Complet list of 1acy hssp fileClick here to see the 3D structure Complete list of 1acy.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1ACY
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-08-06
HEADER     COMPLEX(ANTIBODY/HIV-1 FRAGMENT)        10-FEB-94   1ACY
COMPND      MOLECULE: IGG1-KAPPA 59.1 FAB (LIGHT CHAIN);
SOURCE      ORGANISM_SCIENTIFIC: MUS MUSCULUS;
AUTHOR     J.B.GHIARA,I.A.WILSON
DBREF      1ACY H  114   226  UNP    P01869   IGH1M_MOUSE      1    100
DBREF      1ACY P  308   332  UNP    P05877   ENV_HV1MN      306    328
DBREF      1ACY L    1   211  PDB    1ACY     1ACY             1    211
SEQLENGTH   436
NCHAIN        2 chain(s) in 1ACY data set
NALIGN      426
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : Q66JS7_MOUSE2HFE    0.87  0.94    1  215   21  235  215    0    0  238  Q66JS7     Igk protein OS=Mus musculus GN=Igkv3-7 PE=1 SV=1
    2 : Q52L64_MOUSE1H3P    0.81  0.91    1  215   21  237  217    2    2  240  Q52L64     ENSMUSG00000076577 protein OS=Mus musculus GN=Igkv8-30 PE=1 SV=1
    3 : A0N7J3_9MURI        0.80  0.90    1  215    1  216  216    1    1  219  A0N7J3     Mc5 VLCL (Fragment) OS=Mus sp. GN=Mc5 VLCL PE=2 SV=1
    4 : A2NHM3_MOUSE1ZEA    0.80  0.91    1  215    1  216  216    1    1  219  A2NHM3     If kappa light chain (Fragment) OS=Mus musculus GN=Igkc PE=1 SV=1
    5 : A2P1G9_MOUSE        0.80  0.90    1  215    1  216  216    1    1  219  A2P1G9     Kappa light chain (Fragment) OS=Mus musculus GN=Igkc PE=2 SV=1
    6 : Q65ZC0_MOUSE2GK0    0.80  0.91    1  215    1  216  216    1    1  219  Q65ZC0     Kappa light chain C_region (Fragment) OS=Mus musculus GN=Igkc PE=2 SV=1
    7 : A0A5E3_MOUSE        0.79  0.90    1  215   23  234  215    2    3  237  A0A5E3     LOC100046793 protein OS=Mus musculus GN=Gm10880 PE=2 SV=1
    8 : I6L9E1_MOUSE        0.79  0.89    1  215   23  233  215    1    4  236  I6L9E1     Uncharacterized protein OS=Mus musculus PE=2 SV=1
    9 : Q58EU8_MOUSE        0.79  0.91    1  215   21  236  216    1    1  239  Q58EU8     Igk protein OS=Mus musculus GN=Igkv1-133 PE=2 SV=1
   10 : Q5XFY8_MOUSE3OZ9    0.79  0.88    1  215   23  232  215    2    5  235  Q5XFY8     Uncharacterized protein OS=Mus musculus GN=Gm1499 PE=1 SV=1
   11 : I6L9E2_MOUSE        0.78  0.88    1  215   23  232  215    2    5  235  I6L9E2     Uncharacterized protein OS=Mus musculus PE=2 SV=1
   12 : I6L971_MOUSE        0.77  0.89    1  215   20  230  215    2    4  233  I6L971     Uncharacterized protein (Fragment) OS=Mus musculus GN=Igkj1 PE=2 SV=1
   13 : I6L991_MOUSE        0.77  0.89    1  215   21  231  215    1    4  234  I6L991     Uncharacterized protein OS=Mus musculus PE=2 SV=1
   14 : Q52L95_MOUSE        0.77  0.88    1  215   23  233  215    2    4  236  Q52L95     Igk protein OS=Mus musculus GN=Igkc PE=2 SV=1
   15 : Q7TS98_MOUSE4KVC    0.77  0.88    1  215   23  233  215    1    4  236  Q7TS98     Anti-colorectal carcinoma light chain OS=Mus musculus GN=Gm16939 PE=1 SV=1
   16 : I6L958_MOUSE        0.76  0.89    1  215   21  231  215    2    4  234  I6L958     Igk protein OS=Mus musculus GN=Igk PE=2 SV=1
   17 : I6L978_MOUSE3VRL    0.75  0.89    1  215   21  231  215    2    4  234  I6L978     Igk protein OS=Mus musculus GN=Igk PE=1 SV=1
   18 : A0N7J2_9MURI3VRL    0.69  0.83  217  437    1  216  222    3    7  219  A0N7J2     Mc5 VHCH1 (Fragment) OS=Mus sp. GN=Mc5 VHCH1 PE=1 SV=1
   19 : Q5M842_RAT  1ZAN    0.68  0.85  217  437   20  236  222    4    6  458  Q5M842     IgG-2a protein OS=Rattus norvegicus GN=IgG-2a PE=1 SV=1
   20 : I6L985_MOUSE        0.67  0.81  217  437   20  245  228    4    9  469  I6L985     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
   21 : Q4KM66_RAT  1ZAN    0.67  0.87    1  215   21  231  215    2    4  234  Q4KM66     LOC500183 protein OS=Rattus norvegicus GN=LOC500183 PE=1 SV=1
   22 : Q4VBH1_RAT  2HLF    0.66  0.83  217  437   20  241  224    3    5  467  Q4VBH1     Ighg protein OS=Rattus norvegicus GN=Ighg PE=2 SV=1
   23 : Q99LC4_MOUSE2NTF    0.66  0.81  217  437   20  239  222    2    3  463  Q99LC4     Igh protein OS=Mus musculus GN=Ighg1 PE=1 SV=1
   24 : B2RZB2_RAT          0.65  0.87    1  215   20  230  215    1    4  233  B2RZB2     Uncharacterized protein OS=Rattus norvegicus PE=2 SV=1
   25 : Q5I0J0_RAT          0.65  0.82  217  437   20  239  222    2    3  465  Q5I0J0     Immunoglobulin heavy chain (Gamma polypeptide) OS=Rattus norvegicus GN=Ighg PE=2 SV=1
   26 : Q569B4_RAT  2J4W    0.64  0.80  217  437   20  242  225    4    6  468  Q569B4     Ighg protein OS=Rattus norvegicus GN=Ighg PE=1 SV=1
   27 : Q5M7V3_RAT          0.64  0.83  217  437   20  239  222    2    3  461  Q5M7V3     LOC367586 protein OS=Rattus norvegicus GN=IgG-2a PE=2 SV=1
   28 : Q66K04_MOUSE        0.64  0.79  217  437   20  241  224    3    5  471  Q66K04     Igh protein OS=Mus musculus GN=Igh-1a PE=2 SV=1
   29 : Q91Z05_MOUSE1T66    0.64  0.81  217  436   20  236  221    3    5  473  Q91Z05     Ighg protein OS=Mus musculus GN=Ighg PE=1 SV=1
   30 : Q5BK05_RAT          0.63  0.81  217  437   20  236  222    3    6  458  Q5BK05     LOC367586 protein OS=Rattus norvegicus GN=IgG-2a PE=2 SV=1
   31 : HVM63_MOUSE 1ZAN    0.62  0.80  217  437    1  220  224    4    7  237  P84751     Ig heavy chain Mem5 (Fragment) OS=Mus musculus PE=1 SV=1
   32 : I3LAQ0_PIG          0.62  0.82    2  215   22  235  214    0    0  240  I3LAQ0     Uncharacterized protein OS=Sus scrofa GN=IGKC PE=4 SV=1
   33 : Q505N9_MOUSE1MVU    0.62  0.80  217  437   20  238  222    3    4  468  Q505N9     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   34 : Q5BJZ2_RAT  2G60    0.62  0.82  217  437   20  236  222    3    6  458  Q5BJZ2     LOC367586 protein OS=Rattus norvegicus GN=IgG-2a PE=2 SV=1
   35 : Q6GMX6_HUMAN1ZA6    0.62  0.78  217  437   20  236  222    3    6  465  Q6GMX6     IGH@ protein OS=Homo sapiens GN=IGH@ PE=1 SV=1
   36 : I7G9T4_MACFA        0.61  0.79  217  437   20  242  224    4    4  474  I7G9T4     Macaca fascicularis brain cDNA clone: QtrA-18020, similar to human similar to FLJ27099 protein (LOC388078), mRNA, RefSeq: XM_370835.1 OS=Macaca fascicularis PE=2 SV=1
   37 : F6Z2Q3_CALJA        0.60  0.80    1  215   21  232  216    2    5  235  F6Z2Q3     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   38 : F7A2K7_MACMU        0.60  0.78    1  215   23  234  216    2    5  237  F7A2K7     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
   39 : Q569W9_MOUSE3OZ9    0.60  0.80  217  437   20  238  222    3    4  468  Q569W9     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   40 : Q6GMX0_HUMAN2D7T    0.60  0.82    1  215   23  233  215    1    4  236  Q6GMX0     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
   41 : Q6PJA7_MOUSE3CMO    0.60  0.80  217  437   20  242  225    3    6  472  Q6PJA7     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   42 : Q8TCD0_HUMAN3PGF    0.60  0.81    1  215   21  236  216    1    1  239  Q8TCD0     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
   43 : Q9D8L4_MOUSE1F11    0.60  0.82  217  437   20  238  222    3    4  473  Q9D8L4     Putative uncharacterized protein OS=Mus musculus GN=Ighg2a PE=1 SV=1
   44 : F6WEL0_CALJA        0.59  0.79    1  215   23  234  217    4    7  237  F6WEL0     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   45 : F7A2J9_MACMU        0.59  0.78    1  215   21  232  216    2    5  235  F7A2J9     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
   46 : F7E8F0_CALJA        0.59  0.81    1  215   23  234  216    2    5  237  F7E8F0     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   47 : F7EKL6_CALJA        0.59  0.80    1  215   23  234  216    2    5  237  F7EKL6     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   48 : F7EKS1_CALJA        0.59  0.80    1  215   25  236  216    2    5  239  F7EKS1     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   49 : G1LUD1_AILME        0.59  0.80    1  215   21  236  216    1    1  239  G1LUD1     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
   50 : M3YD79_MUSPF        0.59  0.79    1  215   21  237  217    2    2  244  M3YD79     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
   51 : Q0KKI6_HUMAN        0.59  0.80    1  215    1  216  216    1    1  219  Q0KKI6     Immunoblobulin light chain (Fragment) OS=Homo sapiens PE=2 SV=1
   52 : Q569X1_MOUSE1MPA    0.59  0.76  217  436   20  239  222    3    4  476  Q569X1     Ighg protein OS=Mus musculus GN=Ighg PE=1 SV=1
   53 : Q5EFE6_HUMAN        0.59  0.79    2  215   22  231  216    3    8  234  Q5EFE6     Anti-RhD monoclonal T125 kappa light chain (Precursor) OS=Homo sapiens PE=2 SV=1
   54 : Q7Z3Y4_HUMAN1L7I    0.59  0.80    1  215   23  233  215    1    4  236  Q7Z3Y4     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
   55 : Q8R3H6_MOUSE        0.59  0.81  217  436   20  237  221    3    4  474  Q8R3H6     Ighg protein OS=Mus musculus GN=Ighg PE=2 SV=1
   56 : E2RCC8_CANFA        0.58  0.78  217  437   20  239  223    4    5  473  E2RCC8     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
   57 : F6SRA2_CALJA        0.58  0.79    1  215   21  233  217    3    6  236  F6SRA2     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   58 : F6V7T7_CALJA        0.58  0.79    1  215   21  236  220    5    9  239  F6V7T7     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   59 : M3XG21_FELCA        0.58  0.81    1  215   21  237  217    2    2  240  M3XG21     Uncharacterized protein OS=Felis catus PE=4 SV=1
   60 : Q58E56_MOUSE        0.58  0.81  217  437   20  242  225    3    6  477  Q58E56     Igh protein OS=Mus musculus GN=Ighg2c PE=2 SV=1
   61 : Q6PF95_MOUSE1XGY    0.58  0.77  217  437   20  234  222    4    8  464  Q6PF95     Igh protein OS=Mus musculus GN=Igh-1a PE=1 SV=1
   62 : Q6PIL8_HUMAN3DVN    0.58  0.79    1  215   21  233  216    2    4  236  Q6PIL8     IGK@ protein OS=Homo sapiens GN=IGK@ PE=1 SV=1
   63 : Q6PIP8_MOUSE4KVC    0.58  0.77  217  437   20  234  224    5   12  464  Q6PIP8     Igh protein OS=Mus musculus GN=Igh-1a PE=1 SV=1
   64 : Q6PJB2_MOUSE1YNK    0.58  0.78  217  437   20  235  223    4    9  465  Q6PJB2     Igh protein OS=Mus musculus GN=Igh-1a PE=1 SV=1
   65 : A8K008_HUMAN3CFJ    0.57  0.77  217  437   20  243  226    5    7  472  A8K008     cDNA FLJ78387 OS=Homo sapiens PE=2 SV=1
