTSTSSGTTT SSTTT TTSSSSSSTTRTTTS T VSSGTS  SSS
   140   31 B S  G <  S+     0   0   71  740   57  NSSSS tttS  GGTENstssSSSTSNVsNNSSt stSmt tDssssssnnSStSS S DgSSss  ssn
   141   32 B Y  S <  S-     0   0   44  738   42  YDKNN yyyN  YYYYCayaaNNYYNYNmNSYYc ymGyy mYaaagaayyYYyYN Y YmYSya  yaa
   142   33 B T        -     0   0   30  739   92  AAAAY DYYG  NYWIWAYGADAGGAGASHEHYC YRYYR DVAAAAAAYYYWYPG V KCGGAT  YAT
   143   34 B M  E     -OP 160 207E   0  739   49  AVVVW WWWV  MMIIIWWWWIVVVVVVVWMMMW WVWWW VVWWWWWWWWWIWVV V GVVMWW  WWW
   144   35 B S  E     -OP 159 206E   0  740   72  GNDGS TSSG  NHEHHNSNNTHAGDEGGSAHHT GSNNS GSNNNNNNAATSSHV S LANSND  GNN
   145   36 B W  E     +OP 158 205E   0  740    0  WWWWW WWWW  WWWWWWWWWWWWWWWWWWWWWW WWWWW WWWWWWWWWWWWWWW W WWWWWW  WWW
   146   37 B V  E     -OP 156 204E   0  740   17  VVVVI IIIV  VVVVIIIVIVVVVVVVIIYIVI IIIII IMIIIIIIFFLVIMV V VIVMIv  III
   147   38 B R  E     -OP 155 203E  10  740   21  RRRRR RRRR  KKIKKRRRRRRRRRRRRRRRRR RRRRR RQRRRRRRRRRRRRR R RRRRRq  RRR
   148   39 B Q  E     -OP 154 202E   9  740    4  QQQQQ QQQQ  QQQQQQQQQQQQQQQQQQQQQQ QRKQQ QQQQQQQQQQQQQQQ Q QQQQQL  QQQ
   149   40 B T    >   -     0   0    9  739   74  AAAAA TPPA  SSRRRSHSSAAAAAAAPPAPAP PPFFF PRSSSSSSPPTMPAA A APAAFR  SSS
   150   41 B P  T 3  S+     0   0   80  740   11  PPPPP PPPP  NHPSPPPPPPPPPPPPSPPPPP PPPPP PTPPPPPPPPPPPPP P PPPPPS  PPP
   151   42 B E  T 3  S-     0   0  151  740   29  GGGGG GGGG  GVGGGSGSSGGGGGGGGGGGGG GGGGG GGSSSSSSGGGGGGG G GGGGGF  GSS
   152   43 B K    <   +     0   0  121  740   37  KKKKK KKKK  KKHQQRRRRRKKKKKKKKRKQK KKNNN KQRRGRRRKKKKKKK K KEKKNS  KRR
   153   44 B R        -     0   0  113  739   42  AAVAG GGGA  SSGGGGGGGAVAAVAVGGEGGG GAKKK AVGGGGGDGGGGGGA G GAGGKG  GGG
   154   45 B L  E     -O  148   0E   9  740   13  LLPPL LLLL  LLLLLLLLLLPLLPLPLLPLLL LLLLL LLLLLLLLLLLLLLL L LLLLLV  LLL
   155   46 B E  E     -O  147   0E  44  739    4  EEEEE EEEE  EEEEEEEEEEEEEEEEEEEEEE EEEEE EEEEEEEEEEEEEEE E EEEEEG  EEE
   156   47 B W  E     +O  146   0E  15  739   11  WWWWW WWWW  WWWWWWWWWWWWWWWWWWWWWW YWYWW WWWWWWWWWWWWWWW W WWWWWI  WWW
   157   48 B V  E     -     0   0E   0  739   28  LVLVI MIIV  IIIIILILLILLLLVLLIVIMM ILMMI LILLLLLLIIIMMVL V VLIVMI  ILL
   158   49 B A  E     -O  145   0E   0  740   36  GGGAG GGGG  GGGGGGGGGTGGSGGGAGSGGG GAGGG AGGGGGGGGGGGGGG G GAGAGG  GGG
   159   50 B S  E     -OQ 144 168E   0  740   94  GQGGR CYYG  NREWARFRRCGGYGESHLHVRC YRYSY LERRRRRRSSFTRVG A QWYHYE  SRR
   160   51 B I  E     -OQ 143 167E   4  739   18  IIIII IIII  IIIFITITTLIIIVIIIIIAVI IIIII IITTTTTTIIVIIVI I IDILII  LTX
   161   52 B N    >   -     0   0   47  740   85  HDSHY NSSD  DNFYSYSYYAAWYSKSWSDYDG SBNSY YYYYYYYYHHYDSWC A PIGYSN  YYY
   162   53 B N  T 3  S+     0   0   65  740   86  TNGNG NSSN  PPPPLYNYYRTRNSDTWGPAPY GBYYY WPYYYYYYHHDPSGS G LLTWYP  YYY
   163   54 B G  T 3  S-     0   0   65  740   68  NGRSS NSSD  YYGGGRNRRDGDNDIDNSFGSD SBSDS DGRRRRRRTTGSGGG S RNGDSD  SRR
   164   55 B G  S <  S+     0   0   30  740   50  GGGGG GGGG  YNSSNSGSSGGGGGGGDGQGDG SDGGG DSSSSSSSGGGDGGG G FDTRGG  GSS
   165   56 B G  S    S+     0   0   74  739   59  gISSG NSSD  GGGGSkDrkRSKDSTSDGRGGN GKSsT DGkkkkkkPPRSSSS G NDYwSS  skt
   166   57 B R        +     0   0  163  548   85  ....S ....  GA.SGy.yl.....A..SN.N. S...I ..yyyyyy...D... S G..r..  syy
   167   58 B T  E     -Q  160   0E  62  724   48  .TTIT TTTT  TTsIANPNNTTTTTETKTPATI TFT.T KsNNHHNNTTTTTIT T EK.ATt  gIN
   168   59 B Y  E     +Q  159   0E  53  723   87  nNYGD YYYY  SSnKWDFDDWFNDY.SYDRDNY YYYn. RyDDEDDDYYKRYYS Y VY.SSy  yDD
   169   60 B Y        -     0   0   44  737    7  LYYYY YYYY  YYYYYYYYYYYYYYYYYYYIYY YWYYY YYYYYYYYEEYYYYF Y KYLYYY  YYY
   170   61 B P    >>  -     0   0   20  737   66  NNNNN SSSN  NNNNNRNAANKDNNNNNNSAAT NSNNN SNAAAAAANNNSSNN N NGAANA  AAA
   171   62 B D  T 34 S+     0   0  148  739   65  PASPP PPPP  QQEEQVPVTPPPAPPPPPEDQP PTPPP PEVVVPVVPPPPPPP P PANDPN  PVV
   172   63 B T  T 34 S+     0   0   90  739   62  AAAAS SSSA  KNKKKSSSFAAAAAAAASASKS SSSSS SKSSSFSSPPSSSTA A GSWRSA  SSS
   173   64 B V  T X> S+     0   0    1  740   43  LLLLL LLLL  FFFFFVLVVLLFLLLLLLVLFL LLLLL LFVVVVVVLLLFLLL L SLAVLV  LVV
   174   65 B K  B 3< S+l  177   0C 142  739   35  KKKKK KKKK  KKKKKKKKKKMQKKKKKKRKQK KRKKT KKKKKKKKKKRQKKK K VEKKKK  RKR
   175   66 B G  T 34 S+     0   0   74  739   36  SSSSS SSSS  GDGDDSSSSSSSSSSSSSGNGS STSNS SGSSSSSSSSSGSSS S VTSGSG  SSS
   176   67 B R  T <4 S+     0   0   36  739   21  RRRRR RRRR  KKKKKRRRRRRRRRRRRRRRRR RRRRR RKRRRRRRRRRQRRR R RRRRRR  RRR
   177   68 B F  E  <  -lM 174 192C   2  740   67  LLLLV TTTL  AAAAAIFIILLLLRLLLVFVVT VLIIT LAIIIVIIVVVVTLL L VLSFIF  VII
   178   69 B T  E     - M   0 191C  79  740   38  SSSST SSSS  TSTTKTTTTSSSSSTSTTSTSS TSSST TITITTTTTTSTSSS S SATTST  ITT
   179   70 B I  E     + M   0 190C   5  740   22  IIIII IIII  LLFLLIIIIIIIIIIIVIIIII IIIII ILIIIIIIMMIIIII I VVITII  III
   180   71 B S  E     - M   0 189C  51  736   45  TTTTS SSST  TTTTTNSNNTTTTTSTSSSTTS SSTTT TTNXYNXNSSSSSTT T SSTSTS  SNN
   181   72 B R  E     - M   0 188C  30  739   68  RRRRI RRRK  VVAAAPIPPRRRRRRRKTRKGR KKRRR KAPPPPPPVILARRK K LKSRRR  VSP
   182   73 B D  E > > - M   0 187C  60  738    5  DDDDD DDDD  DDDDVDDDDDDDDDEDDDDDDD DNDDD DDDDDDDDDDDDDDD D KDNEDD  DDD
   183   74 B N  G > 5S+     0   0   48  739   59  TTTTT TTTN  KKTKTTTTTTSTTATTSTNNTT TDTTT TKTTITTTTTTKTTN T PTTPTN  TTT
   184   75 B A  G 3 5S+     0   0   99  739   41  SSSSS SSSS  SSSSSSSSSSSSSSSSSSAGSS SSSSS SSSSPSSSSSVSSSS S SSNSSA  SSS
   185   76 B K  G < 5S-     0   0  111  740   54  KKEKK KKKK  SSSSTKKKKKKKKKKKDKKKTK KKKKK KSKKKKKKKKKIKKK K FKEEKK  KKK
   186   77 B N  T < 5 +     0   0   62  740   46  SSSSN NNNS  SSNSNNNNNSSSSSSSNNGKSN NNNNN NSNNNNNNNNKNNSS S NNNSNN  NNN
   187   78 B T  E   < -KM 132 182C  16  740   68  QQQQQ QQQQ  TTTTTQQQQQQQQQQQQQQQTQ QQQQQ QTQQQQQQQQQTQQQ Q QQTLQT  QQQ
   188   79 B L  E     -KM 131 181C   0  737   61  VVLVF FFFV  AAAVAFFFFVVVVVVVVFLVAF FVYFF VAFFFFFFVVVAFVV V AVVLFL  LFF
   189   80 B Y  E     -KM 130 180C  41  737   41  SSSSS TSSS  YYYYYSTSSSSSSSSSFSYYYS SVYFF DYSSSTSSSSSYSYS Y HVTYFY  SSS
   190   81 B L  E     -KM 129 179C   0  739    8  LLLLL LLLL  MMMMMLLLLLLLLLLLLLLLML LLLLL LMLLLMLLLLLLLLL L MLLLLL  LLL
   191   82 B Q  E     -KM 128 178C  76  739   41  SSSSK QQQS  QEHEEQRHQSSSSSSSKKQQEQ KIQKE TEQQQQQQRRNQQTS Q ESKPQQ  RQQ
   192   83 B M  E     +KM 127 177C   0  740   11  LLLLL LLLV  LLLLVLLLLLLLLLLLILMMLL LMLLM MFLLLLLLLLLWLLV L LMMMLM  LLL
   193   84 B S        +     0   0   42  740   54  SSSSS SSSS  KHDSSNYNSRSSSSSSASDNSS SINNN TSNNNQNNRRGSSNS T SNTTNN  SNN
   194   85 B S  S    S-     0   0   68  739   23  SSSSS SSSS  SSSRSSSSSSSSSSSSSSNGSS SNSSS FSSSSSSSSSSSSSS S STSGSS  SSS
   195   86 B L        -     0   0    3  740   16  VVVVV VVVV  LLLLLVVVVVVVVVVVVVLMLV VVVVL MLVVVVVVVVVLMLV V LVLLVL  VVV
   196   87 B K    >   -     0   0  102  740   70  ATTTT TTTT  TTTTTTTTTTTTTTTTVTQERT TNTTT DTTTTTTTTTTKTRT N FGTETR  TTI
   197   88 B S  G >  S+     0   0   70  740   59  STAAA TTTP  SSSSNPSPPTSTTTITTAVVAT APTTA PSPPPPPPAASATAP P SPGPTA  APP
   198   89 B E  G 3  S+     0   0  126  740   21  EEDEA EEEE  EEEGEEAEEEDDEEDEAAGKEE AVEEE WEEEEEEEKAASEEE E EGAEET  AEE
   199   90 B D  G <   +     0   0    2  740    3  DDDDD DDDD  DDDDDDDDDDDDDDDDDDDDDD DDDDD DDDDDDDDDDDDDDD D DDDDDD  DDD
   200   91 B T    <   +     0   0   32  740   32  TTTTT TTTT  SSSSSTTTTTTTTAATTTSTTT TTTTT TSTTTATTAAASTTT T TTTTTT  TTT
   201   92 B A  E    S- R   0 223E   8  737    4  AAAPA AAAA  AAAAAAAAAAAAAAAAAAGAAA AAAAA AAAAAAAAAAGAAAA A AAAGAA  AAA
   202   93 B M  E     -PR 148 222E  58  739   46  VVVMV VMMT  VVVVVVKLVVVVVVVVTVRMVL VTTTT TVVVVVVVVVVTVVT V VTTRTL  VVV
   203   94 B Y  E     -PR 147 221E   0  739    1  YYYYY YYYY  YYYYYYYYYYYYYYYYYYYYYY YYYYY YFYYYYYYYYYYYYY Y YYYYYY  YYY
   204   95 B Y  E     -P  146   0E   7  740    4  TWYYY FYYY  YYFFYYYYYYYYYYYYYYYYYY YYYYY YFYYYFFYYYYYYYY Y YYFHYY  YFY
   205   96 B d  E     -P  145   0E   0  740    0  CSCCC CCCC  CCCCCCCCCCCCCCCCYCCCCC CCCCC CCCCCCCCCCCCCCC C CCCCCC  CCC
   206   97 B V  E     -PS 144 217E   0  740   24  VAVAA AAAA  AAAATAAVAGATTAAAAAVAGV AAAAA AAAAAAAAAAAAAAA A AAGAAA  AAA
   207   98 B R  E     -PS 143 216E  21  739   39  rtrrr rrrk  rtrrRrrrrrrerrkrRrrrrR rrrrr hrKRTRSrrrrkrrr k rrsrr   srr
   208   99 B H  E     + S   0 214E   6  629   94  atgva ghyt  iygwElkllgvylcgvIttys. ratli dd.D...lvvfyggt f tgncr   gmg
   209  100 B E  E  >  + S   0 213E  63  676   73  DNSAF NTAG  PDRDDGAGXRNGGGPGPGTIQD GGDRL GGGLGDGSSSSDGPG P SSEGR   GGG
   210  101 B Y  T >4 S-     0   0   80  702   91  GGGCG FHAK  WLGYYQAAGSVKGSGDGEDFCT DYAHR YSGSNENACCPVASK T DQFGT   CGS
   211  102 B Y  T 34 S-     0   0  140  709   44  IHWIY YFRY  FFFFyFYYLwWFVIFNFYFYHV FyMYY YLVFYRYFyyYGVCY C YYFPW   YFY
   212  103 B Y  T 34 S+     0   0   39  264   90  ....H F.T.  ....q....s.......Y.... .y... ........nn..... . .....   A..