   66 : F1MH40_BOVIN        0.57  0.77    1  215   21  237  219    4    6  240  F1MH40     Uncharacterized protein OS=Bos taurus PE=2 SV=2
   67 : F6TEC6_CALJA        0.57  0.79    1  215   21  232  216    2    5  235  F6TEC6     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   68 : K7G0P2_PELSI        0.57  0.74    1  204   23  230  208    4    4  244  K7G0P2     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
   69 : Q6N089_HUMAN1U6A    0.57  0.78  217  437   20  243  226    4    7  472  Q6N089     Putative uncharacterized protein DKFZp686P15220 OS=Homo sapiens GN=DKFZp686P15220 PE=1 SV=1
   70 : Q6N093_HUMAN2HFG    0.57  0.77  247  437    1  192  193    3    3  417  Q6N093     Putative uncharacterized protein DKFZp686I04196 (Fragment) OS=Homo sapiens GN=DKFZp686I04196 PE=1 SV=1
   71 : Q6P5S8_HUMAN2NY0    0.57  0.78    1  215   21  233  217    3    6  236  Q6P5S8     IGK@ protein OS=Homo sapiens GN=IGK@ PE=1 SV=1
   72 : F1MZ96_BOVIN        0.56  0.79    1  215   21  237  217    2    2  240  F1MZ96     Uncharacterized protein OS=Bos taurus PE=2 SV=2
   73 : F1PNY2_CANFA        0.56  0.79    1  215   21  235  218    4    6  238  F1PNY2     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
   74 : F7F0D6_MACMU        0.56  0.75  217  437    4  234  231    3   10  466  F7F0D6     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=2 SV=1
   75 : Q6MZX7_HUMAN        0.56  0.78  217  437   27  250  224    2    3  476  Q6MZX7     Putative uncharacterized protein DKFZp686M24218 OS=Homo sapiens GN=DKFZp686M24218 PE=1 SV=1
   76 : Q6PJF2_HUMAN2AGJ    0.56  0.78    1  215   21  232  218    4    9  235  Q6PJF2     IGK@ protein OS=Homo sapiens GN=IGK@ PE=1 SV=1
   77 : Q05B55_BOVIN        0.55  0.78    1  215   21  237  219    4    6  240  Q05B55     IGK protein OS=Bos taurus GN=IGK PE=2 SV=1
   78 : Q5EFE5_HUMAN        0.55  0.76  217  437   20  246  229    4   10  475  Q5EFE5     Anti-RhD monoclonal T125 gamma1 heavy chain (Precursor) OS=Homo sapiens PE=2 SV=1
   79 : B0JYP6_BOVIN        0.54  0.77    1  215   21  237  219    4    6  240  B0JYP6     IGK protein OS=Bos taurus GN=IGK PE=2 SV=1
   80 : F6RL33_MACMU        0.54  0.77  217  437   20  238  223    4    6  470  F6RL33     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
   81 : F7ATB8_CALJA        0.54  0.76    1  215   23  228  216    3   11  231  F7ATB8     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   82 : G1THZ6_RABIT        0.54  0.75  222  436   24  232  216    4    8  458  G1THZ6     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100009097 PE=4 SV=1
   83 : G3SC88_GORGO        0.54  0.76    1  215   21  237  217    2    2  240  G3SC88     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
   84 : Q68CN4_HUMAN        0.54  0.74  217  437   20  245  228    4    9  470  Q68CN4     Putative uncharacterized protein DKFZp686E23209 OS=Homo sapiens GN=DKFZp686E23209 PE=1 SV=2
   85 : Q6MZU6_HUMAN        0.54  0.75  217  437   20  239  224    5    7  464  Q6MZU6     Putative uncharacterized protein DKFZp686C15213 OS=Homo sapiens GN=DKFZp686C15213 PE=1 SV=1
   86 : F6RL43_MACMU        0.53  0.76  217  437   20  237  223    4    7  469  F6RL43     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
   87 : F6RL61_MACMU        0.53  0.76  217  437   20  242  225    4    6  474  F6RL61     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
   88 : F6SFX9_MONDO        0.53  0.79    1  215   17  234  218    3    3  237  F6SFX9     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
   89 : F6ZEZ0_CALJA        0.53  0.75    1  170   23  189  171    2    5  190  F6ZEZ0     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   90 : F7D7L3_MACMU        0.53  0.76  217  437   20  243  226    4    7  475  F7D7L3     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
   91 : G1RH32_NOMLE        0.53  0.75  217  437   56  273  223    4    7  287  G1RH32     Uncharacterized protein OS=Nomascus leucogenys PE=4 SV=2
   92 : L8AXL3_PIG          0.53  0.73  217  437   20  239  223    4    5  466  L8AXL3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
   93 : L8B0U1_PIG          0.53  0.73  217  437   20  240  223    3    4  467  L8B0U1     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
   94 : L8B0W5_PIG          0.53  0.72  217  437   20  243  226    4    7  470  L8B0W5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
   95 : L8B180_PIG          0.53  0.72  217  431   20  235  218    4    5  464  L8B180     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
   96 : L8HT76_BOSMU        0.53  0.74    3  215   30  246  221    4   12  249  L8HT76     Ig kappa chain C region OS=Bos grunniens mutus GN=M91_09392 PE=4 SV=1
   97 : Q6MZQ6_HUMAN        0.53  0.74  217  437   20  246  229    4   10  475  Q6MZQ6     Putative uncharacterized protein DKFZp686G11190 OS=Homo sapiens GN=DKFZp686G11190 PE=1 SV=1
   98 : Q6N030_HUMAN2NY1    0.53  0.73  217  437   20  242  225    4    6  518  Q6N030     Putative uncharacterized protein DKFZp686I15212 OS=Homo sapiens GN=DKFZp686I15212 PE=1 SV=1
   99 : Q6N096_HUMAN        0.53  0.74  217  437   20  237  223    4    7  466  Q6N096     Putative uncharacterized protein DKFZp686I15196 OS=Homo sapiens GN=DKFZp686I15196 PE=2 SV=1
  100 : Q7Z351_HUMAN3PGF    0.53  0.73  217  437   20  253  236    4   17  482  Q7Z351     Putative uncharacterized protein DKFZp686N02209 OS=Homo sapiens GN=DKFZp686N02209 PE=2 SV=1
  101 : F7E0L9_MACMU        0.52  0.74  217  437   20  246  229    4   10  547  F7E0L9     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  102 : F7H602_MACMU        0.52  0.74  217  437   20  248  231    4   12  480  F7H602     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  103 : F7HL06_MACMU        0.52  0.75  217  437   20  244  227    4    8  476  F7HL06     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  104 : L8B0R9_PIG          0.52  0.72  217  431   20  226  217    4   12  455  L8B0R9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  105 : L8B0S2_PIG          0.52  0.69  217  431   20  241  225    5   13  469  L8B0S2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  106 : L8B0U3_PIG          0.52  0.74  217  437   20  242  225    4    6  469  L8B0U3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  107 : L8B157_PIG          0.52  0.71  217  437   20  247  230    5   11  474  L8B157     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  108 : L8B165_PIG          0.52  0.72  217  435   20  233  221    5    9  462  L8B165     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  109 : Q5EBM2_HUMAN        0.52  0.74  217  437   20  243  226    4    7  519  Q5EBM2     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  110 : Q6MZV7_HUMAN        0.52  0.76  217  437   20  244  227    4    8  473  Q6MZV7     Putative uncharacterized protein DKFZp686C11235 OS=Homo sapiens GN=DKFZp686C11235 PE=1 SV=1
  111 : Q6N094_HUMAN        0.52  0.72  217  437   20  251  234    4   15  480  Q6N094     Putative uncharacterized protein DKFZp686O01196 OS=Homo sapiens GN=DKFZp686O01196 PE=1 SV=1
  112 : Q6N095_HUMAN2NXY    0.52  0.74  217  437   20  246  230    5   12  475  Q6N095     Putative uncharacterized protein DKFZp686K03196 OS=Homo sapiens GN=DKFZp686K03196 PE=1 SV=1
  113 : Q7Z374_HUMAN        0.52  0.72  217  423   32  241  213    8    9  492  Q7Z374     Putative uncharacterized protein DKFZp686C02218 (Fragment) OS=Homo sapiens GN=DKFZp686C02218 PE=1 SV=1
  114 : A4F255_HUMAN2QAD    0.51  0.74  220  437    1  228  230    4   14  234  A4F255     Immunoblobulin G1 Fab heavy chain variable region (Fragment) OS=Homo sapiens GN=VHCH1 PE=2 SV=1
  115 : F7HQW4_MACMU        0.51  0.72  217  437   20  249  232    5   13  481  F7HQW4     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  116 : L8AXK8_PIG          0.51  0.72  217  435   20  239  222    4    5  473  L8AXK8     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  117 : L8AXL9_PIG          0.51  0.71  217  437   20  245  228    4    9  472  L8AXL9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  118 : L8AXM9_PIG          0.51  0.71  217  437   20  245  228    5    9  472  L8AXM9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  119 : L8B0S7_PIG          0.51  0.70  217  437   20  253  236    5   17  480  L8B0S7     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  120 : L8B0T2_PIG          0.51  0.71  217  437   20  244  227    4    8  471  L8B0T2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  121 : L8B0V2_PIG          0.51  0.72  217  435   20  244  227    4   10  478  L8B0V2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  122 : L8B0V6_PIG          0.51  0.71  217  435   20  245  228    3   11  474  L8B0V6     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  123 : L8B0V9_PIG          0.51  0.71  217  435   20  244  227    4   10  478  L8B0V9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  124 : L8B0W9_PIG          0.51  0.71  217  436   20  246  229    5   11  470  L8B0W9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  125 : L8B130_PIG          0.51  0.70  217  435   20  244  227    4   10  478  L8B130     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  126 : L8B173_PIG          0.51  0.72  217  437   20  242  224    4    4  469  L8B173     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  127 : Q6N097_HUMAN        0.51  0.71  217  437   20  252  235    4   16  481  Q6N097     Putative uncharacterized protein DKFZp686H20196 OS=Homo sapiens GN=DKFZp686H20196 PE=2 SV=1
  128 : Q7Z379_HUMAN        0.51  0.73  217  423   19  227  212    7    8  478  Q7Z379     Putative uncharacterized protein DKFZp686K04218 (Fragment) OS=Homo sapiens GN=DKFZp686K04218 PE=1 SV=1
  129 : G1KAJ9_ANOCA        0.50  0.67    1  215   26  236  218    5   10  241  G1KAJ9     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=2
  130 : L8AXM5_PIG          0.50  0.70  217  437   20  245  228    4    9  472  L8AXM5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  131 : L8B0U8_PIG          0.50  0.71  217  437   20  238  223    4    6  465  L8B0U8     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  132 : L8B0W0_PIG          0.50  0.72  217  437   20  233  223    4   11  460  L8B0W0     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  133 : L8B0X5_PIG          0.50  0.69  217  437   20  248  231    5   12  475  L8B0X5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  134 : L8B0Y0_PIG          0.50  0.70  217  437   20  244  227    3    8  471  L8B0Y0     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  135 : L8B0Y6_PIG          0.50  0.70  217  437   20  248  231    4   12  475  L8B0Y6     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  136 : L8B149_PIG          0.50  0.71  217  437   20  247  230    5   11  474  L8B149     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  137 : Q5HZC6_XENTR        0.50  0.72    1  204   22  226  205    1    1  239  Q5HZC6     LOC734128 protein (Fragment) OS=Xenopus tropicalis GN=LOC734128 PE=2 SV=1
  138 : Q6NTU5_XENLA        0.50  0.72    1  204   26  230  205    1    1  243  Q6NTU5     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  139 : F6TGA0_XENTR        0.49  0.69    1  204   26  226  206    3    7  239  F6TGA0     Uncharacterized protein OS=Xenopus tropicalis GN=LOC734128 PE=4 SV=1
  140 : L8B0T7_PIG          0.49  0.69  217  437   20  249  232    5   13  476  L8B0T7     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  141 : L8B139_PIG          0.49  0.72  217  437   20  238  223    4    6  465  L8B139     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  142 : Q5RE17_PONAB        0.49  0.71  217  437   20  246  229    4   10  475  Q5RE17     Putative uncharacterized protein DKFZp469C2335 OS=Pongo abelii GN=DKFZp469C2335 PE=2 SV=1
  143 : Q5U413_MOUSE        0.49  0.69  217  429   19  232  217    6    7  483  Q5U413     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  144 : L8AXK3_PIG          0.48  0.71  217  437   20  244  227    4    8  471  L8AXK3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  145 : L8B0W4_PIG          0.47  0.65  217  437   20  254  237    5   18  481  L8B0W4     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  146 : Q4V801_XENLA        0.47  0.68  220  435   22  239  221    7    8  560  Q4V801     LOC398774 protein OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
  147 : F7AXD1_CALJA        0.46  0.69  217  437   20  237  225    7   11  465  F7AXD1     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  148 : F7E1E8_CALJA        0.46  0.69  217  437   20  242  230    8   16  470  F7E1E8     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  149 : Q99M22_MOUSE        0.46  0.66  217  429   19  229  217    7   10  479  Q99M22     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  150 : A5D7Q2_BOVIN        0.45  0.68  217  429   20  237  222    7   13  487  A5D7Q2     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  151 : F6XE80_CALJA        0.45  0.68  217  437   20  239  230    8   19  467  F6XE80     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  152 : F7HBI3_CALJA        0.45  0.66  217  423   20  224  214    9   16  487  F7HBI3     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  153 : Q8NCL6_HUMAN        0.45  0.67  217  423   20  229  213    8    9  493  Q8NCL6     cDNA FLJ90170 fis, clone MAMMA1000370, highly similar to Ig alpha-1 chain C region OS=Homo sapiens PE=1 SV=1
  154 : A1L3I1_XENLA        0.44  0.68  217  435   20  241  224    6    7  562  A1L3I1     LOC398774 protein OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
  155 : F7GMQ8_MACMU        0.44  0.63   11  206   29  223  202    5   13  234  F7GMQ8     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  156 : G1RZR1_NOMLE        0.44  0.64   13  206   62  254  199    5   11  265  G1RZR1     Uncharacterized protein OS=Nomascus leucogenys GN=LOC100589708 PE=4 SV=2
  157 : L5KG32_PTEAL        0.44  0.61    1  215   21  213  218    4   28  216  L5KG32     Ig kappa chain C region OS=Pteropus alecto GN=PAL_GLEAN10002463 PE=4 SV=1
  158 : Q6MZV6_HUMAN        0.44  0.69  217  423   20  228  214    9   12  479  Q6MZV6     Putative uncharacterized protein DKFZp686L19235 OS=Homo sapiens GN=DKFZp686L19235 PE=2 SV=1
  159 : Q96K68_HUMAN        0.44  0.68  217  423   20  230  215    9   12  494  Q96K68     cDNA FLJ14473 fis, clone MAMMA1001080, highly similar to Homo sapiens SNC73 protein (SNC73) mRNA OS=Homo sapiens PE=2 SV=1
  160 : F6QQP0_MACMU        0.43  0.63   11  206   29  222  201    5   12  233  F6QQP0     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  161 : F6W0E5_MACMU        0.43  0.63   14  206   32  228  199    4    8  239  F6W0E5     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  162 : F6YZ67_CALJA        0.43  0.67  217  437   20  238  230    8   20  466  F6YZ67     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  163 : F7DKI0_MACMU        0.43  0.63   14  206   32  226  199    5   10  237  F7DKI0     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  164 : F7GMK4_MACMU        0.43  0.63   11  206   29  223  202    5   13  234  F7GMK4     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  165 : F7GMQ6_MACMU        0.43  0.63   11  206   29  222  200    5   10  233  F7GMQ6     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  166 : G7PHD1_MACFA        0.43  0.63   14  206   32  228  199    4    8  239  G7PHD1     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_02501 PE=4 SV=1
  167 : H3A3U7_LATCH        0.43  0.67    1  215   22  238  223    6   14  241  H3A3U7     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  168 : Q569B8_RAT          0.43  0.69  217  436   17  241  227    6    9  590  Q569B8     Igh-6 protein OS=Rattus norvegicus GN=Rwdd4 PE=2 SV=1
  169 : Q5U472_MOUSE        0.43  0.66  217  429   20  233  218    7    9  484  Q5U472     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  170 : Q6GMX4_HUMAN4D9L    0.43  0.64    1  206   20  225  212    7   12  236  Q6GMX4     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  171 : Q6INK3_XENLA        0.43  0.66  217  434   20  236  224    8   13  584  Q6INK3     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  172 : Q6N041_HUMAN        0.43  0.68  217  429   35  253  223    9   14  498  Q6N041     Putative uncharacterized protein DKFZp686O16217 (Fragment) OS=Homo sapiens GN=DKFZp686O16217 PE=2 SV=1
  173 : Q6N092_HUMAN        0.43  0.68  217  429   44  261  221    8   11  519  Q6N092     Putative uncharacterized protein DKFZp686K18196 (Fragment) OS=Homo sapiens GN=DKFZp686K18196 PE=1 SV=1
  174 : Q6P089_HUMAN        0.43  0.69  217  423   20  229  214    9   11  480  Q6P089     IGH@ protein OS=Homo sapiens GN=IGH@ PE=1 SV=1
  175 : Q8N355_HUMAN4HK0    0.43  0.66    8  206   26  223  203    4    9  234  Q8N355     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  176 : Q96E61_HUMAN        0.43  0.62    8  206   26  225  206    6   13  236  Q96E61     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  177 : A5PK72_BOVIN        0.42  0.62    8  206   26  225  202    4    5  236  A5PK72     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  178 : F7GMQ3_MACMU        0.42  0.63   14  206   32  225  199    5   11  236  F7GMQ3     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  179 : F7GMQ4_MACMU        0.42  0.63   14  206   32  225  199    5   11  236  F7GMQ4     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  180 : F7HM36_MACMU        0.42  0.63   14  206   32  224  198    5   10  235  F7HM36     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  181 : G3RQ12_GORGO        0.42  0.60   12  206   30  226  202    4   12  237  G3RQ12     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  182 : G3RVT8_GORGO        0.42  0.60   12  206   30  226  202    4   12  237  G3RVT8     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
  183 : Q58E53_MOUSE        0.42  0.66  217  429   20  236  219    6    8  487  Q58E53     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  184 : Q58E54_MOUSE        0.42  0.66  217  429   20  234  218    7    8  485  Q58E54     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  185 : Q5M8X4_XENTR        0.42  0.68  217  434   20  236  222    6    9  367  Q5M8X4     Uncharacterized protein OS=Xenopus tropicalis GN=MGC108125 PE=2 SV=1
  186 : Q5VLR6_RAT          0.42  0.65  217  429   20  235  218    7    7  482  Q5VLR6     BWK3 OS=Rattus norvegicus GN=LOC366772 PE=2 SV=1
  187 : Q6GMV8_HUMAN        0.42  0.63    8  206   26  223  204    5   11  234  Q6GMV8     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  188 : Q6GMW3_HUMAN        0.42  0.64    8  206   26  223  205    5   13  234  Q6GMW3     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  189 : Q6GMX3_HUMAN        0.42  0.63    8  206   26  225  206    6   13  236  Q6GMX3     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  190 : Q6IPQ0_HUMAN        0.42  0.63   14  206   32  225  197    5    7  236  Q6IPQ0     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  191 : Q6NS95_HUMAN        0.42  0.63    8  206   26  223  204    5   11  234  Q6NS95     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  192 : Q6P5S3_HUMAN        0.42  0.63   11  206   29  225  199    5    5  236  Q6P5S3     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  193 : Q8NEJ1_HUMAN        0.42  0.63    8  206   26  225  205    5   11  236  Q8NEJ1     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  194 : Q91X92_MOUSE        0.42  0.66  217  429   20  231  218    9   11  482  Q91X92     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  195 : A2NUT2_HUMAN        0.41  0.64    8  206   26  224  205    5   12  235  A2NUT2     Lambda-chain (AA -20 to 215) (Precursor) OS=Homo sapiens PE=2 SV=1
  196 : C6KXN3_HUMAN4AJ0    0.41  0.62   14  206   32  221  195    4    7  232  C6KXN3     Lambda light chain of human immunoglobulin surface antigen-related protein (Fragment) OS=Homo sapiens GN=IgLC-rG PE=1 SV=1
  197 : F1MLW8_BOVIN        0.41  0.61   11  206   29  222  202    6   14  233  F1MLW8     Uncharacterized protein OS=Bos taurus GN=LOC100847119 PE=4 SV=2
  198 : F7I7D9_CALJA        0.41  0.64    8  206   26  229  207    6   11  240  F7I7D9     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  199 : H2L5S8_ORYLA        0.41  0.66    8  192   31  209  189    5   14  232  H2L5S8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101172990 PE=4 SV=1