   213  104 B A  E <<  -S  209   0E   0  447   85  ....G S.P.  ....G..CVDDE....GG.S.R YY... .GERYGF.WWYG... L Y....   F.S
   214  105 B M  E     +S  208   0E   0  580   59  ..I.L FFL.  .F..F.FFVIII..IIFL.W.G IM.FF FFMFFMF.LLFL... V YFN.F   F.F
   215  106 B D  E     +     0   0E  19  696   48  DADDD SPT.  ADADPDDHEDEYDDEDDD.TRT NDDDD DAADDDDDDDHE... P YDAAA   QDH
   216  107 B Y  E     -S  207   0E  99  702   57  YYYYS AVI.  YYYYYYSYYYTSFYYYYS.FTL FVYYV YHVFSVSIPPHS... L YYIVY   HYY
   217  108 B W  E     -S  206   0E  23  731    0  WWWWW RWWR  WWWWWWWWWWWWWWWWWWWWWW WWWWW WWWWWWWWWWWWWWR W WWWWW   WWW
   218  109 B G        -     0   0    0  714   13  GSGGG R QG  GGGGGGGGGGGGGGGGGGSSSA AGGGG GGGGGGGGGGGGNAG G GGGGG   GGG
   219  110 B Q        -     0   0   91  701   38  PPPPQ P VP  QQQQQQQQQPPPRPPPQQ  QL KKQQA QQQQRQQQQQQQPQP P QQPPQ   QQQ
   220  111 B G        -     0   0   16  687   10  GGGGG S PQ  GGGGGGGGGGGGGGGGGG  GN  GGGG GGGGGGGGGGGGKGQ A GGGNG   GGG
   221  112 B T  E     -R  203   0E  21  675   26  VLLLV S LV  TTTTTTATTLLLLLLLTV  TA  TTTT TTTTTTTTTTTVDFV C TITRT   FTT
   222  113 B T  E     -R  202   0E  72  661   75  LLLLV L LD  LTLTTLLLLLLLLLLLTV   P  TSPT LLLMLTLMLLPVMPD I LLLVL   LLL
   223  114 B V  E     -R  201   0E   0  654   18  VVIVV L VL  VLVLVVVVVVVVVVVVLV   V  VVLV VVVVVVVVVVVVVLL V VVVVV   VAV
   224  115 B T  E     -n  120   0D  36  643   13  TTTTT S  S  TTTTTTTTTTTTTTTTTT   S  TTTT TSTTTTTTLIST KS   TTTIT   TTT
   225  116 B V  E     +n  121   0D   6  626    6  VVVVV V  V  VVVVVVVVVIVVVVVVVV   V  VVVV VVVVVVVVVVVV LV   VVVVV   VVV
   226  117 B S        -     0   0   36  616    5  SSSSS S  G  SSSSSSSSSSSSSSSSSS   A  SSSS SASSSSSSSSSS SG   SSSES   SSS
   227  118 B S  S    S+     0   0   84  597   20  SSSSS    S  ASASSSSSSSSSSSSSSS   S  SSSS SASSSSSSSSSS AS   SSSNA   SSS
   228  119 B A  S    S+     0   0   70   97   58      A              GG        A   A         GGGGGG   A      G        GG
   229  120 B W        -     0   0  123   87   40      S              SS        S   S         SSSSSS   S      S        SS
   230  121 B R        +     0   0  207   62   76      T                        T   P                  T                 
   231  122 B H              0   0  156   56   69      K                        K                      K                 
   232  123 B P              0   0  155   28   53      G                        G                      G                 
## ALIGNMENTS 1191 - 1234
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1    1 A D              0   0  183  423   16            D                                 
     2    2 A I        -     0   0   32  466   12            V                                 
     3    3 A E        -     0   0  117  468   68            V                                 
     4    4 A L  E     -A   25   0A  10  482    7            M                                L
     5    5 A T  E     -A   24   0A  64  482    8            T                                N
     6    6 A Q  E     -A   23   0A  13  482    0            Q                                Q
     7    7 A T  E    S+A   22   0A  64  482   35            T                                T
     8    8 A P        -     0   0   46  485    9          P P           P      P P           P
     9    9 A V  S    S+     0   0   96  489   67          G P           H      H S           I
    10   10 A S  E     -d  104   0B  60  491   42          A S           S      S S           S
    11   11 A L  E     -d  105   0B  58  494   23          V L           V      V V     V     D
    12   12 A S  E     +d  106   0B  60  495   42          S S           S S    S S     S     P
    13   13 A A  E     -d  107   0B   0  495   58          S V           E A    E G     G     V
    14   14 A S    >   -     0   0   47  496   31          A A           S S    S S     S     S
    15   15 A V  T 3  S+     0   0   76  496   66          V I           P L    P P     P     A
    16   16 A G  T 3  S+     0   0   42  496    5          G G           G G    G G     G     G
    17   17 A E    <   -     0   0   71  496   36          G Q           K A    K E     Q     E
    18   18 A T        -     0   0   69  496   62          S S           T S    T R     K     T
    19   19 A V  E     - B   0  75A  11  496   36          V V           I V    V V     V     S
    20   20 A T  E     - B   0  74A  67  495   29          N S           T K    T T     T     E
    21   21 A I  E     - B   0  73A   1  494   17          I I           I L    I I     I     L
    22   22 A T  E     -AB   7  72A  29  494   59          K S           S T    S S     S     K
    23   23 A b  E     -AB   6  71A   0  495    1          C C           C C    C C     C     C
    24   24 A R  E     -AB   5  70A 110  495   47          R K           T T    T T     T     A
    25   25 A A  E     -A    4   0A  10  495   28          T S           R L    R G     R     M
    26   26 A S  S    S+     0   0   66  495    4          S S           S S    S S     S     Q
    27   27 A E  S    S-     0   0  101  495   38          Q Q           S S    S S     S     N
    28   28 A N        +     0   0   83  495   45          D S           G G    D S     G     G
    29   29 A I    >   -     0   0    5  496   32          V L           S H    S N     N     K
    30   30 A Y  T 3   -     0   0  155  496   81          y v           i s    i i     i     m
    31   31 A S  T 3  S+     0   0   53  471   64          n t           n y    n y     y     y
    32   32 A Y    <   +     0   0   63  495   53          C Y           Y A    Y H     Y     Y
    33   33 A L  E     -E   90   0B   0  495    7          L L           V I    V V     V     M
    34   34 A A  E     -E   89   0B   0  495   71          A H           Q A    Q S     H     S
    35   35 A W  E     -EF  88  48B   1  496    0          W W           W W    W W     W     W
    36   36 A Y  E     -EF  87  46B   0  496    8          Y L           Y H    Y H     Y     Y
    37   37 A Q  E     -EF  86  45B   7  496   27          Q L           Q Q    Q Q     Q     R
    38   38 A Q  E     -E   85   0B  21  496    4          Q Q           Q Q    R Q     Q     Q
    39   39 A K    >   -     0   0   51  495    8          K S           R Q    R L     Q     R
    40   40 A Q  T 3  S+     0   0  190  496   18          D P           P P    P P     P     P
    41   41 A G  T 3  S+     0   0   86  496   10          G G           G E    G G     G     G
    42   42 A K  S <  S-     0   0  126  495   54          G R           S K    S K     R     E
    43   43 A S        -     0   0   21  495   56          V S           A G    A A     A     A
    44   44 A P        -     0   0    4  495   10          P P           P p    P P     P     P
    45   45 A Q  E     -F   37   0B  74  495   32          K K           T l    T K     T     .
    46   46 A F  E     +F   36   0B  25  495   41          R R           T M    T P     T     .
    47   47 A L  E     +     0   0B   4  495    9          L L           V K    V L     V     .
    48   48 A V  E     -FG  35  54B   0  496    5          I I           I L    I I     I     V
    49   49 A Y  E >> S+ G   0  53B  39  496   17          Y Y           Y N    F Y     Y     W
    50   50 A N  T 34 S-     0   0   52  496   91          W Q           E S    A E     N     V
    51   51 A A  T 34 S+     0   0    3  496   44          S V           D D    D S     D     L
    52   52 A K  T <4 S+     0   0  148  496   25          S S           N G    D S     N     A
    53   53 A T  E  <  -G   49   0B  47  496   68          T N           Q S    R K     Q     H
    54   54 A L  E     -G   48   0B  60  496   59          R L           R H    R R     R     S
    55   55 A G    >   -     0   0    9  495   70          D G           P S    P P     P     T
    56   56 A E  T 3  S+     0   0  192  495   35          S S           S K    S S     S     S
    57   57 A G  T 3  S+     0   0   70  496    5          G G           G g    G G     G     G
    58   58 A V    <   -     0   0   25  494   10          T V           V i    V I     V     .
    59   59 A P    >   -     0   0   47  495    7          S P           P P    P P     P     .
    60   60 A S  T 3  S+     0   0  115  496   56          A D           D D    D D     D     S
    61   61 A R  T 3  S+     0   0   44  496    4          R R           R R    R R     R     I
    62   62 A F  E <   +C   75   0A   5  496    1          F F           F F    F F     F     Y
    63   63 A S  E     -C   74   0A  55  495   23          T S           S S    S S     S     R
    64   64 A G  E     +C   73   0A  13  496    2          G G           g G    a g     g     g
    65   65 A S  E     +C   72   0A  63  496    6          S T           i S    i s     i     t
    66   66 A G  E     -C   71   0A  36  496   14          G G           D S    D G     D     S
    67   67 A S  E >   +C   70   0A  79  496    9          S S           S S    Y S     S     S
    68   68 A G  T 3  S-     0   0   16  496   12          N Q           S G    S S     S     N
    69   69 A T  T 3  S+     0   0   67  495   13          S K           S A    S A     S     S
    70   70 A Q  E <   +BC  24  67A 110  496   29          D D           n E    n S     n     H
    71   71 A F  E     -BC  23  66A   2  494    5          F F           a R    a .     a     .
    72   72 A S  E     -BC  22  65A  26  495   30          T T           S Y    S .     S     I
    73   73 A L  E     -BC  21  64A   0  496    2          L L           L L    L L     L     L
    74   74 A K  E     -BC  20  63A  97  496   38          T K           T T    T T     T     T
    75   75 A I  E     -BC  19  62A   0  496    1          I I           I I    I I     I     I
    76   76 A N  S    S-     0   0   86  496   29          S S           S S    S T     S     G
    77   77 A S  S    S-     0   0   58  496   62          G R           G S    G G     A     S
    78   78 A L        -     0   0    0  496   27          V V           L L    L L     L     L
    79   79 A L    >   -     0   0   67  496   31          Q E           K Q    R Q     Q     E
    80   80 A P  G >  S+     0   0   92  496   59          A A           T S    T A     A     P
    81   81 A E  G 3  S+     0   0  102  496   15          E E           E E    E E     E     G
    82   82 A D  G <  S+     0   0    1  496    5          D D           D D    D D     D     D
    83   83 A F    <   +     0   0   29  495   73          A L           E E    E E     E     S
    84   84 A G  E    S- H   0 105B  17  496   23          A G           A A    A A     A     A
    85   85 A S  E     -EH  38 104B  24  496   62          V V           D D    D D     D     V
    86   86 A Y  E     -EH  37 103B   0  496    0          Y Y           Y Y    Y Y     Y     Y
    87   87 A Y  E     -E   36   0B   5  495    4          Y Y           Y Y    Y Y     Y     Y
    88   88 A b  E     -E   35   0B   0  496    0          C C           C C    C C     C     C
    89   89 A Q  E     -EI  34  99B   0  494   48          Q A           Q Q    Q E     Q     A
    90   90 A H  E     -E   33   0B  22  486   28          G Q           S T    S S     S     A
    91   91 A H        +     0   0    0  423   89          Q T           Y L    Y Y     Y     W
    92   92 A Y  S    S+     0   0  104  454   87          H T           D G    D D     D     D
    93   93 A G  S    S-     0   0   34  421   71          Y H           S H    S S     N     S
    94   94 A T  S    S-     0   0  104  444   88          P F           N W    N S     S     S
    95   95 A P  S    S+     0   0    7  441   51          N P           N H    N I     D     A
    96   96 A P  S    S-     0   0   55  420   76          T P           Y V    L N     I     a
    97   97 A L        -     0   0   21  151   88          . .           A .    W .     .     f
    98   98 A T        -     0   0   40  278   41          . .           L V    V .     .     T
    99   99 A F  B     -I   89   0B  18  277   26          . .           F F    F .     .     F
   100  100 A G        -     0   0    3  285   38          S .           G G    G .     .     G
   101  101 A G        -     0   0   52  300   63          G .           G G    G G     .     P
   102  102 A G        -     0   0   11  300   41          G .           G G    G P     H     G
   103  103 A T  E     - H   0  86B   0  360   19          P T           T T    T T     T     T
   104  104 A K  E     -dH  10  85B  98  359   60          H M           Q H    K V     V     A
   105  105 A L  E     -dH  11  84B   4  343   39          L I           L L    L L     L     L
   106  106 A E  E     -d   12   0B 108  326   52          V Q           T      T Q     Q     S
   107  107 A I  E      d   13   0B 113  295   51          V             V      V       T     L
   108  108 A K              0   0  145  261   18          K                            K     R
   109      ! !              0   0    0   0     0  
   110    1 B E              0   0  194  375   30  QQE QQ Q      QQQQ  EQ D  Q     QQQ Q N QQQ 
   111    2 B V        +     0   0   19  428   12  VVV VVVV      VVVVL EV V  V     VVV V I LVI 
   112    3 B K  E     -J  134   0C 111  430   32  QRQ QQQQ      QQQTQ QT Q  T     QQQ Q V QQT 
   113    4 B L  E     -J  133   0C   3  452    1  LLLLLLLL      LLLLL LL L  L     LLL L L LLL 
   114    5 B Q  E     -J  132   0C  83  454   70  QQVQQQVE      QQKRQ VK Q  K     VKV V T LVK 
   115    6 B E  E     +J  131   0C   5  458   22  EGQEEEQQ      EEEEE EE E  E     QEQEQ Q EQE 
   116    7 B S  E     +J  130   0C  69  463   14  SSSSSSSS      SSSSS SS S SN     SSSSS P SSS 
   117    8 B G        +     0   0   36  467    4  GGGGGGGG      GGGGG GG G GG     GGGEG E GGG 
   118    9 B G        +     0   0   29  718   50  PPAPPPVP P  PAPPPPPPGP P PPP  P APAGA SPPAP 
   119   10 B D        -     0   0   96  725   42  SSEGGGEG E  GGGGGAGEGG G GTGG G EGEGE AGGET 
   120   11 B L  E     +n  224   0D  79  727   14  LLVTLLRL L  LLLLVLLLLI L LLLL L VVVLV VXVVL 
   121   12 B V  E     -n  225   0D  16  729   31  VVKVVVKV V  VVVVVVVVVL V VVVV V RVKFR KVVKV 
   122   13 B Q    >   -     0   0  114  730   53  KKRRKKVR K EKKKKKKKKQQ K KKAK E KKKKK KRKKK 
   123   14 B P  T 3  S+     0   0   66  730    7  PPPPPPPP P PPPPPPPPPPP A HPPP P PPPPP PXPPP 
   124   15 B G  T 3  S+     0   0   58  734   31  SSGSSSGS G SSSSSSTSGGS S STSS S GSGTG GSSGT 
   125   16 B G    <   -     0   0   25  736   63  QQEEQEAQ A QQQQQQQEAGQ S QEQQ Q AQSDA EQESE 
   126   17 B S        +     0   0   78  735   29  TTSSTTST S TTTTTTTTSST A TTST T STSTS STTST 
   127   18 B L  E     - K   0 192C  25  737   28  LLLLLLVL V LLLLLLLLVLL L LLLL L VLALV HLLVL 
   128   19 B K  E     - K   0 191C  93  735   55  SSRRSSRS K SSSSSSTSKRS S STSS S KSRTK KSRRT 
   129   20 B L  E     - K   0 190C   0  740   16  LLILLLIL I LLLLLLLLVLL L LLIL L VLLLV LLLVL 
   130   21 B S  E     -JK 116 189C  28  740   37  TTSTTTST S TTTTTTTTSST T TTTT T STSTS STSTT 
   131   22 B d  E     -JK 115 188C   0  740    0  CCCCCCCC C CCCCCCCCCCC C CCCC C CCCCC CCCCC 
   132   23 B A  E     -JK 114 187C  52  740   67  TSKTAAKT K AAATTATIKAS S TTTA V KSKTK TAAKT 
   133   24 B A  E     +J  113   0C   8  740   48  VVTVVVAV A IIVVVVFVAAF V VLVI I AVVVA VIVTF 
   134   25 B S  E     +J  112   0C  58  740   14  SSSSSSSS S SSSSSSSSSSS T SSSS S SSSSS SSSSS 
   135   26 B G  S    S+     0   0   56  739    3  RGGGGGGG G GGGEGGGGGGG G GGGG G GGGGG GGGGG 
   136   27 B F  S    S-     0   0   33  740   31  FLYFFGYS Y DDDFFFFGYFF Y FLFD D YSDFY FDGGF 
   137   28 B T    >   -     0   0   93  740   53  SSSESSAT S SSSSSSSPSTS S SSSS S TSDST DSSTS 
   138   29 B F  G >  S+     0   0    2  740   28  LLFLIIFF F VVVILLLIFFL I LLIV V FIFLF VVVFL 
   139   30 B S  G 3  S+     0   0   57  740   55  TTTTTSES T SSSTTTSRTSR T TTNS S ITNST NSSSS 
   140   31 B S  G <  S+     0   0   71  740   57  SNSStGNN D ttstSSsrDSt s StQS t StTGS GssGt 
   141   32 B Y  S <  S-     0   0   44  738   42  NHSFyYYD Y galyYSmyYYm y Yv.N g YyYYY HayYv 
   142   33 B T        -     0   0   30  739   92  VGWSAWYY K AATYPACYKGG Y GA.S A YYDDA HVYTG 
   143   34 B M  E     -OP 160 207E   0  739   49  VVIVWWIY I WWWWVVVWIMV W VV.A W MWIMV MWWIV 
   144   35 B S  E     -OP 159 206E   0  740   72  GGSHDSHT Y NNNSNGGGYHG N HGLA S HSHSH NNSSG 
   145   36 B W  E     +OP 158 205E   0  740    0  WWWWWWWW W WWWWWWWWWWW W WWWW W WWWWW WWWWW 
   146   37 B V  E     -OP 156 204E   0  740   17  VVVIIIVV V FIIFIVIIVvI I IIcn I VIVVV VIIVI 
   147   38 B R  E     -OP 155 203E  10  740   21  RRRRRRRR K RRRRRRRRKcR R RRgr R RRRRR KRRRR 
   148   39 B Q  E     -OP 154 202E   9  740    4  QQQQQQQQ Q QQQQQQQQQQQ Q QQSP Q QQQQQ QQQQQ 
   149   40 B T    >   -     0   0    9  739   74  PAMPPPAP S SSSPAAPPSPP F AGPV S ASAAA VSQAR 
   150   41 B P  T 3  S+     0   0   80  740   11  PPPPPPPP H PPPPPPPPHPS P PPAP P PTPPP PPPPP 
   151   42 B E  T 3  S-     0   0  151  740   29  GGGGGGGG G SSSGGGGGGGG G GGSS S GEGGG GSGGG 
   152   43 B K    <   +     0   0  121  740   37  KKKKKKLR K RRRKKKKKKKK N KRRR R QKRKQ ERKRK 
   153   44 B R        -     0   0  113  739   42  AAGGGGGG S GGGGGGGGSVG K GAKG G GGGGG GGGGA 
   154   45 B L  E     -O  148   0E   9  740   13  LLLLLLLL L LLLLLLLLLLL L LLGL L LLLLL LLLLL 
   155   46 B E  E     -O  147   0E  44  739    4  EEEEEEEE E EEEEEEEEEQE E EESE E EQEEE EEEEE 
   156   47 B W  E     +O  146   0E  15  739   11  WWWWWWWW W WWWWWWWWWWW W WWGW W WWWWW WWWWW 
   157   48 B V  E     -     0   0E   0  739   28  LLMIMIMI I LLLIVVLIIML M VLVL L VIMIM LXMVL 
   158   49 B A  E     -O  145   0E   0  740   36  GGGGGGGG G GGGGGGAGGGA G GAAG G GGAGG LGGGA 
   159   50 B S  E     -OQ 144 168E   0  740   94  ICSFIRIY Y RRRYVARGYLH Y VWGR R TYVVW SRYSF 
   160   51 B I  E     -OQ 143 167E   4  739   18  FLIAIIFV I TTTIMIIVIWI I MLST T IIVIV YTWPI 
   161   52 B N    >   -     0   0   47  740   85  NYYWYDNF D YYYRFADYDTW S FLIT L HNHYN RYSAN 
   162   53 B N  T 3  S+     0   0   65  740   86  SNPYNSPY P YYYYGGWYPEW Y GYWY Y PYPAP KYGKW 
   163   54 B G  T 3  S-     0   0   65  740   68  DDGGDSVH Y RRREGSDTYSD D GWAR R LSSSY TRSWD 
   164   55 B G  S <  S+     0   0   30  740   50  GGDGGGAG N SSSGGGDGNTD G GDGS S LGDGN YSTTD 
   165   56 B G  S    S+     0   0   74  739   59  NDSgSsGT G kkknSGDSGSD s SDGk k GGdSG NkYdD 
   166   57 B R        +     0   0  163  548   85  ..Dv..A. G yys..S..V.. . .DSy y S.t.N .y.fN 
   167   58 B T  E     -Q  160   0E  62  724   48  ITTTT.VS T NDY.TTKIT.K . TKTN E TTT.T TN.qR 
   168   59 B Y  E     +Q  159   0E  53  723   87  FGK.Yy.D T DDEyYYYYT.R n DRND . NG..K YD.v. 
   169   60 B Y        -     0   0   44  737    7  LYY.YLSD Y YYYYYYYYYYY Y YFYY Y YYY.Y YYYYY 
   170   61 B P    >>  -     0   0   20  737   66  NNN.SNST N AAASNNNNNNN N NSNA A ANG.A AANIS 
   171   62 B D  T 34 S+     0   0  148  739   65  SPPDPPET Q VVVPPPTPQPP P PPSV E QLPTQ SIPKP 
   172   63 B T  T 34 S+     0   0   90  739   62  AASSSSKP K SSSSTASSKAA S TSAS S KSRYK GSAWS 
   173   64 B V  T X> S+     0   0    1  740   43  LLFLLLFL F VVVLLLLLFFL L LLLV V FLSYF IVFEL 
   174   65 B K  B 3< S+l  177   0C 142  739   35  KKQKKKRR E RKKKKKEREQK K KKMK K QKQAQ QKQRR 
   175   66 B G  T 34 S+     0   0   74  739   36  SSGNSSDS D SSSSSSTGDGS N SSSS S SSATG GSNVS 
   176   67 B R  T <4 S+     0   0   36  739   21  RRHRRRRR K RRRRRRRRKHR R RRRR R RRRWR RRRTR 
   177   68 B F  E  <  -lM 174 192C   2  740   67  LLVVTVLV A IIITLLLVAIL I LLLI I VSFAV IIIVL 
   178   69 B T  E     - M   0 191C  79  740   38  SSTTSTVT S TTLSSSTTSST S STST T SSTKS TNTST 
   179   70 B I  E     + M   0 190C   5  740   22  VIIIILMM L IIIIIIIILII I IVII F IIVSM FIILG 
   180   71 B S  E     - M   0 189C  51  736   45  ITSTSSSL T NNNSTTSSTTS T TTSN N TSTRT SXTKT 
   181   72 B R  E     - M   0 188C  30  739   68  RRAKRRSV A PPPRRRKVAAK R RRKP P ERRSS TPAPK 
   182   73 B D  E > > - M   0 187C  60  738    5  DDDDDDDD D DDDDDDDDDDD D DDDD D DDDTD EDDSD 
   183   74 B N  G > 5S+     0   0   48  739   59  ITKNTTTT K TTTTTTTTKTT T TTNT T TTSIT STTFT 
   184   75 B A  G 3 5S+     0   0   99  739   41  ASSGSSSS S SSSSSSSSSAS S SSSS S YSSTS SSSNS 
   185   76 B K  G < 5S-     0   0  111  740   54  EKIKKKAK S KKKKKKRRSRS K KKKK K AKTRM TKKQR 
   186   77 B N  T < 5 +     0   0   62  740   46  SSSKNNNN S NNNNSSNNSNN N SNSN N SNTTS TNNAN 
   187   78 B T  E   < -KM 132 182C  16  740   68  QQTQQQTQ T QQQQQQQQTQQ Q QQQQ Q TETsT FEQYQ 
   188   79 B L  E     -KM 131 181C   0  737   61  LVTIFFVF A FFFFVVVFAFV F VVVF F AFVtA .VF.V 
   189   80 B Y  E     -KM 130 180C  41  737   41  SSFYSSSS L SSSSYYVSLSF F YVFS S YSYVY .AS.V 
   190   81 B L  E     -KM 129 179C   0  739    8  LLLLLLML M LLLLLLLLMLL L LLLL L MLMBM ILLML 
   191   82 B Q  E     -KM 128 178C  76  739   41  SSHQQKQR H QQQQTQTNHQK K TTKQ Q EQELD EQQET 
   192   83 B M  E     +KM 127 177C   0  740   11  LLWMLLLL L LLLLLLMLLLI L LMML L LLLML ILLLI 
   193   84 B S        +     0   0   42  740   54  SSSNSSRS N NNSSNTDRNSA N NTNN N STTDS PNNVT 
   194   85 B S  S    S-     0   0   68  739   23  SSSGSSNS S SSSSSSPSSSS S RNSS S SSASS NSGNN 
   195   86 B L        -     0   0    3  740   16  VVLMVVLV L VVVVLVVMLVV V LMLV V LVLLL LVVLM 
   196   87 B K    >   -     0   0  102  740   70  STKETTRT T ITTTRNDSTTD T RDQT T RTITS RTTFD 
   197   88 B S  G >  S+     0   0   70  740   59  ATAVTASA S PPPTAPTASTT P APTP P AASAA VPLNP 
   198   89 B E  G 3  S+     0   0  126  740   21  EESKQADA E EDDEEEAAEEA E EVDE E EDAQE EEAEV 
   199   90 B D  G <   +     0   0    2  740    3  DDDDDDDD D DDDDDDTDDDD D DDDD D DDDDD DDDDD 
   200   91 B T    <   +     0   0   32  740   32  TTTTTTTT S TTTSTTYTSTT T TTTT T TTTTT TTTGS 
   201   92 B A  E    S- R   0 223E   8  737    4  AAAAAAGA A AAAAAA.AAAA A AAAA X AAAAA AXAAG 
   202   93 B M  E     -PR 148 222E  58  739   46  VLTMVVRV I VVVVVV.MVMT T VTMV V VVITL MVLVT 
   203   94 B Y  E     -PR 147 221E   0  739    1  YYYYYYYY Y YYYYYY.YYYY Y YYYY Y YYYYY YYYYY 
   204   95 B Y  E     -P  146   0E   7  740    4  YYYYYYFY Y YYFYYYYYYYY Y FYYY Y YYYFY YYYYF 
   205   96 B d  E     -P  145   0E   0  740    0  CCCCCCCC C CCCCCCCCCCC C CCCC C CCCCY CCCCC 
   206   97 B V  E     -PS 144 217E   0  740   24  AAAAAAAA A AAATAAAAAAA A AVAA V AAAAA AAAAA 
   207   98 B R  E     -PS 143 216E  21  739   39  stkrrrrr r rrgrkkrrrRq r rhrs r rrrrr Rirrh 
   208   99 B H  E     + S   0 214E   6  629   94  yvslnlfi s gvasgipds n g gpdd t ekslw Gsevl 
   209  100 B E  E  >  + S   0 213E  63  676   73  DLAGHASA S GRASPTADS P H PRGD P PGGSA TGGNG 
   210  101 B Y  T >4 S-     0   0   80  702   91  YGSHRSQG P SLEWSTGGP A N STSA T SDTYL GWGPG 
   211  102 B Y  T 34 S-     0   0  140  709   44  WYFYFFYC F YFFYCYYIF W Y CLYF F CFSlF FFYFF 
   212  103 B Y  T 34 S+     0   0   39  264   90  ........ . ......... . W ..W. . ...s. P.... 
   213  104 B A  E <<  -S  209   0E   0  447   85  S.....G. . S........ . Y .AY. . ...S. Q.... 
   214  105 B M  E     +S  208   0E   0  580   59  II....MI . F.....M.. F F .FF. . ..LV. W.Q.. 