  200 : I3J7W3_ORENI        0.41  0.67    1  209   24  246  223    7   14  254  I3J7W3     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  201 : Q567P1_HUMAN        0.41  0.65    8  206   26  224  202    5    6  235  Q567P1     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  202 : Q6DHW4_HUMAN        0.41  0.63    8  206   26  226  206    5   12  237  Q6DHW4     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  203 : Q6GMV7_HUMAN        0.41  0.63    8  206   26  225  203    5    7  236  Q6GMV7     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  204 : Q6GMW6_HUMAN        0.41  0.63    8  206   26  224  202    5    6  235  Q6GMW6     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  205 : Q6GPX4_XENLA        0.41  0.67  217  434   20  237  224    9   12  585  Q6GPX4     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  206 : Q6IN99_HUMAN        0.41  0.63    8  206   26  224  205    5   12  235  Q6IN99     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  207 : Q6MZX9_HUMAN        0.41  0.66  217  423   20  232  217    9   14  483  Q6MZX9     Putative uncharacterized protein DKFZp686M08189 OS=Homo sapiens GN=DKFZp686M08189 PE=2 SV=1
  208 : Q6PDB8_MOUSE        0.41  0.64  217  429   20  234  219    8   10  485  Q6PDB8     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  209 : Q6PIK1_HUMAN        0.41  0.62   12  206   30  224  199    5    8  235  Q6PIK1     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  210 : Q6PJG0_HUMAN1JVK    0.41  0.62   11  206   29  224  201    6   10  235  Q6PJG0     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
  211 : A6H7J7_BOVIN        0.40  0.62    8  206   26  224  205    6   12  235  A6H7J7     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  212 : F1MCF8_BOVIN        0.40  0.61    8  206   26  223  204    6   11  234  F1MCF8     Uncharacterized protein OS=Bos taurus GN=IGLL1 PE=4 SV=2
  213 : F1PYR5_CANFA        0.40  0.65   12  206   30  221  198    5    9  232  F1PYR5     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
  214 : F7GMK5_MACMU        0.40  0.61   12  206   30  225  203    6   15  236  F7GMK5     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=2 SV=1
  215 : F7H6V3_CALJA        0.40  0.62   12  206   30  228  204    5   14  239  F7H6V3     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  216 : G1RZR5_NOMLE        0.40  0.58   12  206   30  222  201    6   14  233  G1RZR5     Uncharacterized protein OS=Nomascus leucogenys GN=LOC100589708 PE=4 SV=1
  217 : G1TU82_RABIT        0.40  0.61   16  206   34  222  194    6    8  233  G1TU82     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
  218 : G3PGY2_GASAC        0.40  0.65  220  431   10  226  220    5   11  502  G3PGY2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  219 : H2L5S9_ORYLA        0.40  0.63    8  192   30  213  193    5   17  235  H2L5S9     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101172990 PE=4 SV=1
  220 : K4G9C3_CALMI        0.40  0.67    1  214   21  230  215    3    6  235  K4G9C3     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  221 : K4GER5_CALMI        0.40  0.66    1  214   21  231  216    4    7  236  K4GER5     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  222 : K7FQA1_PELSI        0.40  0.57   10  206   28  231  209    7   17  242  K7FQA1     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  223 : Q5FWF9_HUMAN2FL5    0.40  0.62   12  206   30  221  200    6   13  232  Q5FWF9     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  224 : Q5XHD5_XENLA        0.40  0.64  217  433   18  235  225    9   15  589  Q5XHD5     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  225 : Q6GMW4_HUMAN        0.40  0.59   16  206   34  222  198    7   16  233  Q6GMW4     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  226 : Q6MZW0_HUMAN        0.40  0.66  217  429   37  248  218    8   11  506  Q6MZW0     Putative uncharacterized protein DKFZp686J11235 (Fragment) OS=Homo sapiens GN=DKFZp686J11235 PE=1 SV=1
  227 : Q6PAF5_XENLA        0.40  0.68  217  417   30  224  203    4   10  225  Q6PAF5     LOC398774 protein (Fragment) OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
  228 : Q6PIQ7_HUMAN        0.40  0.63   11  206   29  225  201    6    9  236  Q6PIQ7     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  229 : Q6ZVX0_HUMAN        0.40  0.64  217  423   20  236  221    9   18  487  Q6ZVX0     cDNA FLJ41981 fis, clone SMINT2011888, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=1 SV=1
  230 : Q7Z2U7_HUMAN        0.40  0.64    8  206   26  223  204    5   11  234  Q7Z2U7     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
  231 : Q8N5F4_HUMAN4HPY    0.40  0.61   11  206   29  222  202    6   14  233  Q8N5F4     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  232 : Q8WY24_HUMAN        0.40  0.67  217  429   20  239  223    8   13  497  Q8WY24     SNC66 protein OS=Homo sapiens PE=2 SV=1
  233 : Q91Z07_MOUSE        0.40  0.63  217  429   20  236  222    9   14  486  Q91Z07     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  234 : Q96DK0_HUMAN        0.40  0.64  217  429   20  238  222    8   12  496  Q96DK0     CDNA FLJ25298 fis, clone STM07683, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=2 SV=1
  235 : Q99M11_MOUSE        0.40  0.62    8  206   26  224  203    6    8  235  Q99M11     Igl protein OS=Mus musculus GN=Iglc1 PE=2 SV=1
  236 : R4I3X3_EPICO        0.40  0.65    8  207   28  231  205    4    6  243  R4I3X3     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  237 : A0A5E4_HUMAN        0.39  0.60   11  206   29  224  200    6    8  235  A0A5E4     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  238 : A4IFI0_BOVIN        0.39  0.61    8  206   26  224  204    7   10  235  A4IFI0     IGLL1 protein OS=Bos taurus GN=IGLL1 PE=2 SV=1
  239 : A5PK49_BOVIN        0.39  0.60    8  206   26  223  206    7   15  234  A5PK49     IGL@ protein OS=Bos taurus GN=IGL@ PE=2 SV=1
  240 : A6QM09_BOVIN        0.39  0.58   11  206   29  221  203    6   17  232  A6QM09     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  241 : F1MLW7_BOVIN        0.39  0.60    8  206   26  223  204    5   11  234  F1MLW7     Uncharacterized protein OS=Bos taurus GN=IGLL1 PE=4 SV=2
  242 : F7I7B2_CALJA        0.39  0.63    8  206   26  227  206    6   11  238  F7I7B2     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  243 : F7II77_CALJA        0.39  0.66  217  385   20  198  182    7   16  207  F7II77     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  244 : G3TRS4_LOXAF        0.39  0.59   11  206   29  224  203    6   14  235  G3TRS4     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  245 : G3UK57_LOXAF        0.39  0.60   11  206   29  224  202    6   12  235  G3UK57     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  246 : G7MWV9_MACMU        0.39  0.67  217  434   21  250  230    6   12  600  G7MWV9     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_18625 PE=4 SV=1
  247 : G7N3E4_MACMU        0.39  0.59   10  206   28  228  204    6   10  239  G7N3E4     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_02860 PE=4 SV=1
  248 : K4G4T3_CALMI        0.39  0.66    1  214   21  231  216    4    7  236  K4G4T3     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  249 : K4G7J9_CALMI        0.39  0.66    1  214   21  230  215    3    6  235  K4G7J9     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  250 : K4GK69_CALMI        0.39  0.66    1  214   21  229  216    4    9  234  K4GK69     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  251 : K9J2X3_DESRO        0.39  0.68  217  429   13  228  220    8   11  472  K9J2X3     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  252 : M3XIH0_LATCH        0.39  0.59    8  204   26  228  207    8   14  241  M3XIH0     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
  253 : Q0IIV1_XENTR        0.39  0.61    9  204   25  216  199    5   10  229  Q0IIV1     LOC734127 protein (Fragment) OS=Xenopus tropicalis GN=LOC734127 PE=2 SV=1
  254 : Q0P3Z5_DANRE        0.39  0.65    1  207   21  224  210    6    9  238  Q0P3Z5     Zgc:153659 OS=Danio rerio GN=zgc:153659 PE=2 SV=1
  255 : Q1RMN8_BOVIN        0.39  0.60    8  206   26  223  204    5   11  234  Q1RMN8     Immunoglobulin light chain, lambda gene cluster OS=Bos taurus GN=IGL@ PE=2 SV=1
  256 : Q3KQK0_MOUSE        0.39  0.65  217  429   20  233  218    7    9  484  Q3KQK0     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  257 : Q3SYJ4_MOUSE        0.39  0.65  217  429   20  233  218    7    9  484  Q3SYJ4     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  258 : Q3T101_BOVIN4K3D    0.39  0.61    8  206   26  224  205    6   12  235  Q3T101     IGL@ protein OS=Bos taurus GN=IGL@ PE=2 SV=1
  259 : Q566J7_MOUSE        0.39  0.64  217  429   20  232  219    9   12  483  Q566J7     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  260 : Q6INM5_XENLA        0.39  0.65  217  436   18  242  229    7   13  593  Q6INM5     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  261 : Q6N091_HUMAN        0.39  0.68  217  429   38  255  222    9   13  500  Q6N091     Putative uncharacterized protein DKFZp686C02220 (Fragment) OS=Homo sapiens GN=DKFZp686C02220 PE=1 SV=1
  262 : Q6ZW64_HUMAN        0.39  0.67  217  429   20  236  220    8   10  494  Q6ZW64     cDNA FLJ41552 fis, clone COLON2004478, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=1 SV=1
  263 : Q8K172_MOUSE        0.39  0.66  217  429   20  231  218    8   11  482  Q8K172     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  264 : Q8VEA0_MOUSE        0.39  0.64  217  429   20  233  220    9   13  484  Q8VEA0     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  265 : Q91XE1_MOUSE        0.39  0.61  217  429   19  229  218    8   12  480  Q91XE1     Igh protein (Fragment) OS=Mus musculus GN=Gm16844 PE=2 SV=1
  266 : A9UMG6_XENTR        0.38  0.66  217  434   34  256  226    8   11  634  A9UMG6     LOC100135349 protein (Fragment) OS=Xenopus tropicalis GN=LOC100135349 PE=2 SV=1
  267 : F1Q526_DANRE        0.38  0.63   10  209   29  230  207    7   12  241  F1Q526     Uncharacterized protein OS=Danio rerio PE=4 SV=1
  268 : F7BEZ6_XENTR        0.38  0.59    9  204   25  218  201    6   12  231  F7BEZ6     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=igl@ PE=4 SV=1