   215  106 B D  E     +     0   0E  19  696   48  HDD.H.DD D HDDR..DDD A D .DDD D ..GDN GYFDD 
   216  107 B Y  E     -S  207   0E  99  702   57  YYN.K.VV Y YYYL..VVF Y V .VVI F .SPVF YSHYX 
   217  108 B W  E     -S  206   0E  23  731    0  WWW.WWWW W WWWWWWWWW W W WWWW W WWWWR WWWWW 
   218  109 B G        -     0   0    0  714   13  GGGGDAGG G GGGPAIGGG G G AGGG G AGGGG GGSGG 
   219  110 B Q        -     0   0   91  701   38  PPQNPKQQ Q QQQPQKRQQ Q A QQAQ Q QGQPS SQEQQ 
   220  111 B G        -     0   0   16  687   10  GGGGN GG G GGGPGLGGG G G GGGG G GEGGA GG GG 
   221  112 B T  E     -R  203   0E  21  675   26  LLVGD TS T TAT FKTTT T T FTTT T FGTTT TT VT 
   222  113 B T  E     -R  202   0E  72  661   75  LLLLL TL T LLL PIPTT L   PKTM L PFLLE FL LL 
   223  114 B V  E     -R  201   0E   0  654   18  VVV   VV L VVV LLVVL V   LVVV V LLLVL LV VV 
   224  115 B T  E     -n  120   0D  36  643   13  TTT   IT T TTT KTTHT T   KATT T KSITT TT TT 
   225  116 B V  E     +n  121   0D   6  626    6  IAV   VV V VVV L VVV V   LVVV V L VVE VV VV 
   226  117 B S        -     0   0   36  616    5  SSS   SS S SSS S SSS S   SSSS S S SSS TS SS 
   227  118 B S  S    S+     0   0   84  597   20  SSS   SS S SSS A SSS A   ASSS S A S P SS SS 
   228  119 B A  S    S+     0   0   70   97   58    A        GGG                G A     VG G  
   229  120 B W        -     0   0  123   87   40    S        SSS                S S     TS S  
   230  121 B R        +     0   0  207   62   76    T                             R     QA    
   231  122 B H              0   0  156   56   69    K                             E           
   232  123 B P              0   0  155   28   53    G                             G           
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1    1 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   6  13   1  78   423    0    0   0.727     24  0.83
    2    2 A   9   3  86   0   0   0   0   0   0   1   0   1   0   0   0   0   0   0   1   0   466    0    0   0.582     19  0.87
    3    3 A  45   2   1   2   0   0   0   0   1   0   0   5   0   0   0   1  40   2   0   0   468    0    0   1.264     42  0.32
    4    4 A   1  31   0  67   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   482    0    0   0.697     23  0.92
    5    5 A   0   0   1   0   0   0   0   0   0   0   3  95   0   0   0   0   0   0   1   0   482    0    0   0.258      8  0.92
    6    6 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   482    0    0   0.049      1  0.99
    7    7 A   0   0   0   0   0   0   0   0   1   1  74  24   0   0   0   0   0   0   0   0   482    1    0   0.676     22  0.64
    8    8 A   0   0   0   0   0   0   0   0   1  94   0   3   0   0   0   0   1   0   0   0   485    0    0   0.320     10  0.90
    9    9 A   2   9   0   0   1   0   0   4  25   2  47   2   0   1   0   0   0   2   0   4   489    0    0   1.605     53  0.33
   10   10 A   0   2   5   0   3   0   2   0   1   3  75   9   0   0   0   0   0   0   0   0   491    0    0   0.997     33  0.57
   11   11 A  12  78   0   5   0   0   0   0   0   0   0   1   0   0   0   1   1   0   1   0   494    0    0   0.851     28  0.77
   12   12 A   0   1   0   0   0   0   1   0  17  12  66   1   0   0   0   0   0   1   0   0   495    0    0   1.038     34  0.58
   13   13 A  33   5   1   0   0   0   0   2  51   0   0   1   0   0   1   2   0   2   0   0   495    0    0   1.296     43  0.41
   14   14 A   0   0   0   0   1   0   0   0   6   3  80   9   0   0   0   0   0   0   0   0   496    0    0   0.762     25  0.69
   15   15 A  36  26   1   0   0   0   0   0   2  28   1   1   0   1   1   0   3   0   0   0   496    0    0   1.502     50  0.34
   16   16 A   0   0   0   0   0   0   0  97   0   0   0   0   0   0   1   0   0   1   0   0   496    0    0   0.163      5  0.95
   17   17 A   0   0   0   0   0   0   0   9   0   0   1   0   0   0   0   1  12  35   0  41   496    0    0   1.333     44  0.63
   18   18 A   0   0   1   0   0   0   0   0   0   7   5  22   0   0  52   8   3   0   0   0   496    0    0   1.439     48  0.37
   19   19 A  75   0   1   0   0   0   0   0  24   0   0   1   0   0   0   0   0   0   0   0   496    0    0   0.643     21  0.63
   20   20 A   0   0   1   0   0   0   0   0   1   0  15  81   0   0   0   0   0   0   1   0   495    1    1   0.653     21  0.70
   21   21 A   1  10  81   7   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   494    0    0   0.691     23  0.82
   22   22 A   0   0   1   0   0   0   0   0   0   0  37  42   0   0   3   5   0   1  11   0   494    0    0   1.336     44  0.41
   23   23 A   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   495    0    0   0.082      2  0.98
   24   24 A   0   1   0   0   0   0   0   0   0   0   4   2   0   1  55  20  17   0   0   0   495    0    0   1.316     43  0.53
   25   25 A   0   0   0   0   0   0   0   0  81   0  16   2   0   0   1   0   0   0   0   0   495    0    0   0.634     21  0.72
   26   26 A   0   0   0   0   0   0   0   1   0   0  97   1   0   0   0   0   0   0   0   0   495    0    0   0.165      5  0.96
   27   27 A   0   0   0   0   0   0   0   1   0   0   9   0   0   1   0   4  73  11   1   0   495    0    0   0.986     32  0.61
   28   28 A   0   0   0   0   0   0   0  21   0   0  57   1   0   0   0   0   0   0   8  11   495    0    0   1.268     42  0.54
   29   29 A  27  18  51   0   0   0   0   0   0   0   1   1   0   0   0   0   0   0   1   0   496    0    0   1.235     41  0.68
   30   30 A   4  12   1   0   1   0   9   6   0   0  44   3   0   1   2   0   0   1   9   5   496   25  179   1.933     64  0.19
   31   31 A   0   0   2   0   0   0   1   1   0   0  34  14   0   1   0   4   1   0  33   6   471    0    0   1.655     55  0.35
   32   32 A   1   3   1   0   4  10  59   1   1   0   3   0   1   1   1   0   0   2   8   2   495    0    0   1.611     53  0.47
   33   33 A   3  84   1  11   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   495    0    0   0.567     18  0.92
   34   34 A   1   1   0   0   0   0   4   1  37   0  11   1   0  16   0   0   1   2  22   2   495    0    0   1.772     59  0.29
   35   35 A   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   496    0    0   0.029      0  0.99
   36   36 A   0   2   0   0   8   0  87   0   0   0   0   0   0   3   0   0   0   0   0   0   496    0    0   0.509     16  0.91
   37   37 A   0  11   0   0   0   0   0   0   0   0   0   0   0   0   1   0  87   0   0   0   496    0    0   0.434     14  0.72
   38   38 A   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   2  95   0   0   0   496    1    0   0.196      6  0.95
   39   39 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   3  94   1   0   0   0   495    0    0   0.323     10  0.91
   40   40 A   0   1   0   0   0   0   0   0   1  89   5   0   0   1   1   0   2   0   0   0   496    0    0   0.555     18  0.82
   41   41 A   0   0   0   0   0   0   0  92   0   0   1   0   0   0   0   0   1   1   0   4   496    0    0   0.413     13  0.89
   42   42 A   0   0   0   0   0   0   0   4   1   0   2   3   0   0   1  33  50   3   1   0   495    0    0   1.368     45  0.46
   43   43 A   3   0   0   0   0   0   0   0  42  18  29   5   0   0   1   0   0   0   0   0   495    0    0   1.471     49  0.44
   44   44 A   3   0   1   0   0   0   0   0   0  95   0   0   0   0   0   0   0   0   0   0   495    1    1   0.263      8  0.89
   45   45 A   0   0   0   0   0   0   0   0   0   0   0   2   0   0  14  71  11   1   1   0   495    0    0   0.934     31  0.67
   46   46 A   1  78   0   0   1   0   0   1   0   6   1   2   0   1   6   0   0   0   0   0   495    0    0   0.965     32  0.58
   47   47 A   1  93   1   1   0   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   495    0    0   0.346     11  0.91
   48   48 A   2   2  95   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   496    0    0   0.282      9  0.95
   49   49 A   0   0   0   0   1   0  92   0   0   0   2   0   0   1   1   1   0   0   1   0   496    0    0   0.454     15  0.83
   50   50 A   1   6   0   0   0   5  12  13  19   0   4   1   0   1  10   9   2   6   2   9   496    0    0   2.428     81  0.09
   51   51 A  10   1   2   1   0   0   0   3  70   0   1  11   0   0   0   0   0   0   0   1   496    0    0   1.103     36  0.56
   52   52 A   0   0   0   0   0   0   1   0   0   0  84   5   0   0   0   2   0   0   7   0   496    0    0   0.692     23  0.74
   53   53 A   0   0   2   0   0   0   2   1   0   0  25  20   0   1   5   7   1   0  35   1   496    0    0   1.745     58  0.32
   54   54 A   0  70   0   0   0   0   0   0   0   0   1   0   0   1  26   0   1   0   0   0   496    0    0   0.802     26  0.40
   55   55 A   2   1   1   0   4   0   1   2  33   1   0   1   0   7   0   0  23  21   0   3   495    1    0   1.883     62  0.29
   56   56 A   0   0   0   0   0   0   0   0   1   1  74  16   0   0   0   0   0   1   1   5   495    0    0   0.935     31  0.64
   57   57 A   0   0   0   0   0   1   0  98   0   0   0   0   0   0   0   0   0   1   0   0   496    1    2   0.139      4  0.95
   58   58 A  84   0  14   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   494    0    0   0.530     17  0.89
   59   59 A   0   0   0   0   0   0   0   0   0  95   4   0   0   0   0   0   0   0   0   0   495    0    0   0.196      6  0.93
   60   60 A   1   1   0   0   0   0   0   0  17   1  52   0   0   0   0   1   0   1   0  26   496    0    0   1.250     41  0.43
   61   61 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  97   0   1   0   0   0   496    0    0   0.176      5  0.95
   62   62 A   0   1   1   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   496    0    0   0.110      3  0.99
   63   63 A   0   0   1   0   0   0   0   0   0   0  86   3   0   0   2   6   0   0   0   0   495    0    0   0.585     19  0.76
   64   64 A   0   0   0   0   0   0   0  98   1   0   0   0   0   0   0   0   0   0   0   1   496    0    8   0.124      4  0.98
   65   65 A   0   0   1   0   0   0   0   1   0   0  97   1   0   0   1   0   0   0   0   0   496    0    0   0.182      6  0.94
   66   66 A   0   0   0   0   0   0   0  93   0   0   0   0   0   0   5   0   0   0   0   1   496    0    0   0.323     10  0.85
   67   67 A   0   0   0   0   1   0   2   0   1   0  96   0   0   0   0   0   0   0   0   0   496    0    0   0.245      8  0.91
   68   68 A   0   0   0   0   0   0   0  93   2   0   1   0   0   0   2   0   0   1   0   1   496    0    0   0.412     13  0.87
   69   69 A   0   0   0   0   0   0   0   0   2   0   3  93   0   0   0   1   1   0   0   0   495    0    0   0.382     12  0.86
   70   70 A   0   0   0   0   0   0   0   0   1   0   5   0   0   0   0   0   7  12   1  72   496    2    4   0.995     33  0.71
   71   71 A   0   0   0   0  77   0  22   0   1   0   0   0   0   0   0   0   0   0   0   0   494    0    0   0.582     19  0.94
   72   72 A   0   0   1   0   0   0   0   0   0   0  20  78   0   0   0   0   0   0   0   0   495    0    0   0.581     19  0.70
   73   73 A   0  95   0   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   496    0    0   0.228      7  0.97
   74   74 A   0   0   1   0   0   0   0   0   0   0   2  76   0   0   2  13   0   0   5   0   496    0    0   0.875     29  0.62
   75   75 A   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   496    0    0   0.079      2  0.98
   76   76 A   0   0   0   0   0   0   0   1   0   0  82   2   0   5   1   0   0   0   7   2   496    0    0   0.756     25  0.70
   77   77 A   0   0   0   0   0   0   0  10   0   7  50   1   1   0  20   0   0   0   8   4   496    0    0   1.536     51  0.37
   78   78 A  30  59   1   8   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   496    0    0   1.043     34  0.73
   79   79 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2  44  51   0   1   496    0    1   0.876     29  0.69
   80   80 A   1   0   0   0   0   0   1   0  32  43   4   2   8   0   0   0   2   5   0   1   496    0    0   1.556     51  0.41
   81   81 A   0   0   0   0   0   0   0   1   4   0   0   0   0   0   0   0   0  81   0  13   496    0    0   0.619     20  0.85
   82   82 A   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   1   0  97   496    0    0   0.117      3  0.94
   83   83 A  21   6   8   2  26   0   0   0  31   0   1   2   0   0   0   0   0   1   0   1   495    0    0   1.738     57  0.27
   84   84 A   1   0   0   0   0   0   0  22  76   0   0   1   0   0   0   0   0   0   0   0   496    0    0   0.649     21  0.77
   85   85 A  25   0   7   2   0   0   0   0   1   0   2  50   0   2   0   0   0   1   3   8   496    0    0   1.493     49  0.37
   86   86 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   496    0    0   0.000      0  1.00
   87   87 A   0   0   0   0  10   0  88   0   0   0   0   0   0   1   0   0   0   0   0   0   495    0    0   0.446     14  0.95
   88   88 A   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   496    2    0   0.041      1  0.99
   89   89 A   1   9   0   7   2   0   1   1   2   0   1   0   0   2   0   0  72   1   0   0   494    0    0   1.150     38  0.52