  269 : F7HAF7_CALJA        0.38  0.61   11  206   29  225  202    6   11  236  F7HAF7     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  270 : F7IIR0_CALJA        0.38  0.62   11  206   29  225  200    5    7  236  F7IIR0     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  271 : F7IMW5_CALJA        0.38  0.62  217  423   20  224  216   11   20  487  F7IMW5     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  272 : G1Q329_MYOLU        0.38  0.62   11  206   32  228  200    6    7  239  G1Q329     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  273 : G3PGZ8_GASAC        0.38  0.65  220  431   23  235  220    9   15  587  G3PGZ8     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  274 : G3PH38_GASAC        0.38  0.65  220  431   22  233  220    9   16  596  G3PH38     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  275 : G3U5R4_LOXAF        0.38  0.60   11  206   29  222  201    6   12  233  G3U5R4     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  276 : G3UQQ8_MELGA        0.38  0.56    8  206   13  207  206    7   18  218  G3UQQ8     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
  277 : H2RWF3_TAKRU        0.38  0.62  220  433   22  233  217    6    8  279  H2RWF3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  278 : K4G3A9_CALMI        0.38  0.65    1  214   21  231  216    4    7  236  K4G3A9     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  279 : K9IZ41_DESRO        0.38  0.61    8  206   26  224  202    5    6  235  K9IZ41     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  280 : M3XU30_MUSPF        0.38  0.61   16  206   34  221  196    6   13  232  M3XU30     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
  281 : Q3B8R4_RAT          0.38  0.67  217  436   20  246  227    4    7  595  Q3B8R4     Igh-6 protein OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
  282 : Q52L51_MOUSE        0.38  0.63  217  429   20  232  218    8   10  483  Q52L51     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  283 : Q569B3_RAT          0.38  0.65  217  436   20  247  228    5    8  617  Q569B3     Igh-6 protein OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
  284 : Q5CZ94_HUMAN        0.38  0.60   11  206   29  223  198    5    5  234  Q5CZ94     Putative uncharacterized protein DKFZp781M0386 OS=Homo sapiens GN=DKFZp781M0386 PE=2 SV=1
  285 : Q6DDQ7_XENLA        0.38  0.65  217  436   18  237  226    7   12  614  Q6DDQ7     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  286 : Q6GNB8_XENLA        0.38  0.63    8  204   26  218  200    5   10  231  Q6GNB8     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  287 : Q6N090_HUMAN        0.38  0.65  217  429   38  248  218    8   12  506  Q6N090     Putative uncharacterized protein DKFZp686G21220 (Fragment) OS=Homo sapiens GN=DKFZp686G21220 PE=1 SV=1
  288 : Q80ZI7_MOUSE        0.38  0.63  217  429   20  236  221    9   12  487  Q80ZI7     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  289 : Q99KA4_MOUSE        0.38  0.63  217  429   20  237  222    8   13  487  Q99KA4     Igh protein OS=Mus musculus GN=Igh-VJ558 PE=2 SV=1
  290 : Q99LA6_MOUSE        0.38  0.65  217  429   20  234  219    8   10  484  Q99LA6     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  291 : R4I5B0_EPICO        0.38  0.65    8  207   28  231  206    4    8  243  R4I5B0     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  292 : R9PXM5_CHICK        0.38  0.57   11  206   29  219  203    8   19  229  R9PXM5     Uncharacterized protein OS=Gallus gallus GN=Gga.57 PE=4 SV=1
  293 : A1L2N8_XENLA        0.37  0.60  217  434   24  240  225    7   15  588  A1L2N8     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
  294 : B2RYY0_XENTR        0.37  0.60    9  204   27  218  200    5   12  231  B2RYY0     Uncharacterized protein OS=Xenopus tropicalis PE=2 SV=1
  295 : F1R2L7_DANRE        0.37  0.63    1  209   48  259  216    6   11  264  F1R2L7     Uncharacterized protein (Fragment) OS=Danio rerio GN=LOC793066 PE=2 SV=1
  296 : F7BF18_XENTR        0.37  0.58    9  204   33  227  201    5   11  240  F7BF18     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=igl@ PE=4 SV=1
  297 : F7H1Q4_CALJA        0.37  0.59   11  206   29  223  201    5   11  234  F7H1Q4     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  298 : F7I7E2_CALJA        0.37  0.61   11  206   29  223  200    5    9  234  F7I7E2     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  299 : G0YP42_MOUSE        0.37  0.59   11  206   29  223  199    6    7  234  G0YP42     Anti-human Langerin 2G3 lambda chain OS=Mus musculus PE=2 SV=1
  300 : G1LPA5_AILME        0.37  0.58   12  206   31  222  198    5    9  233  G1LPA5     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
  301 : G3UR71_MELGA        0.37  0.57   10  206   13  206  204    7   17  217  G3UR71     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
  302 : H0XPV0_OTOGA        0.37  0.59   16  204   34  218  196    7   18  231  H0XPV0     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  303 : H2M8T0_ORYLA        0.37  0.62  217  425   29  245  222   10   18  617  H2M8T0     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=IGHA1 PE=4 SV=1
  304 : H9GTZ4_ANOCA        0.37  0.58    8  206   28  222  204    8   14  232  H9GTZ4     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100560921 PE=4 SV=1
  305 : J9NVC6_CANFA        0.37  0.67  217  435   26  249  228    8   13  620  J9NVC6     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
  306 : K4FT06_CALMI        0.37  0.65    1  214   21  232  219    4   12  237  K4FT06     Ig lambda-like chain, V-C region-nurse shark OS=Callorhynchus milii PE=2 SV=1
  307 : K4G9V5_CALMI        0.37  0.64    4  214    1  208  216    4   13  213  K4G9V5     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  308 : K9IRB0_DESRO        0.37  0.67  217  429   13  226  217    6    7  272  K9IRB0     Uncharacterized protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  309 : Q0P3Z6_DANRE        0.37  0.61   16  207   52  254  204   11   13  268  Q0P3Z6     Uncharacterized protein (Fragment) OS=Danio rerio GN=zgc:153659 PE=2 SV=1
  310 : Q2KHS9_MOUSE        0.37  0.65  217  429   20  235  220    8   11  486  Q2KHS9     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  311 : Q2T9K9_MOUSE        0.37  0.62  217  429   20  231  218    8   11  482  Q2T9K9     LOC677563 protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  312 : Q4V9Z4_MOUSE        0.37  0.61  217  429   19  225  218    9   16  476  Q4V9Z4     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  313 : Q5HZY6_MOUSE        0.37  0.63  217  429   20  235  220    8   11  486  Q5HZY6     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  314 : Q6GNH3_XENLA        0.37  0.63    8  204   26  220  201    5   10  233  Q6GNH3     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  315 : Q6P2J1_HUMAN        0.37  0.60   11  206   29  224  201    6   10  235  Q6P2J1     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  316 : Q8K0F2_MOUSE        0.37  0.64  217  429   20  237  222    8   13  488  Q8K0F2     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  317 : Q91WP5_MOUSE        0.37  0.61  217  429   20  228  218    9   14  479  Q91WP5     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  318 : R4I4V8_EPICO        0.37  0.62    1  207   20  234  218    9   14  247  R4I4V8     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  319 : A4FU62_MOUSE        0.36  0.58   11  206   29  223  199    6    7  233  A4FU62     LOC207685 protein (Fragment) OS=Mus musculus GN=Iglv2 PE=2 SV=1
  320 : G1N5T4_MELGA        0.36  0.55   10  206   28  219  205    6   21  230  G1N5T4     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=2
  321 : G1Q0M3_MYOLU        0.36  0.61   14  206   32  221  195    4    7  232  G1Q0M3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  322 : G1Q5P0_MYOLU        0.36  0.61   11  206   29  225  202    6   11  236  G1Q5P0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  323 : G1QEL1_MYOLU        0.36  0.60   11  206   29  224  201    6   10  235  G1QEL1     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  324 : H0ZF58_TAEGU        0.36  0.58   10  202   28  217  198    7   13  232  H0ZF58     Uncharacterized protein OS=Taeniopygia guttata GN=IGLL1 PE=4 SV=1
  325 : H2RWF5_TAKRU        0.36  0.62  220  433   24  241  222    5   12  363  H2RWF5     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  326 : H3A0Z5_LATCH        0.36  0.57   16  204   34  234  204    9   18  247  H3A0Z5     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
  327 : I3ISX9_DANRE        0.36  0.64  220  431   21  233  218   10   11  573  I3ISX9     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  328 : I3IT31_DANRE        0.36  0.61  220  431   20  228  218   10   15  568  I3IT31     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  329 : I3IXP5_ORENI        0.36  0.63   14  207    1  197  198    3    5  208  I3IXP5     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100701627 PE=4 SV=1
  330 : K9IKE8_DESRO        0.36  0.65  217  429   20  234  219    8   10  478  K9IKE8     Putative secreted protein OS=Desmodus rotundus PE=2 SV=1
  331 : Q2NLC3_MOUSE        0.36  0.63  217  429   20  229  218    8   13  480  Q2NLC3     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  332 : Q2TAW9_MOUSE        0.36  0.62  217  429   20  231  218    8   11  482  Q2TAW9     Uncharacterized protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  333 : Q32NZ5_MOUSE        0.36  0.64  217  429   20  231  218    8   11  482  Q32NZ5     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  334 : Q4VAB6_MOUSE        0.36  0.65  217  429   20  232  218    8   10  483  Q4VAB6     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  335 : Q566X2_DANRE        0.36  0.61    1  209   48  261  218    7   13  266  Q566X2     LOC793066 protein (Fragment) OS=Danio rerio GN=LOC793066 PE=2 SV=1
  336 : Q5BJ31_DANRE        0.36  0.63  220  431   21  230  218    9   14  570  Q5BJ31     Ighm protein OS=Danio rerio GN=ighm PE=2 SV=1
  337 : Q5M8U3_XENTR        0.36  0.59    9  204   25  216  199    5   10  229  Q5M8U3     LOC734127 protein (Fragment) OS=Xenopus tropicalis GN=LOC734127 PE=2 SV=1
  338 : Q5U512_XENLA        0.36  0.59    9  204   27  220  202    5   14  233  Q5U512     LOC594871 protein OS=Xenopus laevis GN=LOC594871 PE=2 SV=1
  339 : Q5XGQ4_XENLA        0.36  0.56    8  204   26  226  206    8   14  239  Q5XGQ4     LOC594870 protein OS=Xenopus laevis GN=LOC594870 PE=2 SV=1
  340 : Q6GN83_XENLA        0.36  0.62  217  436   31  254  229    8   14  605  Q6GN83     MGC69066 protein (Fragment) OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  341 : Q8VCV5_MOUSE        0.36  0.63  217  429   20  231  218    8   11  481  Q8VCV5     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  342 : Q91WR1_MOUSE        0.36  0.64  217  429   20  237  222    8   13  488  Q91WR1     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  343 : Q91WT1_MOUSE        0.36  0.63  217  429   20  230  218    8   12  481  Q91WT1     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  344 : G1Q584_MYOLU        0.35  0.58   11  206   29  226  204    7   14  237  G1Q584     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  345 : G1TKP3_RABIT        0.35  0.60    1  206   21  227  214    9   15  238  G1TKP3     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
  346 : I3IT76_DANRE        0.35  0.61  220  431   20  228  218   10   15  568  I3IT76     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  347 : K9IWW7_DESRO        0.35  0.60   11  206   29  225  199    5    5  236  K9IWW7     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  348 : K9IZ43_DESRO        0.35  0.58   11  206   29  225  202    6   11  236  K9IZ43     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  349 : L7N2R1_XENTR        0.35  0.64  217  434   34  255  226    8   12  634  L7N2R1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=ighx PE=4 SV=1
  350 : Q3KQK2_MOUSE        0.35  0.61  217  429   20  228  218    9   14  479  Q3KQK2     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  351 : Q4QQW0_RAT          0.35  0.63  217  436   19  242  228    7   12  591  Q4QQW0     Igh-6 protein (Fragment) OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
  352 : Q58E08_XENLA        0.35  0.55    8  204   16  218  208    9   16  231  Q58E08     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
  353 : Q63ZL4_XENLA        0.35  0.56   12  204   30  227  202    9   13  240  Q63ZL4     LOC594871 protein OS=Xenopus laevis GN=LOC594871 PE=2 SV=1
  354 : Q7TMK4_MOUSE        0.35  0.61  217  429   20  229  220    9   17  479  Q7TMK4     Immunoglobulin heavy chain complex OS=Mus musculus GN=Gm16844 PE=2 SV=1
  355 : Q8K0Z4_MOUSE        0.35  0.64  217  429   20  230  218    8   12  480  Q8K0Z4     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  356 : Q8VCX4_MOUSE        0.35  0.63  217  429   20  238  223    8   14  489  Q8VCX4     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  357 : Q91WT3_MOUSE        0.35  0.63  217  429   20  230  218    9   12  481  Q91WT3     Igh protein OS=Mus musculus GN=Igh-VJ558 PE=2 SV=1
  358 : F7BB77_CALJA        0.34  0.58   11  206   29  225  201    5    9  236  F7BB77     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  359 : F7CRS2_CALJA        0.34  0.57   11  206   29  234  210    9   18  245  F7CRS2     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  360 : G1PXZ7_MYOLU        0.34  0.56  217  397    1  191  194    7   16  244  G1PXZ7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  361 : G1TR53_RABIT        0.34  0.59   20  206    1  188  196    9   17  199  G1TR53     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=4 SV=1
  362 : G3PH43_GASAC        0.34  0.57  219  399    1  177  185    8   12  213  G3PH43     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  363 : H2S812_TAKRU        0.34  0.59    8  207   45  253  210    7   11  265  H2S812     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101062439 PE=4 SV=1
  364 : I3JA36_ORENI        0.34  0.59  219  399    1  179  185    7   10  215  I3JA36     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  365 : Q921A6_MOUSE1ZEA    0.34  0.57  217  389    1  179  185    7   18  241  Q921A6     Anti-CEA 79 single chain Fv (Fragment) OS=Mus musculus PE=1 SV=1
  366 : F1N160_BOVIN        0.33  0.53    8  206   26  234  212    9   16  245  F1N160     Uncharacterized protein OS=Bos taurus PE=2 SV=2
  367 : F6UM84_ORNAN        0.33  0.54  217  400    1  194  198    7   18  257  F6UM84     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  368 : F6W3M2_MACMU        0.33  0.62  217  434   20  244  234    8   25  614  F6W3M2     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  369 : H0W5L9_CAVPO        0.33  0.55   16  206   34  233  203    8   15  244  H0W5L9     Uncharacterized protein OS=Cavia porcellus GN=LOC100735142 PE=4 SV=1
  370 : H2S813_TAKRU        0.33  0.58    8  207   28  231  209    8   14  243  H2S813     Uncharacterized protein OS=Takifugu rubripes GN=LOC101062439 PE=4 SV=1
  371 : H9KXR9_CALJA        0.33  0.58  217  397    1  184  192    7   19  224  H9KXR9     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=4 SV=1
  372 : I3ISY6_DANRE        0.33  0.61  220  431   21  230  218   10   14  570  I3ISY6     Uncharacterized protein OS=Danio rerio GN=ighm PE=2 SV=1
  373 : I3JD33_ORENI        0.33  0.56    3  207   23  226  211    9   13  236  I3JD33     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100700295 PE=4 SV=1
  374 : K9IHN7_DESRO        0.33  0.57   12  206   31  224  199    8    9  235  K9IHN7     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  375 : K9IL19_DESRO        0.33  0.62  217  429   20  240  227   10   20  529  K9IL19     Putative secreted protein OS=Desmodus rotundus PE=2 SV=1
  376 : K9IR05_DESRO        0.33  0.58   13  206   27  219  198    8    9  230  K9IR05     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  377 : K9IR26_DESRO        0.33  0.57    8  206   28  233  211   10   17  244  K9IR26     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  378 : K9J517_DESRO        0.33  0.57    8  206   28  233  212   10   19  244  K9J517     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  379 : Q58E61_MOUSE        0.33  0.62  217  429   20  235  221    9   13  485  Q58E61     Igh protein OS=Mus musculus GN=Gm16844 PE=2 SV=1
  380 : Q7T0R1_XENLA        0.33  0.58  217  436   20  236  226    9   15  587  Q7T0R1     MGC69066 protein OS=Xenopus laevis PE=2 SV=1
  381 : A0N8U8_HETFR        0.32  0.57    3  214   19  236  223    8   16  242  A0N8U8     Variable region OS=Heterodontus francisci PE=4 SV=1
  382 : A2RVA3_XENLA        0.32  0.56   11  204   29  226  202    8   12  239  A2RVA3     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  383 : B0AZK4_DROME        0.32  0.50  217  392   21  213  197    9   25  440  B0AZK4     BerH2-scFv-hpRNase (Precursor) OS=Drosophila melanogaster PE=2 SV=1
  384 : F6S2S6_XENTR        0.32  0.54    9  204   27  220  202    5   14  233  F6S2S6     Uncharacterized protein OS=Xenopus tropicalis PE=4 SV=1
  385 : G1M4T3_AILME        0.32  0.56    8  206   26  229  209    9   15  240  G1M4T3     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
  386 : G1Q6S7_MYOLU        0.32  0.57  217  391    1  182  187    8   17  238  G1Q6S7     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  387 : G1QAM9_MYOLU        0.32  0.57  217  391    1  177  187    7   22  224  G1QAM9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  388 : G3N7B2_GASAC        0.32  0.56    2  207   11  219  216   13   17  229  G3N7B2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  389 : G3P9Y5_GASAC        0.32  0.54    2  207   16  225  218   13   20  235  G3P9Y5     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  390 : H2RJA0_TAKRU        0.32  0.53  220  400    4  186  191    8   18  245  H2RJA0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=IGHV2-26 PE=4 SV=1
  391 : H2RQT3_TAKRU        0.32  0.56  220  399    4  188  192    9   19  248  H2RQT3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  392 : H2ZU89_LATCH        0.32  0.53  217  391    1  189  191    7   18  241  H2ZU89     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  393 : H2ZX70_LATCH        0.32  0.54    1  185    1  161  185    5   24  235  H2ZX70     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  394 : I3JA37_ORENI        0.32  0.53  219  399    1  173  185    7   16  209  I3JA37     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  395 : M7BZD4_CHEMY        0.32  0.53  217  404  126  322  203    8   21  379  M7BZD4     Ig heavy chain V region 3 OS=Chelonia mydas GN=UY3_01528 PE=4 SV=1
  396 : Q5FW13_XENTR        0.32  0.58  217  431   29  240  222   10   17  594  Q5FW13     LOC548369 protein (Fragment) OS=Xenopus tropicalis GN=LOC548369 PE=2 SV=1
  397 : Q6GNC5_XENLA        0.32  0.55   11  204   35  232  202    8   12  245  Q6GNC5     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
  398 : G1PFS0_MYOLU        0.31  0.56    4  206   22  232  217   10   20  243  G1PFS0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  399 : G3P9Y8_GASAC        0.31  0.54    2  207   22  230  218   12   21  239  G3P9Y8     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  400 : G3S323_GORGO        0.31  0.58  217  397    1  185  190    6   14  226  G3S323     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=IGHV3-21 PE=4 SV=1
  401 : H2M8H5_ORYLA        0.31  0.55  220  400    2  192  196    8   20  234  H2M8H5     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
  402 : H2RJA1_TAKRU        0.31  0.55  220  400    4  186  191    9   18  245  H2RJA1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=IGHV2-26 PE=4 SV=1
  403 : H2RU22_TAKRU        0.31  0.55  220  399    4  186  187    8   11  222  H2RU22     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  404 : H3A2G4_LATCH        0.31  0.54  217  399    1  199  202    8   22  253  H3A2G4     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  405 : H3A9N8_LATCH        0.31  0.58  254  437   41  228  190    5    8  231  H3A9N8     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  406 : H9G6Q7_ANOCA        0.31  0.54  218  405    2  188  200    8   25  261  H9G6Q7     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=2
  407 : I3JD26_ORENI        0.31  0.54    3  207   23  225  214   10   20  234  I3JD26     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100698499 PE=4 SV=1
  408 : I3KCG8_ORENI        0.31  0.51  220  399    4  195  199    9   26  231  I3KCG8     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  409 : K7F501_PELSI        0.31  0.55  217  397    1  188  193    8   17  229  K7F501     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  410 : K7FDV6_PELSI        0.31  0.55  218  401    1  182  190    6   14  222  K7FDV6     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  411 : M3WFW2_FELCA        0.31  0.54    4  206   22  230  214   10   16  241  M3WFW2     Uncharacterized protein OS=Felis catus PE=4 SV=1