   90   90 A   0   0   0   0   0   0   0   4   1   0   2   0   0   7   1   2  79   1   2   0   486   35    0   0.870     29  0.72
   91   91 A   0   2   0   0   1   4  25  16   7   0  16   4   1  10   4   0   1   1   4   3   423    0    0   2.269     75  0.11
   92   92 A   1   6   2   0   1   2  33   3   1   0  10   6   0   2   3   4   0   0  18   7   454   28    0   2.183     72  0.12
   93   93 A   1   0   0   0   0   0   4   5   0   0  43   4   0   6   1   2   5  12  10   5   421    0    0   1.984     66  0.29
   94   94 A   4   6   2   0   7   4  15   3   6   2  22  11   0   0   1   1   0   2   8   5   444    1    0   2.460     82  0.11
   95   95 A   1   8   1   0   2   1   2   2   1  70   7   2   0   0   0   0   0   0   2   1   441    0    0   1.270     42  0.49
   96   96 A   1   8   1   0   4   5   7   1   2  55   5   3   0   3   2   0   1   1   2   0   420  240   20   1.817     60  0.24
   97   97 A   2  12   3   1   5   7  11   1   1   5   2  26   0   1  15   1   5   0   1   0   151    1    0   2.345     78  0.11
   98   98 A  15   1   0   0   0   0   0   2   1   1   4  73   2   0   0   0   0   0   0   0   278    0    0   1.016     33  0.58
   99   99 A   5   6   6   3  75   0   2   0   1   0   1   0   0   0   0   0   0   0   0   0   277    0    0   1.055     35  0.73
  100  100 A   0   2   0   0   0   0   0  75   1   0   4   1   0   1   1   0  12   0   2   0   285    0    0   1.030     34  0.61
  101  101 A   1   0   0   0   0   0   0  35  16   4   6  10   0   0   0   0  24   1   0   1   300    0    0   1.774     59  0.37
  102  102 A   4   3   1   3   0   0   0  75   1   2   2   0   0   1   1   1   1   1   2   1   300    0    0   1.200     40  0.58
  103  103 A   0   1   1   1   0   0   0   1   1   0   4  89   0   0   0   1   1   0   1   0   360    0    0   0.610     20  0.81
  104  104 A  18   0   1   2   0   0   0   1   1   0   1   3   0   1   5  57   5   4   1   1   359    0    0   1.532     51  0.39
  105  105 A  23  57   8   2   0   0   1   0   3   0   0   4   0   1   0   1   0   0   0   0   343    0    0   1.348     45  0.61
  106  106 A   5   0   0   2   0   0   0   0   0   0   5   2   0   5   0   1  18  54   2   5   326    0    0   1.574     52  0.48
  107  107 A  12  16  49   1   1   0   0   0   2   4   2   9   0   0   0   0   1   0   1   0   295    0    0   1.682     56  0.49
  108  108 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  14  81   3   0   2   0   261    0    0   0.625     20  0.82
  109          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  110    1 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  51  40   0   9   375    0    0   0.952     31  0.69
  111    2 B  90   2   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   3   0   0   428    0    0   0.463     15  0.88
  112    3 B   0   0   0   1   0   0   0   0   0   0   0   2   0   2   4  13  76   0   0   0   430    0    0   0.908     30  0.67
  113    4 B   1  98   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   452    0    0   0.101      3  0.99
  114    5 B  48   8   0   0   0   0   0   0   0   0   0   1   0   0   1   3  33   4   0   0   454    0    0   1.341     44  0.30
  115    6 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  23  76   0   0   458    0    0   0.597     19  0.78
  116    7 B   0   0   0   0   0   1   0   0   0   7  91   0   0   0   0   0   0   0   0   0   463    0    0   0.389     12  0.85
  117    8 B   0   0   0   0   0   0   0  97   0   0   0   0   0   0   0   0   0   2   0   0   467    0    0   0.168      5  0.96
  118    9 B   0   0   0   0   0   0   0  48  19  30   1   2   0   0   0   0   0   0   0   0   718    0    0   1.171     39  0.50
  119   10 B   1   0   0   0   0   0   0  58   1   0   4   1   0   0   0   0   0  25   0   9   725    0    0   1.245     41  0.57
  120   11 B  13  85   1   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   727    0    0   0.556     18  0.86
  121   12 B  83   1   0   2   0   0   0   0   2   0   0   0   0   0   4   4   2   1   0   0   729    1    0   0.781     26  0.68
  122   13 B   0   0   0   0   0   0   0   0   6   1   0   1   0   0   8  44  37   1   0   0   730    0    0   1.314     43  0.47
  123   14 B   0   1   0   0   0   0   0   0   3  95   1   0   0   0   0   0   0   0   0   0   730    0    0   0.272      9  0.92
  124   15 B   0   0   0   0   0   0   0  72   0   0  24   1   0   0   0   2   0   0   0   0   734    0    0   0.765     25  0.68
  125   16 B   0   0   0   0   0   0   0  38  22   0   1   1   0   0   6   1  21   7   0   1   736    1    0   1.639     54  0.36
  126   17 B   0   1   0   0   0   0   0   0   0   0  82  16   0   0   0   0   0   0   0   0   735    0    0   0.602     20  0.71
  127   18 B  26  69   0   1   0   0   0   0   0   0   0   0   0   1   2   0   0   0   0   0   737    1    0   0.827     27  0.72
  128   19 B   0   0   0   0   0   0   0   0   0   0  24   3   0   0  28  44   0   0   0   0   735    0    0   1.252     41  0.45
  129   20 B   4  78  15   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   740    0    0   0.726     24  0.83
  130   21 B   0   0   0   0   1   0   0   0   0   0  73  26   0   0   0   0   0   0   0   0   740    0    0   0.665     22  0.63
  131   22 B   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   740    0    0   0.031      1  0.99
  132   23 B   4   0   0   0   0   0   0   0  40   0   4  24   0   0   0  26   0   1   0   0   740    0    0   1.427     47  0.33
  133   24 B  21   0   4   0   1   0   0   2  66   0   1   4   0   0   0   0   0   0   0   0   740    0    0   1.045     34  0.51
  134   25 B   0   1   0   0   0   0   0   0   0   0  91   6   0   0   0   0   0   0   0   0   740    1    0   0.385     12  0.85
  135   26 B   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   1   0   0   739    0    0   0.127      4  0.97
  136   27 B   0   1   1   0  66   0  22   2   1   0   0   0   0   0   1   0   0   0   0   4   740    0    0   1.088     36  0.68
  137   28 B   0   0   1   0   0   0   0   0   1   1  29  57   0   0   0   0   0   1   6   3   740    0    0   1.215     40  0.47
  138   29 B   4  17  12   0  64   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   740    0    0   1.108     36  0.72
  139   30 B   0   0   0   0   0   0   0   1   1   0  49  35   0   1   2   5   0   0   3   1   740    0    0   1.314     43  0.44
  140   31 B   0   0   0   0   0   0   1   5   1   0  51   8   0   1   3   0   0   0   9  19   740    2   80   1.563     52  0.42
  141   32 B   0   1   0   1   6   0  74   1   3   0   2   4   1   2   0   0   0   0   3   1   738    0    0   1.157     38  0.58
  142   33 B   2   1   0   0   1  16  21  26  12   1   3   3   1   1   1   1   0   3   2   5   739    0    0   2.152     71  0.08
  143   34 B  15   1   9  64   0  10   0   0   0   0   0   0   0   0   0   0   0   0   0   0   739    0    0   1.146     38  0.51
  144   35 B   0   1   0   0   1   0   4   6   1   0  26   2   0  33   0   1   1   4  17   2   740    0    0   1.897     63  0.27
  145   36 B   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   740    0    0   0.000      0  1.00
  146   37 B  80   1  14   1   3   0   1   0   1   0   0   0   0   0   0   0   0   0   0   0   740    0    4   0.743     24  0.83
  147   38 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0  77  21   0   0   0   0   740    0    0   0.645     21  0.79
  148   39 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  97   0   0   0   740    1    0   0.160      5  0.96
  149   40 B   2   0   0   0   3   0   0   1  39  15  10  12   0   0  17   0   0   0   0   0   739    0    0   1.755     58  0.26
  150   41 B   0   0   0   0   0   0   0   0   1  94   1   1   0   3   0   0   0   0   0   0   740    0    0   0.341     11  0.89
  151   42 B   1   0   0   0   0   0   0  74   0   0   3   0   0   0   1   0   0  15   0   5   740    0    0   0.921     30  0.71
  152   43 B   0   0   0   0   0   0   0   0   0   0   0   0   0   3   8  69  14   1   2   0   740    0    0   1.055     35  0.62
  153   44 B   1   0   0   0   0   0   0  72   5   0   4   0   0   0  12   3   0   2   0   1   739    0    0   1.055     35  0.58
  154   45 B   0  94   0   0   0   0   0   0   0   3   0   0   0   0   2   0   0   0   0   0   740    0    0   0.293      9  0.87
  155   46 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   2  96   0   0   739    0    0   0.212      7  0.95
  156   47 B   0   3   0   0   1  92   1   0   0   1   0   0   0   0   0   0   0   0   0   0   739    0    0   0.425     14  0.89
  157   48 B  45  17  32   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   739    0    0   1.218     40  0.71
  158   49 B   1   0   0   0   0   0   0  53  36   0   9   0   0   0   0   0   0   0   0   0   740    0    0   1.048     34  0.63
  159   50 B  15   2   2   1   4   5  14   4   8   0   4   9   1   1  15   0   1   9   3   2   740    0    0   2.556     85  0.05
  160   51 B   3   1  87   1   1   0   0   0   0   0   1   3   0   0   1   0   0   0   0   0   739    0    0   0.656     21  0.81
  161   52 B   0   2   1   0   1  12  12   1   1   0  26   1   0   3   9   3   0   0  14  13   740    0    0   2.224     74  0.14
  162   53 B   0   2   0   0   0   3  13   7   4  26  22   6   0   2   1   1   2   1   8   2   740    0    0   2.195     73  0.13
  163   54 B   0   0   0   0   0   0   3  29   5   1  14   1   0   0   4   7   0   2  10  22   740    0    0   2.038     68  0.32
  164   55 B   0   0   0   0   0   0   1  53   4   0  21   3   0   0   0   0   0   0  11   5   740    0    0   1.499     50  0.50
  165   56 B   1   0   1   0   1   0   1  33   1   0  37   3   0   1   2   3   0   0  10   5   739  192   95   1.730     57  0.40
  166   57 B   1   0   1   0   1   0  18  11   4   1  16  15   0   0   1   1   1   4  15   6   548    0    0   2.268     75  0.15
  167   58 B   1   1  10   0   0   0   0   0   3   1   2  67   0   0   0   9   1   1   3   0   724   11   10   1.326     44  0.52
  168   59 B   0   1   1   0   1   1  40   2   2   0   6   3   0   3   2  10   0   5  15   8   723    0    0   2.064     68  0.13
  169   60 B   0   1   0   0   1   0  95   0   0   0   0   0   0   1   0   0   0   0   0   0   737    0    0   0.292      9  0.93
  170   61 B   3   0   0   0   0   0   0   1  34  11   7   3   0   2   0   1   0   0  33   5   737    0    0   1.737     57  0.34
  171   62 B   2   0   0   0   0   0   0   1   8  20   8   1   0   0   0   0  10  12   2  35   739    0    0   1.865     62  0.34
  172   63 B   0   0   0   0   1   1   0   0  16   1  50   5   0   0   1  22   0   0   1   1   739    0    0   1.476     49  0.37
  173   64 B  48  22   0   1  27   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   740    1    0   1.175     39  0.56
  174   65 B   0   0   3   3   0   0   0   0   0   0   0   1   0   0   4  75  10   2   1   0   739    0    0   0.982     32  0.64
  175   66 B   0   0   0   0   0   0   0  64   0   0  27   1   0   0   0   0   0   0   2   5   739    0    0   0.994     33  0.63
  176   67 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0  75  22   1   0   0   0   739    0    0   0.674     22  0.78
  177   68 B   6  15   5   0  49   0   0   0  22   0   1   2   0   0   0   0   0   0   0   0   740    0    0   1.417     47  0.33
  178   69 B   0   0   4   0   0   0   0   0   1   0  20  73   0   0   0   1   0   0   0   0   740    0    0   0.832     27  0.62
  179   70 B   4  15  74   3   3   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   740    1    0   0.904     30  0.77
  180   71 B   0   0   1   0   0   0   0   0   0   0  63  33   0   0   0   0   0   0   2   0   736    0    0   0.827     27  0.55
  181   72 B  10   1   1   0   0   1   0   0  13   3   2   1   0   0  56  12   0   0   0   0   739    1    0   1.458     48  0.32
  182   73 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   2  95   738    0    0   0.239      7  0.94
  183   74 B   0   0   1   0   0   0   0   0   0   0   1  27   0   0   0  15   0   0  48   6   739    0    0   1.339     44  0.41
  184   75 B   1   0   0   0   0   0   0   4  24   6  62   2   0   0   0   0   0   0   1   0   739    0    0   1.128     37  0.58
  185   76 B   0   0   1   0   0   0   0   0   1   0  23   2   0   0   2  59   7   1   3   0   740    0    0   1.293     43  0.45
  186   77 B   0   0   0   0   0   0   0   0   0   0  41   1   0   0   1   2   0   0  53   1   740    0    0   0.967     32  0.54
  187   78 B   0   3   4   4   0   0   0   0   1   0   6  54   0   0   0   0  25   1   2   0   740    3    1   1.402     46  0.32
  188   79 B  22  42   0   0   9   0   1   0  24   0   0   1   0   0   0   0   0   0   0   0   737    0    0   1.391     46  0.38
  189   80 B   1   0   0   0  15   0  67   0   0   0  12   1   0   2   0   0   0   0   1   0   737    0    0   1.085     36  0.59
  190   81 B   0  78   0  19   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   739    0    0   0.673     22  0.92
  191   82 B   0   1   0   0   0   0   0   0   0   0   4   1   0   2   2  11  68   8   1   1   739    0    0   1.196     39  0.58
  192   83 B   1  40   2  56   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   740    0    0   0.866     28  0.88