  412 : M4AAT8_XIPMA        0.31  0.56  238  433    1  198  207   10   20  484  M4AAT8     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=IGHA1 PE=4 SV=1
  413 : Q7SYU1_XENLA        0.31  0.56   11  204   38  235  202    8   12  248  Q7SYU1     LOC779021 protein (Fragment) OS=Xenopus laevis GN=LOC779021 PE=2 SV=1
  414 : R4I3Y3_EPICO        0.31  0.57    3  207   20  231  219   12   21  245  R4I3Y3     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  415 : G1Q286_MYOLU        0.30  0.53  217  397    1  187  193    8   18  245  G1Q286     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  416 : G1Q427_MYOLU        0.30  0.54  217  399    1  193  198    9   20  233  G1Q427     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  417 : G3NAK0_GASAC        0.30  0.53    2  207   19  229  219   14   21  239  G3NAK0     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  418 : I3IV84_ORENI        0.30  0.54    3  207   22  230  217   13   20  239  I3IV84     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100702330 PE=4 SV=1
  419 : I3JA29_ORENI        0.30  0.53  220  391    2  179  190    8   30  240  I3JA29     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  420 : K7F4T3_PELSI        0.30  0.52  217  397    1  184  194    8   23  241  K7F4T3     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  421 : K7F503_PELSI        0.30  0.57  217  397    1  183  191    7   18  224  K7F503     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  422 : K7GG21_PELSI        0.30  0.53  220  406    4  187  198    9   25  230  K7GG21     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  423 : L5LTW6_MYODS        0.30  0.50  217  399   20  177  187    9   33  219  L5LTW6     Ig heavy chain V-III region VH26 OS=Myotis davidii GN=MDA_GLEAN10002129 PE=4 SV=1
  424 : L7MZI0_ANOCA        0.30  0.54  217  399    1  186  196    7   23  244  L7MZI0     Uncharacterized protein (Fragment) OS=Anolis carolinensis PE=4 SV=1
  425 : M7CHH9_CHEMY        0.30  0.50  217  400    1  183  191    8   15  227  M7CHH9     Ig heavy chain V region 3 (Fragment) OS=Chelonia mydas GN=UY3_02407 PE=4 SV=1
  426 : Q6IR66_XENLA        0.30  0.54  217  436   24  237  227   10   20  588  Q6IR66     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 L D              0   0  100   71   31  DDDDEEQDDQEDDDDDD   D  D            QD D D DEDDQEEE  D  QED  E   DQQ  
     2    2 L I        -     0   0    0   77   33  IIIVLLIIVISIIIIII   I  I       I    II I V IIIIIIVI II  IIV  N   VII  
     3    3 L V        -     0   0   88   83   53  VVLLVVVKVVVQQKKQQ   R  Q       V    VQ Q V QVQQVVVV RQ  VVV  V   VVV  
     4    4 L M  E     -Q   25   0G  12   86   20  LMMMMMLMMLLMMMMML   M  M       L    MM M M MMMMMMLM MM  MMM  L   LML  
     5    5 L T  E     -Q   24   0G  80   86   17  TSTTTTTTTSTTTTTTT   T  T       T    TT T T TTTITTTT TT  TTT  T   TTT  
     6    6 L Q  E     -Q   23   0G  19   86    6  QQQQQQQQQQQQQQQQQ   Q  Q       Q    QQ Q Q QQQQQQQQ QQ  QQQ  Q   QQQ  
     7    7 L S  E    S+Q   22   0G  57   86   54  SSTTSSSSTSSTTSSSS   S  S       S    SS S S SSTSSTTS SS  SST  S   TST  
     8    8 L P        -     0   0   47  128    7  PPPPPPPPPPPTTPPPP   P  P       P    PP P P PPPPPPPP PP  PPP  P   PPP  
     9    9 L A  S    S-     0   0   79  136   69  ASLLLLASLAASSSSAA   A  P       L    AS S L SASSALLL SS  AAL  G   LAE  
    10   10 L S  E     -t  107   0H  78  142   56  SSSSSSISTIISSSSSS   S  S       S    TS S S STSSTSLS SS  TTS  T   STS  
    11   11 L L  E     -t  108   0H  34  176   45  LLLLLLMMLLMLLMMLL   L  L       L    LL L L LLVLLLLL FL  LLL  L   LLL  
    12   12 L V  E     +t  109   0H  86  187   34  AAPPSSSYSSSSSYYSS   S  S       S    SS S P SSSSSPPP SS  SSP  S   SSS  
    13   13 L V  E     -t  110   0H  17  189   58  VVVVVVAAVGAAAVAVA   A  A       V    LA A V ALAALVVV AA  LLV  L   ILV  
    14   14 L S  E >   -t  111   0H  46  199   61  SSSSSSSSTFSSSSSSS   S  S       S    SS S T SSSSSTTT SS  SST  S   ISV  
    15   15 L L  T 3  S+     0   0   79  198   66  LVLLLLLLIPLLLLLVV   L  L       P    PV V L VPVVPPPL TV  PPP  P   PPP  
    16   16 L G  T 3  S+     0   0   39  206    7  GGGGGGGGGGGGGGGGG   G  G       G    KG G G GGGGKGGG GG  KGG  G   GKG  
    17   17 L Q    <   -     0   0   97  206   52  QEDDDDEEQEEDDEEEE   E  D       A    ED D Q DEDDEEEQ DD  EEE  E   EEE  
    18   18 L R        -     0   0  152  206   62  RKQQQQRRPKKRRARTT   T  K       P    TK R P RRKRTPPP RT  TRP  R   MTT  
    19   19 L A  E     - R   0  79G   2  206   44  AVAAAAVVAVVVVVVVV   V  V       A    AV V A VAVVAAAA VV  AAA  A   AAV  
    20   20 L T  E     - R   0  78G  66  207   59  TTSSSSTTSTTTTTTTT   N  T       S    TT T S TTTTTSSS TT  TTS  T   STT  
    21   21 L I  E     - R   0  77G   0  207   22  IMIIIIMIIMMIIIIII   I  I       I    LI I I ILIILIII II  LVI  L   ILI  
    22   22 L S  E     -QR   7  76G  36  207   50  SSSSSSTTSTSSSTTTT   E  T       S    ST T S TSTTSSSS TT  SSS  S   SSN  
    23   23 L a  E     -QR   6  75G   0  207    0  CCCCCCCCCCCCCCCCC   C  C       C    CC C C CCCCCCCC CC  CCC  C   CCC  
    24   24 L R  E     -QR   5  74G 153  207   75  RKRRRRTKKRRSSKKRR   L  Q       R    RQ R R RRRRRKRK RR  RRR  R   KRK  
    25   25 L A  E     -Q    4   0G   6  207   68  ASSSSSAASAAGAAAAA   A  T       S    AA A S AAAAAAAS AA  AAA  A   SAA  
    26   26 L S  S    S+     0   0   63  207   52  SSSSSSSSSSSSSSSSS   S  S       S    SS S T SSSSSSSS SS  SSS  S   SSS  
    27   27 L E  S    S-     0   0  105  207   72  QQQQQQSQQSSQQQQEE   E  Q       Q    QQ Q Q QQQQQQQQ QQ  QQQ  Q   QQS  
    28   27AL S        -     0   0   29  207   74  SsssssSDsSRGGDDNN   D  N       S    SS N s SSGGSsss DD  SSs  S   sSs  
    29   27BL V        +     0   0    0   57   77  Vlvvvv..l........   .  .       L    .. . v .....liv ..  ..l  .   v.t  
    30   27CL D  E     +Z   35   0I  45   79   82  SYHHHHV.H........   .  .       E    .. . Y .....HHD ..  ..H  .   H.D  
    31   27DL S  E >  S+Z   34   0I  15  116   82  TSSTTTT.S....I.II   I  .       S    .. . S .....SST ..  ..S  .   S.D  
    32   28 L Y  T 3  S-     0   0  173  119   89  SYNNNNS.N..I.Y.YY   Y  .       Y    .. . D .....DDN ..  ..N  L   D.D  
    33   29 L G  T 3  S+     0   0   81  200   60  TnGGGGSIGVVAISISS   S  I       S    VI I G IVIIVGGG II  VvG  S   GVl  
    34   30 L K  E <  S-Z   31   0I 112  170   77  YkNNNN.KK...S.N..   .  N       Y    SS N N SSSSSNNN RS  SsN  S   KSa  
    35   31 L S  E     -Z   30   0I   7  186   77  SNTTTT.STNNNN.S..   .  K       N    SS N T NSSSSTTT NN  SNT  S   TSD  
    36   32 L F        +     0   0    5  198   68  YYYYYYYYYYYYYFYNY   D  Y       F    YW Y Y DSWCYYYY YY  YYY  Y   YYF  
    37   33 L M  E     -U   94   0H   0  205   51  MLLLLLLLLMMLLLLLL   L  I       L    LL L L LLLLLLLL VL  LLL  L   LLL  
    38   34 L H  E     -U   93   0H   0  207   81  HAEEHHHSNHYNNKSAA   A  A       S    AA N N AAAAAHHI AA  AAN  A   NAA  
    39   35 L W  E     -UV  92  52H   0  207    0  WWWWWWWWWWWWWWWWW   W  W       W    WW W W WWWWWWWW WW  WWW  W   WWW  
    40   36 L Y  E     -UV  91  50H   0  207   13  YYYYYYYYLYYYYFFYY   Y  Y       Y    YY Y F YYYYYFYF YF  YYY  Y   IYY  
    41   37 L Q  E     -UV  90  49H   4  207   25  QQLLLLQQLQQQQQQQQ   Q  Q       Q    QQ Q Q QQQQQRLH QQ  QQL  Q   QQQ  
    42   38 L Q  E     -U   89   0H  16  207   13  QQQQQQQQQQQQQKQQQ   Q  Q       Q    QQ L Q QQQQQQQQ QQ  QQQ  Q   YQQ  
    43   39 L K    >   -     0   0   47  207   59  KKKKKKKKRKKKKKKKK   K  K       K    KK K R KKKKKKKR KK  KKK  K   KKR  
    44   40 L P  T 3  S+     0   0   81  207   39  PPPPPPPPPPSPPPPQQ   P  P       P    PP P P PPPPPPPP SP  PPP  P   PPP  
    45   41 L G  T 3  S+     0   0   58  206   20  GGGGGGGWGGGDDGGGG   G  G       G    GG G G GGGGGGGG GG  GGG  G   GGG  
    46   42 L Q  S <  S-     0   0  103  207   70  QQQQLLSKQSAGGKKKK   K  K       Q    QK K Q KQKKQQQQ KK  QQQ  Q   QQQ  
    47   43 L P        -     0   0   34  207   58  PSSSSSSSSSSTTPSSS   S  A       S    AA A S VAAAASSS AA  AAS  A   SAA  
    48   44 L P        -     0   0    5  207   20  PPPPPPPPPPPVVPPPP   P  P       P    PP P P PPPPPPPP PP  PPP  P   PPP  
    49   45 L K  E     -V   41   0H  96  207   71  KKKKKKKKKKKKKKKQQ   Q  R       R    RK N R KRKKREQR KK  RRR  R   QRK  
    50   46 L V  E     +V   40   0H  10  207   43  LLLLLLLTLPLLLTTLL   L  L       L    LP L R LLLLLGGR FS  LLR  L   GLL  
    51   47 L L  E     +     0   0H   2  207   26  LLLLLLWLLWWLLLLLL   L  L       L    LL L L LLLLLLLL LL  LLL  L   LLL  
    52   48 L I  E     -VW  39  58H   0  207   24  IIIIIIIIIIIIIIIVV   I  I       I    II I I IIIIIIII II  III  I   III  
    53   49 L Y  E  >  + W   0  57H  54  207   35  KYYYYYYYYYYYYYYYY   Y  G       Y    YY Y Y YYYYYYYY YY  YYY  Y   YYY  
    54   50 L I  T >4 S-     0   0   10  207   91  YWKKIISYLAYYYHRAN   N  F       F    GK A K KGASGKKQ AG  GGK  G   QGG  
    55   51 L A  T 34 S+     0   0    2  207   75  AALVVVTAVTTTTTAAA   A  T       A    AA A V AAAAAVVV AA  AAV  V   VAA  
    56   52 L S  T 34 S+     0   0   73  207   57  SSSSSSSTSSSSSDNTK   N  S       T    SS S S SSSSSSSS SS  SSS  S   SSS  
    57   53 L N  E <<  -W   53   0H  77  205   73  NTKNNNNSKKNSSRRNT   S  R       N    TS S N TSSSTNNK TS  TTN  S   NTT  
    58   54 L L  E     -W   52   0H  63  207   64  LRRRRRLLLLLLLLLLL   L  L       K    RL L R LRLLRRRR LL  RRR  R   RRL  
    59   55 L E    >   -     0   0   49  207   82  EEFFFFAAEAAHHMVAA   Q  V       A    AE Q D QVQQAFFD QQ  AAD  A   YAE  
    60   56 L S  T 3  S+     0   0  107  207   43  SSSSSSSDSSPSSDDDD   N  S       S    TS S S STSSTSTS SS  TTS  T   STD  
    61   57 L G  T 3  S+     0   0   67  207   15  GGGGGGGGGGGGGGGGG   G  G       G    GG G G GGGGGGGG GG  GGG  G   GGG  
    62   58 L V    <   -     0   0   17  207   42  VVVVVVVVVVVVVVVVV   V  I       V    IV V V VIVVIVVV VV  IIV  I   VII  
    63   59 L P    >   -     0   0   62  207   24  PPPPPPPPPPPPPPPPP   P  P       P    PP P P PPPPPPPP PQ  PPP  P   SPP  
    64   60 L A  T 3  S+     0   0   99  207   57  ADDDDDTSDAASSSSSS   S  S       D    AS S D SDSSADDD SS  AAD  D   DAD  
    65   61 L R  T 3  S+     0   0   30  207    7  RHRRRRRRRRRRRRRRR   R  R       R    RR R R RRRQRRRR RK  RRR  R   RRR  