  193   84 B   0   0   1   0   0   0   1   1   1   0  41   5   0   1   2   1   0   0  44   2   740    1    0   1.305     43  0.45
  194   85 B   0   0   0   0   0   0   0   2   1   0  85   2   0   0   2   1   0   0   5   0   739    0    0   0.727     24  0.76
  195   86 B  16  82   0   1   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   740    0    0   0.578     19  0.84
  196   87 B   0   0   1   0   0   0   0   0   1   0   1  35   0   0  31  19   9   1   1   1   740    0    0   1.577     52  0.30
  197   88 B   2   0   1   0   0   0   0   0  29   8  40  17   0   0   0   0   0   0   1   0   740    0    0   1.504     50  0.41
  198   89 B   1   0   0   0   0   0   0   1   5   0   0   0   0   0   0   1   1  80   1  10   740    0    0   0.779     26  0.79
  199   90 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  98   740    0    0   0.091      3  0.96
  200   91 B   0   0   0   1   0   0   0   0   1   0  20  77   0   0   0   0   0   0   0   0   740    1    0   0.666     22  0.67
  201   92 B   0   0   0   0   0   0   0   3  96   0   0   0   0   0   0   0   0   0   0   0   737    0    0   0.194      6  0.95
  202   93 B  50   7   7  21   0   0   0   0   0   0   0  13   0   0   1   1   0   0   0   0   739    0    0   1.418     47  0.53
  203   94 B   0   0   0   0   1   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   739    0    0   0.081      2  0.99
  204   95 B   0   0   0   0   8   0  90   0   0   0   0   1   0   0   0   0   0   0   0   0   740    0    0   0.396     13  0.95
  205   96 B   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   740    0    0   0.050      1  0.99
  206   97 B   6   0   0   0   0   0   0   1  83   0   1   7   0   0   0   0   0   0   1   0   740    0    0   0.685     22  0.76
  207   98 B   1   1   1   0   0   0   0   1   2   1   3   5   0   1  73  10   0   0   0   0   739  104  574   1.146     38  0.60
  208   99 B   5   7   3   1   3   3  18   9   4   3   9   6   1   4   7   2   1   3   3   7   629    0    0   2.733     91  0.06
  209  100 B   3   3   1   0   0   0   2  31   6   7  11   5   0   3   4   2   2   4   2  13   676    0    0   2.339     78  0.27
  210  101 B   3   4   2   0   2   4  14  14   6   4  10   7   2   2   5   1   2   2   9   7   702    0    0   2.703     90  0.09
  211  102 B   3   4   2   1  20  10  48   1   1   1   3   0   1   2   2   0   1   0   1   0   709  456   86   1.802     60  0.56
  212  103 B   5   8   0   0   2   6  34  11   4   4   6   3   0   2   3   0   1   4   2   5   264    0    0   2.350     78  0.10
  213  104 B   2   2   2   0   2   4  17  17  27   4   7   4   1   1   2   1   2   1   2   3   447    0    0   2.337     78  0.15
  214  105 B   4   9   5  24  40   1   1   2   2   2   1   1   1   0   3   1   1   1   1   0   580    0    0   1.934     64  0.40
  215  106 B   1   2   0   0   1   0   1   2  13   2   2   1   0   1   1   1   0   4   1  65   696    0    0   1.459     48  0.52
  216  107 B  13   3   2   1   5   0  62   0   2   2   4   2   1   2   0   0   0   0   1   1   702    0    0   1.526     50  0.42
  217  108 B   0   0   0   0   1  98   0   0   0   0   0   0   0   0   1   0   0   0   0   0   731    0    0   0.104      3  0.99
  218  109 B   0   0   0   0   0   0   0  91   3   0   3   1   0   0   0   0   0   0   1   0   714    0    0   0.497     16  0.87
  219  110 B   0   1   0   0   0   0   0   1   7   6   1   2   0   0   4   2  74   1   0   0   701    0    0   1.085     36  0.62
  220  111 B   0   0   0   0   0   0   0  94   1   1   1   0   0   0   0   1   0   0   1   1   687    0    0   0.382     12  0.90
  221  112 B   2   4   1   0   1   0   0   1   2   0   1  86   1   0   0   0   0   0   0   0   675    0    0   0.735     24  0.73
  222  113 B   2  38   1   3   1   0   0   0   1   2  22  26   0   0   0   0   2   0   0   0   661    0    0   1.622     54  0.24
  223  114 B  78  19   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   654    0    0   0.668     22  0.81
  224  115 B   0   0   1   0   0   0   0   1   1   1   2  92   0   0   0   1   0   0   0   0   643    0    0   0.429     14  0.87
  225  116 B  95   2   1   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   626    0    0   0.271      9  0.94
  226  117 B   0   0   0   0   0   0   0   1   1   0  96   2   0   0   0   0   0   0   0   0   616    0    0   0.205      6  0.94
  227  118 B   0   0   0   0   0   0   0   0  14   1  84   1   0   0   0   0   0   0   0   0   597    0    0   0.546     18  0.79
  228  119 B   8   0   0   0   0   0   0  36  25   0   1   2   0   1   0   0   0  27   0   0    97    0    0   1.446     48  0.41
  229  120 B   1   0   0   0   0   1   0   3   1   2  74   2   0   0   1   3   0   0   0  10    87    0    0   1.072     35  0.60
  230  121 B   2   0   0   0   0   0   0   6   3  13   0  16   0   2  10   3  45   0   0   0    62    0    0   1.675     55  0.24
  231  122 B   0   0   0   0   0   0   0   2   0   4  52   7   0   2   4  14   0   4  13   0    56    0    0   1.568     52  0.31
  232  123 B   0   0   0   0   0   0   0  29  18  14  36   0   0   0   0   0   0   0   4   0    28    0    0   1.430     47  0.46
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     2   194    85     1 rHy
     9   200    91     2 rQVr
    11   200    91     1 rHy
    12   204    95     1 yGy
    14   204    95     1 yDy
    18   200    91     1 rHy
    22   200    91     4 sPYYRy
    23   194    85     4 rERYRy
    24   200    91     1 rHy
    28   212   105     1 dGy
    29   202    93     1 rIy
    31   200    91     1 rLy
    32   200    91     1 rIy
    34   200    91     2 rRAv
    35   200    91     2 rHRy
    37   200    91     1 rSw
    38   200    91     1 rGy
    40   212   103     1 yDv
    44   200    91     1 rSw
    45   200    91     2 rQGf
    46   200    91     1 rPy
    47   200    91     2 rGEy
    48   200    91     2 rRDg
    48   204    97     1 rQy
    49   200    91     2 rWHy
    49   204    97     1 sYy
    50   200    91     2 rQGf
    51   200    91     3 rVGDy
    52   200    91     2 rGEd
    53   200    91     2 rQGf
    54   200    91     2 rDNy
    54   204    97     1 hYy
    55   208   118     3 rYYRy
    56   208    99     2 rLGf
    56   212   105     1 sSy
    57   200    91     4 rDRESf
    58   199    90     3 rQKEa
    59   200    91     2 rDGk
    60   200    91     2 rGYy
    61   200    91     4 rDKPAy
    62   193    84     4 rPLDTs
    63   200    91     1 yRy
    64   208    99     2 rQAy
    65   200    91     3 rDPYy
    65   204    98     1 yVp
    66   200    91     4 rEACYs
    66   204    99     1 gEy
    67   200    91     1 rRg
    68   200    91     1 rRg
    69   200    91     4 rEACYs
    69   204    99     1 gEy
    70   200    91     3 rDRAy
    70   204    98     1 dKd
    71   200    91     4 rEACYs
    71   204    99     1 gEy
    73   200    91     3 rDRGy
    74   200    91     4 rDSSGy
    75   200    91     4 rPRSTl
    75   204    99     1 tDw
    76   208    99     2 rREd
    77   190    81     7 rQITTVVAr
    78   200    91     3 rRGAy
    78   204    98     1 qAy
    79   208   115     3 rWGNy
    80   200    91     6 rPRSTLIt
    83   208    99     6 rHINYRYd
    85   200    91     1 rRg
    86   200    91     2 rSYy
    87   200    91     3 rHRDy
    87   204    98     1 rGf
    89   200    91     2 rSYy
    90   200    91     2 rSYy
    91   200    91     2 rDDy
    92   200    91     2 rSYy
    94   207   100     6 rDPPYDSs
    95   207    99     6 rDPPYDSs
    97   208    99     4 kGERWl
    98   208   118     6 kAVVRGVi
    98   212   128     1 yYy
   101   200    91     2 rSTm
   102   207    99     2 tDQt
   103   207    99     6 rDPPYDSs
   110   200    91     4 rQEDGy
   111   200    91     6 rHVRRRAr
   112   200    91     2 rSGd
   113   207   100     3 rSYSs
   114   208    99     4 rVRAAy
   116   207   100     1 rEy
   116   211   105     1 nNe
   118   211   102     1 sSe
   120   208    99     6 rDPVTGSw
   120   212   109     1 yYy
   121   167    58     1 tTy
   128   158    49     2 nNYa
   128   200    93     1 rHy
   129   200    91     3 rSTVi
   130   158    49     2 nNYa
   131   200    91     2 rWGg
   132   207   100     4 kDVQGy
   133   207   100     6 rIPPMIVv
   140   208    99     3 rDTVr
   143   207   117     6 rDTVRGKf
   143   211   127     1 yYy
   147   200    91     2 rLYy
   148   202    93     1 yRy
   150   207    98     4 tDTPRt
   151   207   100     4 kDVQGy
   152   207   100     3 rSYSs
   153   207    98     2 tDQt
   154   166    57     2 nNYa
   154   208   101     3 rRGAt
   155   166    57     2 nNYe
   155   208   101     5 rRGSMRs
   156   207    98     2 rDRf
   160   208   116     6 rPVLLWFr
   161   207    98     6 rHTVRGSw
   161   211   108     1 fPv
   162   208   118     8 tDTVRGTPRv
   170   207    98     4 tDTPRt
   171   207    99     4 kIVASn
   172   210   102     1 vNg
   173   207   100     5 rDRGYSp
   174   208    99     7 rAGSDYDFw
   174   212   110     1 yPy
   175   166    57     2 nNYa
   175   208   101     4 rRGGKe
   177   166    57     2 fNYa
   177   208   101     5 rPAQGIy
   179   208    99     4 kDLGYy
   179   212   107     1 gSq
   184   166    57     1 gSs
   185   166    57     1 sSy
   186   208   118     6 rDTVRGSl
   193   199    90     1 rHe
   194   200    91     3 rPEGl
   195   208   135     6 sGRSMATl
   196   207    99     4 kDRLEv
   197   207   100     4 kDRLEv
   198   207   100     6 rDSVWGSy
   199   207   100     5 fSTSTWp
   200   166    57     2 nNYa
   200   208   101     4 rRGASg
   206   166    57     2 nNHa
   207   208    99     2 rERy
   211   207    98     9 rDTVRTPEEGv
   214   161    52     1 gYa
   214   203    95     1 rPg
   215   210   101     1 wDv
   216   200    91     3 rPEGl
   217   158    49     2 nGYt
   217   200    93     1 rYy
   218   200    91     3 rGTGm
   219   208   112     3 kSEGf
   225   165    58     2 fGSt
   225   207   102     3 rQTLf
   226   207   100     9 kDQRGIVAVPa
   227   165    58     2 dGGt
   227   207   102     4 tRVGAi
   228   208    99     6 kGKVTTIy
   230   201    92     4 rGLSRv
   232   163    54     2 dGGt
   232   205    98     3 yYFDs
   234   208    99     2 lTQs
   235   208    99     3 vKPDd
   238   205    96     3 kLSRa
   239   208    99     4 kMLSRs
   243   208    99     7 tDKRHSEGn
   244   166    57     1 gNp
   245   166    57     1 gNp
   246   208    99     3 rNTVr
   247   208    99    12 rNTVRGSQYPEEGv
   249   166    57     2 nGGt
   252   208    99     4 rDRPLy
   253   208    99     4 rDPDIl
   254   166    57     2 hNYa
   259   158    49     2 nGYt
   259   202    95     1 lIr
   260   159    50     2 nNYa
   260   201    94     1 nGd
   261   158    49     2 nGYt
   262   158    49     2 nGYt
   268   165    58     2 fGSt
   268   207   102     3 rQTLf
   269   208    99     7 kDGNYFDSv
   269   212   110     1 yYa
   270   201    92     3 kDREl
   271   208    99     2 aGEg
   275   208    99    13 kDSQLRSLLYFDWLs
   276   163    57     1 sSy
   276   205   100     3 rDTSk
   278   166    57     1 sSy
   291   208    99     3 rDTVr
   293   207    98     8 rSPVSLVDGw
   294   166    57     2 hNYa
   295   166    57     2 hNYe
   297   158    49     2 nGYt
   298   158    49     2 nGYt
   298   200    93     2 rYNa
   302   208    99     6 kDERGRLv
   303   166    57     2 nNYe
   304   208    99     9 kDLIGKSDWEl
   304   212   112     1 yHh
   305   207    99     4 rGGDDy
   305   211   107     1 fDv
   307   208    99    13 kDSQLRSLLYFEWLs
   308   208    99    13 kDSQLRSLLYFEWLs
   309   208    99     5 rDTSFHp
   310   207    98     5 rHTKRVv
   311   205    96     9 rDTVRACWTLi
   312   206   116     8 rDTVRGSQSl
   315   208    99     3 iATVs
   319   207    98    11 rHSEGKKSRVFHy
   320   207    98     6 eTQPPWAi
   321   204    95     2 kGKv
   322   166    57     2 hNYa
   323   166    57     2 nNYa
   324   166    57     2 hNYa
   325   207    99     6 kSTAGGWc
   326   206    98     6 rAVDIWKn
   327   158    49     2 nGYt
   328   158    49     2 nGYt
   329   158    49     2 nGYt
   329   200    93     2 rYNa
   335   207   100     6 kKWPGTVl
   336   191    91    13 kAEIIYDSSGYYLPh
   338   141    32     2 sSNy
   338   208   101     5 rDTKPWe
   340   208    99     3 rHTVr
   341   207    98    10 rYTVRGKAVPRg
   342   208   118     7 kAVPGGVVq
   343   166    57     1 dGn
   343   208   100     1 rHt
   357   207    98    11 rHSEGKKSRVFHy
   358   208    99     4 kGYIWn
   359   166    57     2 nKYt
   359   208   101     4 rNYYGs
   360   166    57     2 nDYt
   360   208   101     3 rYYGs
   361   166    57     2 yDYt
   361   208   101     3 rDAYy
   365   158    49     2 nNYa
   365   200    93     4 rPDNGs
   366   208   134     4 sDWVGf
   373   208    99     6 kDTVRSVs
   374   207   100     9 rAPQYDSSAYy
   374   211   113     1 hVp
   375    31    31     1 sSs
   377   208    99     6 kDPWWRRy
   378   208    99     6 rEFLLRRn
   379   141    32     2 sSNy
   379   206    99     5 rDTKPWe
   380   208    99    13 kDSQLRSLLYFDWLs
   381   207    98     6 rYTLRRNr
   382   166    79     1 sSy
   382   208   122     9 rDTVSGTFSQp
   387   166    76     2 nSYt
   387   208   120     5 rDTVRGv
   388   166    57     1 gSn
   388   208   100     3 rDTVr
   391   166    76     2 nSYt
   391   208   120     5 rDTARGv
   392   208    99    13 gHTGGHILTSTEARl
   393   208    99     3 rIRDt
   394   208    99     9 rDGGHGFCSSa
   395   208    99     6 rDAGPYVs
   396   166    57     2 nDYt
   396   208   101     4 rDYYGs
   397   166    57     2 nDYt
   397   208   101     4 rDYYGb
   398   166    57     2 nDYt
   398   208   101     4 rDYYDy
   399   166    57     2 fDYt
   399   208   101     4 rDYYGs
   400   166    57     2 nDYt
   400   208   101     5 rDVYYGy
   401   166    76     2 hDYr
   401   208   120     5 rDADYGn
   402   166    57     2 hNYa
   403   166    76     2 nNYv
   403   208   120     5 rGYGGYs
   404   206    98     9 kCAGNSGTQSt
   409    31    31     1 sSs
   411   205    96     8 kKGSYKGGRk
   412   141    32     3 gHGHy
   412   208   102    10 aRPVRVDDISLp
   413   141    32     3 gHGGy
   413   208   102    10 vRPVRVDDISSp
   414   204    95    17 kDEFSSTRKNFLTGQSKTf
   419   208   118    10 rDTVRESSERAd
   420   208    99     5 kDRHKTl
   421   207   117    10 rDTVRERSERAd
   422   208   118    10 rDTVRESSERAd
   423   208    99     1 tDt
   424   206    97    15 rHTGDVDEDDDGDYNEd
   427   166    76     2 nSYt
   427   208   120     5 rDTARGv
   429   166    57     1 bGy
   429   208   100     1 rDi
   430   166    57     2 hNYa
   433   207    99     4 iDPGGw
   434   206    98     2 kSDa
   435   206    98     6 kCAGTWDk
   435   210   108     1 aAd
   439    31    31     1 sNs
   442   165    57     2 dGGt
   442   207   101     5 tDSREEy
   443   166    57     2 dGGt
   443   208   101    11 tGITMIIVVITTs
   445   208    99    13 aDDKKIDYGLGYYSr
   445   212   116     1 cYp
   446   141    32     3 gHGGy
   446   208   102    10 vRPVRVDDISTp
   449   207   117    10 gDTVRESSERAd
   450   208   118    10 rDTVRESSERAd
   451    30    51     8 tESILVTTLq
   452   208    99    13 kDSQLRSLLYFDWLs
   453   208    99    14 aDTVRGNVWAPEEVSe
   453   212   117     1 fDs
   458   208   118    10 rDTVRESSERAd
   459   208   118    10 rDTVRESSERAd
   460   207    99     6 rDAGPYVs
   461   208    99     4 rFRQPf
   462   208    99     6 rVTPAAAs
   463   211   102     1 vSt
   464   207    99     7 kCATDWGSc
   465   208   118    10 rDTVRESSERAd
   466   208   118    10 rDTVRERSERAd
   476   208    99    17 kDTVRPRSRCRLRLSADFl
   480   203    98     1 rAl
   480   207   103     1 lIh
   482   141    32     3 gYGGy
   482   208   102    10 aRTVRVVDISSp
   483   141    32     3 gYGGy
   483   208   102    10 aRTVRVVDISSp
   484   166    57     2 dGGt
   484   208   101    14 tDTLRKIVVVPAAMEe
   484   212   119     1 ySs
   485   166    68     1 gSt
   485   208   111    16 rHGEVSPYYEDDYGYFYt
   486   166    57     2 hNYa
   486   208   101     5 vAQIDNn
   487   206   117     4 tDTVRe
   488   208   118    12 rDTVRESSERADKn
   496   208    99     2 rTRp
   497   208    99     4 rLSVTa
   500   205    97     4 kAAGGy
   501   208   118     4 tDTVRe
   503    31    31     1 sNs
   504    31    31     1 sNs
   506    31    51     1 sSs
   507    31    51     1 sSs
   510   165    57     2 yGGt
   510   207   101    13 rDQDCTNGVCYTFGv
   512    31    53     1 rSs
   516    31    33     1 sSs
   517    31    33     1 sSs
   519   141    32     3 gYGGy
   519   208   102    10 aRTVRVVDISSp
   520   141    32     3 gYGGy
   520   208   102    10 aRTVRVVDISSp
   521   141    32     3 gYGGy
   521   208   102    10 vRTVRVVDISSp
   522    31    50     6 lNSSNQKn
   523    31    31     1 sSn
   524    31    31     1 sSg
   525   166    68     1 gSt
   525   208   111    16 rHGEVSPYYEDDYGYFYt
   526   208    99    13 kDSQLRSLLYFEWLs
   528    31    31     2 ySNn
   530   208    99     5 tGTVREs
   532   208    99     4 iGTVRe
   533    30    51     4 tPSSYs
   539    97    97     1 sTm
   542   207    99     7 kGSVGWANt
   543   202    93     1 yYy
   544   202    93     1 yYy
   546    31    31     1 sSg
   547    31    31     1 sRg
   548    31    31     4 sTSGYs
   549    31    31     4 sAFGYs
   560    31    31     4 sTSGYs
   562    23    23     1 sSn
   565    31    31     6 lYSSNQKn
   566    31    31     6 lYSSNQKn
   567    30    51     8 tESILGITLq
   569   208    99    13 kDSQLRSLLYFEWLs
   574    30    51     3 sGSSs
   575    30    51     4 sGSSYs
   575    96   121     1 lPq
   577    21    23     6 tIKYTVKi
   579   208   118     9 kDIVSGAIIGh
   580   208    99     4 rSGIAl
   581   208    99     6 kLIAVAGt
   582   206    97     3 rVSDf
   583   205    96     1 lSs
   587   207    99     8 kCIAGGCWTa
   588    31    51     4 tYSGSd
   589   200    91     2 lLRn
   590   200    91     2 rWVy
   590   204    97     1 yFy
   595    31    31     4 sTSGYs
   596    31    31     4 sTSGYs
   597    31    51     6 lYSSDNKn
   601    31    31     4 sTSSYn
   602   210   118     1 ySy
   605    31    51     4 dYDGDs
   606   208    99     1 rGr
   608   208    99    10 aGLLDVQYVRQa
   609    31    50     5 vHSTGNt
   610    31    31     6 lYSSNQKn
   611   166    57     2 nSYt
   611   208   101     5 kHEHSKt
   612   208    99     8 tDTLERVGGa
   616    30    30     4 nAFGSs
   616    96   100     1 lPq
   617    31    49     5 tDSDDDd
   618   208    99     5 aTBBFBw
   619   210   101     1 yYy
   622   207    99    12 rLATTSHTYCGSTy
   623   207    99    12 rLATTSHTYCGSTy
   624    31    51     4 tSGSYq
   625    31    51     4 tYSSYq
   626   200    91     3 rEVRr
   627   200    91     3 rDGNy
   628   200    91     2 rKRt
   629   200    91     1 rKy
   630   197    88     2 kRAy
   631   201    92     1 wLr
   632   200    91     4 rDITTv
   633   202    93     1 yGy
   634   200    91     1 rRg
   634   204    96     1 yGt
   637   200    91     4 rLMITh
   638   200    91     2 rSTr
   639   200    91     5 rWGYYGs
   641   200    91     1 rVn
   641   204    96     1 yDy
   643    97    98     2 nVVn
   644    94    97     1 sAv
   645    31    31     4 dNYGIs
   646    31    31     4 dNYGIs
   647    31    31     4 dNSGIs
   648    31    31     4 dSYGNs
   649    31    31     4 dYTGEs
   650    31    31     6 lYSSNSKn
   651    31    51     6 lYSSNNKn
   653    96    96     1 pMl
   654   208    99     8 rDRGYYSGSr
   655   208    99     8 rDRGYYSGSr
   656   208    99     1 rDk
   657    97    97     1 pLf
   658    22    22     4 dYDGDs
   658    88    92     1 fMy
   659    28    28     1 rSs
   660   208    99     2 gYDy
   661    31    51     6 lHSSNKQn
   662    31    31     6 lYSSNQKn
   667    31    51     5 tYSDGDd
   669   208   118    11 aDIMREITFSACq
   671    28    35     2 ySNn
   673    30    31     4 sTSSYs
   673    96   101     1 lPq
   675   166    76     1 gSt
   676   204   115     2 rEYa
   679   200    91     4 rFYYGs
   680   197    88     1 rNr
   680   201    93     1 yYy
   682   202    93     1 yRd
   683   200    91     2 rWAp
   683   204    97     1 yGy
   684   200    91     1 rGd
   685   203    94     1 yPy
   686    31    31     4 dNYDIn
   687    31    51     4 dSYGNs
   688    31    31     4 dSYGNs
   689    31    31     4 dYDGDs
   690    31    31     4 dYDGDs
   691    31    51     6 lYSSNNKn
   692    31    53     1 sSs
   701    31    31     4 sTSNYn
   702   202    93     4 rGWLRr
   704   208    99     1 rWd
   707   208    99     6 rGLYVVVp
   708    31    32     6 lYSSNQKn
   709    31    51     6 lYSGNQKn
   710   141    50     1 sGy
   710   207   117     1 rGy
   711    31    31     5 vHSNGNt
   716    31    33     1 gSs
   717    28    32     1 sSs
   719    30    51     4 sDSSYs
   719    96   121     1 lPq
   721   208    99     1 rDy
   725    31    51     4 tSWGRn
   726   199    90     1 rNi
   726   203    95     1 yYy
   727   200    91     1 rGt
   728   199    90     4 rDGGVw
   730   200    91     1 rGd
   731   199    90     1 rNr
   731   203    95     1 yYy
   733   200    91     6 rAWLRRGr
   734   199    90     4 rNYGSp
   735   200    91     1 sSy
   736   199    90     1 rNl
   736   203    95     1 yYy
   737   200    91     1 rGt
   741    31    31     4 dYDGDs
   742    31    31     4 dYDGDs
   743    31    31     4 sTSGYs
   744    31    31     6 lYSSNNKn
   749   208    99     2 rKDg
   751   208    99     2 rSTl
   752   208    99     2 rSLi
   753   208    99     2 rYDg
   755   208    99     1 rSd
   755   212   104     1 yDy
   756   212   105     1 yRr
   757    23    23     4 eYYGTs
   758   200    91     2 rRGa
   759    97    97     1 aGl
   760    31    31     1 sSs
   761    31    31     4 dSYGNs
   762    31    31     4 sTSGYs
   764   208   102     5 rGGYSGy
   770    28    35     2 ySNn
   774    31    51     6 ySSSNKKd
   776    31    31     6 yYQSNKKn
   777   208    99     3 rDTVr
   778   208   118     4 rYDYYg
   779    30    51     4 eIYGSn
   782    31    51     4 tSSSYq
   783   200    91     1 rVs
   785   200    91     3 rSGYr
   786   199    90     1 vIg
   788   199    90     3 rKGGt
   789   199    90     1 rKh
   790   200    91     2 rDYg
   791   207    99     4 rGRTLl
   792   200    91     1 rVs
   794   199    90     4 rNSGLr
   796    31    31     4 lESGNt
   797    30    30     2 ySNn
   799    31    32     6 lDSGDGNt
   800    31    31     5 vHSNGNt
   801    31    31     1 sGn
   802    31    31     4 vNYGVs
   803    31    31     4 dSYGNs
   805   166    76     1 nQe
   805   208   119    15 rGLSIAVQLSSSSRSPp
   807    31    31     5 lYSNGNt
   809   208    99     4 rSLYDy
   810   208   118     2 rSAy
   811   208    99     1 rEn
   812   208    99     2 rGDy
   813   207    98     4 rWAIYy
   814    31    31     4 dSSGHs
   815   207   100     3 rSSFg
   816    31    31     5 lDSDGKt
   817   208   118     1 rLg
   818    31    31     5 lHSNGFn
   819    31    31     5 vHSNGNt
   821    31    31     5 vHSNGNt
   822    31    31     5 lHSGGKt
   823    31    31    10 gSFGMYFNLVIh
   824    31    52     5 tYSDGDd
   827    31    33     6 fGSSNQKn
   828    31    31     5 lYCNNKn
   829    31    43     5 lHSNGNt
   830    31    31     5 lHSDGCt
   831    31    35     2 yNNn
   832    97    97     1 iLf
   833    22    22     2 yNNn
   835    31    31     1 dSn
   836    31    31     6 fDSSDKKd
   837    31    31     5 lHSNGYt
   838    31    31     5 lHSNRYn
   839   207    99    13 kNDDSGCNADEIDAa
   840   207    98     4 rSVYYg
   841   208   118     2 rYRl
   842    31    31     1 sTs
   843    97   117     2 hLPg
   847   199    90     2 rGYy
   848   200    91     5 rSTYYGs
   850   200    91     1 rSg
   850   204    96     1 lRp
   852   200    91     5 rSTYNGh
   853   200    91     3 rDDGk
   855   200    91     6 rRDYGVAd
   856   199    90     7 rDRGYYGSs
   857   199    90     6 tRQLGLRr
   858   200    91     2 rASy
   860   200    91     5 rHYGSSy
   861   200    91     1 rVs
   862   199    90     2 kDGl
   863   197    88     2 kNYy
   864   199    90     3 rANGy
   866   200    91     3 rGEWt
   867   197    88     3 rEGYg
   868   199    90     3 rNNPh
   869   199    90     1 rNn
   870   200    91     2 rWDy
   871   199    90     3 rQGYy
   872   199    90     5 rDDSSGy
   873   133    24     1 sGy
   874   199    90     5 rGRALLr
   876   200    91     1 rGw
   877   200    91     3 rDGDh
   878   199    90     3 kKYGs
   879   199    90     5 rAYYRYd
   880   199    90     3 rKGGt
   881   200    91     3 nYYGs
   882   199    90     4 rDEVRr
   883   199    90     5 rGRTLLr
   884   200    91     1 iYr
   885   199    90     1 rHg
   886    28    31     2 yBBb
   887    31    32     2 yENg
   887    97   100     3 sGDSf
   888    94   103     2 nVEn
   889    30    31     1 ySn
   890    31    31     6 ySSKHKVh
   891    31    31     4 lZSBGb
   892    31    31     5 lHSDGFd
   893    31    35     5 lHSNGYn
   894    31    31     5 lHSNGIt
   895    31    31     5 lHSNGNt
   896    31    31     4 dYDGDs
   897    31    31     5 vHSNGNt
   898   201    94     6 kDTVRGHh
   899    31    31     5 vISNGFt
   900    31    31     5 vHSNGNt
   901   209   100     1 yDy
   902    30    30     4 dFDGDs
   904   211   102     1 yGs
   908   207    98     4 rHYYKy
   909   208    99     2 rRTv
   910   141    32     2 tGNy
   911    31    33     5 lHSNGNn
   914   207   117     3 rSFFg
   915    31    31     6 lNSGNQKn
   916    31    31     5 vHSDGNt
   920    31    31     5 lHSSGNt
   921    31    31     5 lDSDGYt
   922    64    69     1 gSs
   923    31    31     2 yNNn
   923    97    99     1 tDt
   924    65    85    15 gSGSSLVDGIDSRFSSs
   926    31    31     5 lHSGGKt
   927   207   118     9 rGLLRGGWNDv
   928   208    99     5 rGIYYNs
   929   208   118     4 rSHYYg
   930   208    99     3 rGYGy
   932    31    51     4 tSGSYq
   934   200    91     2 rLSg
   935   200    91     2 rEDy
   936   201    92     1 fDy
   938   200    91     1 vNw
   940   200    91     3 rSYRy
   941   199    90     3 rQAYy
   943   200    91     4 gYGNSl
   944   200    91     8 rPPLLWLRRg
   946    96    97     2 bXBk
   947    31    31     5 qQSKGIt
   948    31    31     1 iSn
   950   208    99     2 rGSf
   950   212   105     1 wDw
   951   199    90     4 rGWFRr
   953   208    99     1 sYg
   954   208    99     2 rRLg
   956   208    99     4 rYDYYg
   958   208    99     4 rSYYGs
   959   208    99     2 rYYd
   960   207    98     3 rLSNw
   961   204    95     2 sSNw
   962   207    98     2 rHGd
   963   208    99    12 rALTINMAGGVFIt
   965   207   117     4 rDENSg
   965   211   125     1 yVg
   966   207   117     4 rGGIYy
   967   206   116     3 rAYRg
   967   210   123     1 yCh
   968   207   117     4 rISSGg
   970    31    35     5 lRSDDYt
   971    31    31     5 lHSNGNt
   972   208   115     7 hPVCLSPSa
   973    31    33     5 lDSDGYt
   974    31    31     5 lHSNGNt
   975    31    31     5 lHTDGRt
   976    31    34     6 lDSEDGNt
   977    31    31     5 lGSDGIt
   978    31    40     5 lHSNGNt
   980   166    58     1 gEs
   980   207   100     3 rWEVy
   981   201    94     6 rQGTGLVh
   982   199    90     3 rQGYy
   983   133    24     2 tGNy
   983   199    92     1 rLr
   984   200    91     2 rRFy
   985   199    90     1 rCh
   986   199    90     9 rNPITTVVAWa
   987   199    90     1 kTg
   988   198    89     6 rHYRYGYd
   989   194    85     6 rHYRYGYd
   990   200    91     8 rKELTTVVAt
   991   200    91     5 rSYDGYs
   992   204    95     1 yDe
   994   199    90     5 rDDYYYg
   995   199    90     4 rEEEYi
   996   207   117     2 rVGa
   996   211   123     1 yPy
   997    31    31     5 lHSNGNt
   999    31    31     5 vHSDGNt
  1000    62    62     2 gSQs
  1000    68    70     1 tDy
  1001   208   118     1 tRg
  1001   212   123     1 iTt
  1002   208    99     2 pTVd
  1003   208    99     2 pDSn
  1004   208    99     6 rTFITTVv
  1005   208    99     4 rGLYDg
  1006   208    99    10 rSQGGGRIAAAg
  1007   208    99     3 iTTVv
  1008   141    51     2 sGGl
  1008   207   119     9 rPGYGDTSVRk
  1009   207   117     4 rDSGYg
  1009   211   125     1 yGc
  1010   141    32     1 sDy
  1011    31    33     6 lYSFNQKn
  1012   141    51     2 tSGy
  1012   207   119     6 rHTVRGSh
  1013   209   120     1 yVv
  1014   207   100     3 kGTVr
  1015    31    31     8 sESTVFSSVd
  1016    31    31     5 eDSYGDt
  1017    31    31     5 lHSNGKt
  1018   205    97     8 rRDTNSAETy
  1019   205    99     7 rESQCRFKs
  1020   208    99     2 vRVi
  1021   207   117     8 sVSIYYYGRs
  1022   208    99     4 rWDYEg
  1023    97    97     1 fTh
  1024   138    29     2 tSSy
  1025   199    90     2 rRGp
  1026   199    90     5 rGRTLLr
  1027   199    90     6 rNRETYYy
  1028   199    90     3 kGTGn
  1029   199    90     3 kETGn
  1030   196    87     5 rSVRPRm
  1031   200    91     3 rEYDy
  1032   199    90     6 rNREIYYy
  1033   203    94     1 yGs
  1034   200    91     5 tGDGYDg
  1035   200    91     6 rDDYGSSy
  1036   200    91     1 rGq
  1037   200    91     2 rGGd
  1038   208   118     1 sHw
  1039   208   124     1 sHw
  1040    30    30     2 ySNn
  1040    57    59     3 gVQQd
  1040    79    84     1 qCb
  1041    31    31     5 vYRBGBt
  1042    31    31     4 nWYGNs
  1043    31    31     5 lHSDGNt
  1044   141    32     1 sGy
  1044   207    99     7 rPLYYRYDe
  1045   205    96     5 rKDYYGs
  1046   203    94     1 wDv
  1047    31    31     5 vYSDGNt
  1048   208    99     3 rGGGr
  1049   166    76     1 dDf
  1049   207   118     1 rSl
  1050   166    76     1 gEp
  1050   207   118     1 iHy
  1050   211   123     1 yGd
  1051   141    32     2 tSGm
  1052   208    99     1 rPt
  1053   141    32     2 sGSy
  1053   207   100     3 rNPYy
  1054   207   117     7 rDQPSSGVf
  1055    21    30     4 sISSIn
  1056    31    50     5 vYSDGNt
  1057    31    31     5 vHSNGNs
  1058    31    31     6 lDSEDGNt
  1059   141    51     1 tSg
  1059   207   118     4 rGTVRg
  1060   208   118     2 rHSe
  1061    31    31     6 fYSSDNKd
  1062   204   115     4 sTLAGt
  1063   208   118     1 rYy
  1065   167    77     1 rSn
  1065   207   118     1 rSd
  1066   200    91     5 sYYGSSy
  1067   199    90     3 rVEQl
  1068   199    90     2 kLIy
  1068   203    96     1 yDa
  1069   200    91     2 rMLp
  1070   199    90     2 kLIy
  1070   203    96     1 yDa
  1071   200    91     4 aRGQVt
  1072   200    91     4 gYGNSl
  1073   199    90     2 kPGy
  1074   200    91     4 pKVRRk
  1075   159    50     1 sFy
  1075   199    91     2 rSPf
  1076   199    90     2 rYMi
  1077    31    31     5 lYKDGKt
  1078    31    31     5 lYKDGKt
  1079    31    31     5 eYSDGYt
  1080   141    51     2 sTNy
  1080   207   119     2 rLGm
  1081   141    32     1 sGy
  1081   207    99     7 rPLYYRFDe
  1082   141    32     1 sGy
  1082   207    99     7 rPLYFRHDe
  1083   209   100     1 yRy
  1084   140    50     1 sGy
  1085   208    99     8 rDYTYYTYDe
  1086   208    99     5 vIYYGNs
  1087   167    77     1 sAr
  1087   207   118    11 rEMEITFGGAVSk
  1087   211   133     1 yYy
  1088   200    91     5 rSNYYGs
  1089   134    25     2 sSSy
  1089   200    93     5 rRVVGVd
  1090   207    98     3 rEWGs
  1091   207    98     1 rQa
  1092   207   117     4 gGWSWa
  1093   207    98     2 rNVy
  1094   207    98     2 rNVy
  1095    31    31     5 vYSDGNt
  1096    30    31     6 lSSGNQKn
  1097   164    56     1 nLq
  1097   204    97     3 rLTKl
  1098   166    76     1 tPy
  1098   206   117     8 iVTVYDIVLn
  1099   208   118     2 rDTv
  1100   205   114     3 tSTPh
  1101   207   100     8 rDTHFQKAMl
  1102   141    51     1 sGy
  1102   166    77     1 nLy
  1102   206   118     9 rDTVRGKAGTw
  1103   207   117     3 kDTVr
  1104   208   118     4 kDTGIf
  1104   212   126     1 ySg
  1105    31    31     6 fYSGNNKh
  1106    31    31     5 lHSNRYt
  1107   199    94     1 rIt
  1107   203    99     1 yLg
  1108   141    50     1 sGy
  1108   207   117     2 gDNd
  1109   208   118     5 rAKYIIt
  1110   141    32     1 sGy
  1110   207    99     4 vFGYDm
  1111   141    32     1 rGy
  1111   207    99     8 rLIPFSDGYy
  1112   207    98     8 rGEIVVVPAa
  1112   211   110     1 yYy
  1113   208    99     1 rGe
  1114   138    29     2 sTNy
  1114   204    97     9 rQSIDFWSGSk
  1115   138    29     2 tANy
  1115   204    97     9 rQSIDFWSGSk
  1116   208    99     8 rGSTMITNGh
  1117   133    24     2 sNSa
  1117   158    51     1 kWy
  1117   200    94     4 sGAMVr
  1118   133    24     2 tNSa
  1118   158    51     1 qWf
  1118   200    94     2 rLVg
  1119   133    24     2 sNSa
  1119   158    51     1 kWy
  1119   200    94     2 sGGp
  1119   204   100     1 yHy
  1120   207   117     8 rCSSESCWHa
  1121   166    76     1 gGn
  1121   206   117     7 rFGSGWAAa
  1122   207   117     7 tCLYRSCHt
  1123   207   117     8 rGDRSIGYYg
  1124   207   117     9 rDYSGCGRSAv
  1125   208   110    14 rEETYYEDDYDYYYPa
  1126    29    29    20 kHSDGKTYLNWLLQKPGQDGDd
  1127   141    32     2 tSSy
  1127   207   100     3 rHSEg
  1128   141    46     1 tGy
  1128   207   113     8 rHSEVTTYIh
  1129   141    51     1 tGy
  1129   207   118     4 rGTVSy
  1130   207   117     1 kDt
  1131    31    31     5 lHSNGYt
  1133   200    91     6 rGGGSTMi
  1134   200    91     5 tDIYYDy
  1135   159    50     1 sAn
  1135   199    91     3 rFALg
  1136   200    91     4 rHEANw
  1137   212   105     1 yGq
  1138   141    32     2 sNSa
  1138   166    59     1 kWy
  1138   208   102     4 rDLELl
  1139   138    29     2 tANy
  1139   204    97     9 rQSIDFWSGSk
  1140   133    24     2 sSSa
  1140   158    51     1 rWy
  1140   200    94     5 rDGAHDl
  1141   133    24     2 sSTa
  1141   158    51     1 kWl
  1141   200    94     1 rDl
  1142   207   117     1 rDg
  1142   211   122     1 wAs
  1143   207   117     5 rDIDGTv
  1144   207   117     3 eIAYy
  1145   207   117    11 rDTSARSGYANGl
  1146   207   117     7 rTWYSGCAc
  1147   207   117    11 kNGYRDGAGRYYg
  1148   207   117     9 rRTFSGGGFAv
  1149   141    32     2 sSGm
  1150   208   110    16 rIDVVITSHEDDFGDYYt
  1151   205    97     7 rLTIAHSPt
  1152   204    98    10 rYTVTEQTNFLy
  1153   208   118     5 rDTVRGs
  1154   141    51     2 tSGc
  1155    31    31     5 vDSDGDt
  1156   141    32     1 sGy
  1156   208   100     3 rDTVr
  1157   141    32     2 tSRm
  1157   207   100     6 rVVNSVMa
  1157   211   110     1 yYy
  1158   199    90     6 rITTIVVt
  1159   133    24     1 mNy
  1159   158    50     1 sNn
  1159   198    91     3 rDQLl
  1160   133    24     2 tGNy
  1160   199    92     3 rDRTi
  1161    31    31     5 lSSKGIt
  1161    97   102     3 sHSVt
  1162   141    32     2 tSGm
  1162   207   100     4 hRKSGd
  1163   167    76     1 sAy
  1163   207   117     2 rRGd
  1164   133    24     2 sNSa
  1164   158    51     1 kWy
  1165   133    24     2 sSTa
  1165   158    51     1 kWy
  1166   133    24     2 sNSa
  1166   158    51     1 kWy
  1167   133    24     2 sNSg
  1167   158    51     1 kWy
  1168   133    24     2 sNSa
  1168   158    51     1 kWy
  1169   133    24     2 sNSa
  1169   158    51     1 kWy
  1169   200    94     3 rKVSl
  1170   141    32     2 nGGy
  1170   207   100     7 rHLGHCRGv
  1170   211   111     1 yRn
  1171   141    32     2 nGGy
  1171   207   100     7 rHLGHCRGv
  1171   211   111     1 yRn
  1172   207    98     6 rNAGGDGf
  1173   208   110    16 kDDVGTPKYYEDDYGYHy
  1174   141    51     2 tSGy
  1174   207   119     9 rDTVKGRAAGg
  1175   207    98     9 rNTAEGGGREg
  1176   207   117     1 rDt
  1177    31    31     5 lHSDGKt
  1178   208   118     9 kDTVRGRSYGf
  1179    31    31     5 lYSNGLt
  1180   208    99     5 rEYGFDt
  1181   141    32     2 gETm
  1181   207   100     2 rSCg
  1182   200   114     5 sGANIEn
  1183   163    57     1 wDr
  1183   205   100    11 rDRQSPQCGEAGc
  1184   133    24     1 sDy
  1184   199    91     5 rGDGNSr
  1185   140    52     2 sNTa
  1185   146    60    29 vSSKWYRQYAPSLQSRLVTDPDTSKNQFSLq
  1185   166   109     1 tTy
  1186    31    31     5 lHSDGNt
  1187    31    31     5 lHSNGNt
  1188   141    32     2 sSSy
  1188   166    59     2 sTYs
  1188   168    63     2 gSPy
  1188   208   105     6 sPTHCSGg
  1189   133    24     2 sNSa
  1189   158    51     1 kWy
  1189   200    94     1 rQm
  1190   132    24     2 nNGa
  1190   157    51     1 tWy
  1190   199    94     5 rDMGGSg
  1191   207   117     7 sFYAREYIy
  1192   207   117    10 tRNGGYYSRGAv
  1193   208   110    17 kVTQHEEYYEDDDGYYYTs
  1194   163    57     2 gAVv
  1194   202    98     9 rGTVTEQNEEl
  1195   141    51     2 tSGy
  1195   207   119     9 rDTVRGSLYQn
  1196   166    57     1 sNy
  1196   206    98     7 rHTVRGSLl
  1197   206    98     4 rVSYDf
  1198   207    98     2 rNLi
  1199    24    30     2 yNSn
  1200   200    91     7 rEGGSYHGs
  1201    31    31     5 vYSDGKt
  1202   129    20     2 tNTg
  1202   154    47     1 kWy
  1202   196    90     5 rDMGGSg
  1203   133    24     2 tNSa
  1203   158    51     1 kWy
  1203   200    94     2 rDTv
  1204   133    24     2 sNSl
  1204   158    51     1 kWs
  1204   200    94     6 gGPGVIPa
  1205   141    32     2 tTYy
  1205   166    59     1 nAy
  1205   206   100     7 rHSENQRHs
  1206   207   117    15 kHTVRGRAGAEGGGREg
  1207   208    99    12 kDTSTCIEINSMAi
  1208   141    32     2 sTGm
  1208   204    97     6 rITVIPAp
  1209   140    32     2 rTGy
  1209   206   100    13 rGNPPPYYDIGTGSd
  1210   200    91     7 rEGGSYHGs
  1211   147    57    36 vQVQESGPGVVKPSQTLSLTCTVSRGSVTSSYWGNWIc
  1212   141    32     2 tSGm
  1212   207   100     1 qIn
  1213    24    30     2 iASn
  1213    58    66     1 gSi
  1213    64    73     1 nSa
  1214   141    32     1 sGy
  1214   166    58     1 sNn
  1214   206    99     8 rGPFYYYDGg
  1215    20    29     1 sSy
  1215    34    44     2 pWYl
  1215    47    59     2 gDGi
  1216   201    92     6 rDTVRREg
  1217   141    32     2 tDGv
  1217   208   101     2 hRHp
  1218   136    27     2 cTLg
  1218   197    90     6 rHYRYGYd
  1219   138    29     2 nCIr
  1219   157    50     1 kWy
  1219   199    93     9 sTTLNWGYEKd
  1220    24    28     2 iASn
  1220    58    64     1 aSi
  1220    64    71     1 nSa
  1221   133    24     2 tNSg
  1221   158    51     2 kWYy
  1221   199    94     7 rGAMTTVVt
  1222    24    30     2 iGSy
  1222    58    66     2 gSKs
  1223   208   118    17 rHSEESSPGAGAEGGGREe
  1224   141    32     2 tSYy
  1224   207   100     8 rGTVKGRRRk
  1225   166    57     1 dRt
  1225   207    99     9 rGAHYSDTDDs
  1226   178    73     1 sBt
  1226   198    94     4 rGHTGl
  1226   202   102     1 lKs
  1227   208    99    12 rDTVRGNQRIGLVw
  1228    21    30     2 iGSy
  1228    55    66     1 gSi
  1228    61    73     1 nSa
  1230   133    24     2 sNSa
  1230   158    51     1 kRy
  1230   200    94     2 iYSs
  1231   141    32     1 sSy
  1231   205    97     7 rDSVERASe
  1232   166    57     1 dPf
  1232   168    60     1 qGv
  1232   206    99     7 rEWKGQVNv
  1233   141    32     2 tSGv
  1233   207   100     9 hRPPWRFTGNl
  1234    28    47     2 mGSy
  1234    57    78    12 gTGFTDRFKPSRDt
  1234    88   121     1 aTf
//