    66   62 L F  E <   -S   79   0G   7  207    2  FFFFFFFFFFFFFFFFF   F  F       F    FF F F FFFFFFFF FF  FFF  F   FFF  
    67   63 L S  E     -S   78   0G  59  207   17  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   TSS  
    68   64 L G  E     +S   77   0G  17  207    7  GGGGGGGGGGGGGGGGG   G  G       G    GG G G GGGGGGGG GG  GGG  G   GGG  
    69   65 L S  E     +S   76   0G  48  207   40  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSS  
    70   66 L G  E     -S   75   0G  35  207   76  GGGGGGGGGGGGGGGGR   G  G       G    GG G G GGGGGGGG GG  GGG  G   GGG  
    71   67 L S  E >   +S   74   0G  68  206   22  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSS  
    72   68 L R  T 3  S-     0   0  163  206   33  GGGGGGGGGGGGGGGGG   G  G       G    GG G G GGGGGGGG GG  GGG  G   GGG  
    73   69 L T  T 3  S+     0   0   51  206   59  TTTTTTTQTTTTTQQTT   T  R       T    TT T T TTTTTTTT TT  TTT  T   TTT  
    74   70 L D  E <   +RS  24  71G  77  206   64  DDDDDDSDDSSDHDDQQ   Q  D       D    DD D D DDDDDDDD DD  DDD  D   DDD  
    75   71 L F  E     -RS  23  70G   0  206   82  FFFFFFYYFYYYYYYYF   Y  Y       F    FF F F FFFFFFFF FF  FFF  F   FFF  
    76   72 L T  E     -RS  22  69G  33  206   58  TTTTTTSSTSSSSSSSS   S  S       T    TT T T TTTTTTTT TT  TTT  T   TTT  
    77   73 L L  E     -RS  21  68G   0  206    3  LLLLLLLLLLLLLLLLL   L  F       L    LL L L LLLLLLLL LL  LLL  L   LLL  
    78   74 L T  E     -RS  20  67G  28  206   44  NTKKKKTTKTTTTTTTK   K  S       K    TT T K TTTTTKRK TT  TTR  T   TTT  
    79   75 L I  E     -RS  19  66G   0  206    3  IIIIIIIIIIIIIIIII   I  I       I    II I I IIIIIIII II  III  I   III  
    80   76 L D  S    S+     0   0   68  206   39  HSSSSSSSSSSSSNSNN   N  S       S    SS S T SSSSSSSS NS  SSS  S   SSS  
    81   77 L P  S    S-     0   0   51  206   60  PSRRRRSSRRSNNSSSS   S  N       R    SS S R SSSSSRRR SS  SSR  R   RSR  
    82   78 L V        +     0   0    0  206   50  VVVVVVMLVVVLLLLLL   L  V       V    LL L V LLLLLVVV LL  LLV  L   VLV  
    83   79 L E    >   -     0   0   93  206   33  EKEEEEEEEEEEEEEQQ   Q  E       E    EQ R E EQEEEEEE QQ  EEE  E   QEE  
    84   80 L A  G >  S+     0   0   22  206   52  EAAAAAASAAAPPCYSP   S  S       A    PP P A PPPPPAAA SP  PPA  P   APA  
    85   81 L D  G 3  S+     0   0   58  206   27  EEEEEEEDEEEEEEEEE   E  E       E    EE D E EEEEEDDE EE  EED  E   EED  
    86   82 L D  G <   +     0   0    1  206    0  DDDDDDDDDDDDDDDDD   D  D       D    DD D D DDDDDDDD DD  DDD  D   DDD  
    87   83 L A    <   +     0   0   12  206   78  TLLLLLATLAAIIMMFF   V  I       A    FF F V FFFFFVVV FF  FFV  F   AFA  
    88   84 L A  E    S- X   0 108H   8  206   19  AAGGGGAAGAAAAGGGG   A  A       G    AA A G AAAAAGGG AA  AAG  A   GAG  
    89   85 L T  E     -UX  42 107H  35  207   69  TLVVVVTTVTTTTIISS   T  S       V    VT T V VTVVVVVV TT  VVV  V   VVD  
    90   86 L Y  E     -UX  41 106H   0  207    5  YYYYYYYYYYYYYYYYY   Y  Y       Y    YY Y Y YYYYYYYY YY  YYY  Y   YYY  
    91   87 L Y  E     -U   40   0H   9  207    7  YYYYFFYYYYYYYYYYY   F  Y       Y    YY Y F YYYYYYYF YY  YYY  Y   YYY  
    92   88 L a  E     -U   39   0H   0  207    4  CCCCCCCCCCCCCCCCC   C  C       C    CC C C CCCCCCCC CC  CCC  C   CCC  
    93   89 L Q  E     -UY  38 102H   1  207   79  QQFFSSHLLQQQQLLQQ   Q  L       Q    QQ Q M QQQQQGYM QQ  QQQ  Q   YQQ  
    94   90 L Q  E     +UY  37 101H   0  207   84  HQQQQQQQQQQQQQQHH   Q  Q       Q    QQ Q Q QQQQQQQQ QQ  QQQ  Q   QQQ  
    95   91 L N        +     0   0    0  185   59  SYGGVSYHAWLYYYYFH   Y  Y       K    YY S G YYYEYGNG YY  YEG  Y   GYS  
    96   92 L N  S    S+     0   0    1  190   79  WYSSTTHGTSSRSDDWS   N  D       S    Sn Y T SnSKSSTT yK  SvT  g   tSN  
    97   93 L E  S    S-     0   0   48  189   80  ENLHHHREHSTYQEEGG   N  N       T    Sa N H .aSNSSHY .S  SrH  s   .SE  
    98   94 L D  S    S+     0   0   42  192   76  IYVVVVFSFNSLFFFTI   Y  S       V    WP I W sPWIWLaR .Y  wna  R   .Wt  
    99   95 L P  S    S-     0   0   26  108   72  PPPPPPPPPPPPPPPPP   P  P       P    PP P P sPPTPPpP pP  pvr  P   pPl  
   100   96 L P        -     0   0    4  141   88  WLWRWGPYRLWWFLRFF   W  W       H    PT L S HTPVPYTP PV  TYT  I   PPT  
   101   97 L T  E     -Y   94   0H  26  181   65  TTTTTTTTTTTTTTTTT   T  T       S    TV T T SVTTTTTT TT  TTN  T   TTH  
   102   98 L F  E     -Y   93   0H  26  205    9  FFFFFFFFFFFFFFFFF   F  F       F    FF F F FFFFFFFL FF  FFF  F   FFF  
   103   99 L G        -     0   0    3  207   13  GGGGGGGGGGGGGGGGG   G  G       G    GG G G GGGGGGSG GG  GGG  G   SWG  
   104  100 L A        -     0   0   81  207   63  GAGGGGGSGAGGSGGGS   G  G       S    QQ G Q QQQQKQQQ QQ  QQQ  Q   QPG  
   105  101 L G        -     0   0   12  207   10  GGGGGGGGGGGGGGGGG   G  G       G    GG G G GGGGGGGG GG  GGG  G   GRG  
   106  102 L T  E     - X   0  90H   0  207   10  TTTTTTTTTTSTTTTTT   T  T       T    TT T T TTTTTTTT TT  TTT  T   TDT  
   107  103 L K  E     -tX  10  89H  74  207   54  NKKKKKKKKRKKKKKKK   K  K       K    KK N K KKKKKKKK RK  QKK  R   KQR  
   108  104 L L  E     +tX  11  88H   2  206   19  LLLLLLLLLLLLLLLVL   L  L       V    LV V L LVLLVLLV VL  MLL  L   LVV  
   109  105 L E  E     -t   12   0H  14  207   67  EDEEEEEEEEEEEEEGE   E  E       E    EE E E EEEEEEEE EE  EEE  D   EEE  
   110  106 L M  E     -t   13   0H   0  207   27  ILIIIIIIILIIILIII   L  L       P    II I I IIIIIIII II  III  I   VII  
   111  107 L R  E     +t   14   0H 126  207   85  KRKKKKKKKKKKKRKKK   K  K       K    KK K K KKKKKKKK TK  KKK  K   KKK  
   112  108 L R        -     0   0   64  207   79  RRRRRRRRRRRRRRRRR   R  R       R    RR R R RRRRRRRR RR  RRR  R   RRL  
   113  109 L A        -     0   0   71  198   67  AAAAAAAAAAAAAAAAA   A  A       A    AA T T AAAAANNT TT  AAS  T   SAG  
   114  110 L D        -     0   0   58  203   71  DDDDDDDDDDDDDDDDD   D  D       D    VV V V VVVVVDDV VV  VVD  V   DVg  
   115  111 L A  B     -A  144   0J  19  204   57  AAAAAAAAAAAAAAAAA   A  A       A    AA A A AAAAAAAA AA  AAA  A   AAv  
   116  112 L A        -     0   0   40  206   62  AAAAAAAAAAAAAAAAA   A  A       K    AA A A AAAAAQQA AA  AAQ  A   EAK  
   117  113 L P        -     0   0    9  206    1  PPPPPPPPPPPPPPPPP   P  P       P    PP P P PPPPPPPP PP  PPP  P   PPP  
   118  114 L T  E     -B  141   0K  85  206   55  TTTTTTTTTTTTTTTTT   T  T       S    SS S S SSSSSSSS SS  SSS  S   SST  
   119  115 L V  E     -B  140   0K   8  206   18  VVVVVVVVVVVVVVVVV   V  V       V    VV V V VVVVVVVV VV  VVV  V   VVV  
   120  116 L S  E     -B  139   0K  17  206   69  SSSSSSSSSSSSSSSSS   S  S       F    FF F F FFFFFFFF FF  FFF  F   FFS  
   121  117 L I  E     -B  138   0K  22  207   30  IIIIIIIIIIIIIIIII   I  I       I    II I I IIIIIVLI II  IIL  I   LII  
   122  118 L F  E     -B  137   0K   4  207    7  FFFFFFFFFFFFFFFFF   F  F       F    FF F F FFFFFFFF FF  FFF  F   FFF  
   123  119 L P        -     0   0    5  207   23  PPPPPPPPPPPPPPPPP   P  P       P    PP P P PPPPPQQP PP  PPQ  P   KPP  
   124  120 L P        -     0   0    1  207    4  PPPPPPPPPPPPPPPPP   P  P       P    PP P P PPPPPPPP PP  PPP  P   PPP  
   125  121 L S    >>  -     0   0    8  207    4  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSS  
   126  122 L S  H 3> S+     0   0   78  207   65  SSSSSSSSSSSSSSSSS   T  T       K    EE D D EEEEEPPD DD  EEL  D   DEA  
   127  123 L E  H 3> S+     0   0   76  207   23  EEEEEEEEEEEEEEEEE   E  E       E    DD E E DDDDDDDE EE  DDD  E   EDD  
   128  124 L Q  H <4>S+     0   0    8  207   27  QQQQQQQQQQQQQQQQQ   Q  Q       Q    QQ Q Q QQQQQEQQ QQ  QQE  Q   QQQ  
   129  125 L L  H ><5S+     0   0   29  207   22  LLLLLLLLLLLLLLLLL   L  L       L    VV L L VVVVVLLL LL  VVL  L   LVL  
   130  126 L T  H 3<5S+     0   0  111  207   71  TTTTTTTTTTTTTTTTT   A  A       E    KK K K KKKKKHHK KK  KKH  K   KKK  
   131  127 L S  T 3<5S-     0   0   83  207   67  SSSSSSSSSSSSSSSSS   T  T       T    SS S S SSSSSTTS SS  SST  S   TSG  
   132  128 L G  T < 5S+     0   0   34  207   53  GGGGGGGGGGGGGGGGG   G  G       Q    GG G G GGGGGGGG GG  GGG  G   GGG  
   133  129 L G  E   < - C   0 186K  21  205   60  GGGGGGGGGGGGGGGGG   G  G       T    TT T T TTTTTSST TT  TTS  T   TTT  
   134  130 L A  E     - C   0 185K   0  207   13  AAAAAAAAAAAAAAAAA   A  A       V    AV A A AVAAAAAA AA  AAA  A   VAA  
   135  131 L S  E     - C   0 184K   2  207   38  SSSSSSSSSSSSSSSSS   S  S       S    TS S S TSTTTSSS SS  TTS  S   STT  
   136  132 L V  E     - C   0 183K   0  207   28  VVVVVVVVVVVVVVVVV   V  V       V    VV V V VVVVVVVV VV  VVI  V   VVV  
   137  133 L V  E     -BC 122 182K   0  207   12  VVVVVVVVVVVVVVVVV   V  V       V    VV V V VVVVVVVV VV  VVV  V   VVV  
   138  134 L b  E     -BC 121 181K   0  207    3  CCCCCCCCCCCCCCCCC   C  C       C    CC C C CCCCCCCC CC  CCC  C   CCC  
   139  135 L F  E     -BC 120 180K   0  207   31  FFFFFFFFFFFFFFFFF   L  L       L    LL L L LLLLLLML LL  LLI  L   LLL  
   140  136 L L  E     -BC 119 179K   0  206   48  LLLLLLLLLLLLLLLLL   M  M       L    LL L L LLLLLLLL LL  LLL  L   VLV  
   141  137 L N  E     -B  118   0K   2  207   48  NNNNNNNNNNNNNNNNN   N  N       N    NN N N NNNNNNNN NN  NNN  N   NNN  
   142  138 L N  E    S+     0   0K  49  207   47  NNNNNNNNNNNNNNNNN   N  N       S    GN N N GNGGGGGN NN  GGD  N   DGG  
   143  139 L F  E     - C   0 177K   0  207   30  FFFFFFFFFFFFFFFFF   F  F       F    FF F F FFFFFFFF FF  FFF  F   FFF  
   144  140 L Y  B    S+A  115   0J   9  206   40  YYYYYYYYYYYYYYYYY   Y  Y       F    YY Y Y YYYYYYYY YY  YYY  Y   YYY  
   145  141 L P  S    S-     0   0   18  207    7  PPPPPPPPPPPPPPPPP   P  P       P    PP P P PPPPPPPP PP  PPP  P   PPP  
   146  142 L K  S    S+     0   0   83  206   75  KKKKKKKKKKKKKKKKK   R  R       R    RR R R RRRRRRRR RR  RRK  R   KRG  
   147  143 L D        +     0   0  116  207   72  DDDDDDDDDDDDDDDDD   D  D       E    DE E E DEDDDDEE EE  DDE  E   DDG  
   148  144 L I        -     0   0   19  206   60  IIIIIIIIIIIIIIIII   I  I       V    AA A A AAAAAIVA AA  AAV  A   IAL  
   149  145 L N  E     -E  201   0L  82  207   67  NNNNNNNNNNNNNNNNN   S  S       N    KS K K KSKKKNNK KK  KKN  K   NKN  
   150  146 L V  E     -E  200   0L  27  207   11  VVVVVVVVVVVVVVVVV   V  V       V    VV V V VVVVVVVV VV  VVV  V   VVV  
   151  147 L K  E     -E  199   0L  53  207   75  KKKKKKKKKKKKKKKKK   K  K       K    KK Q Q KKKKKKKQ QQ  KKK  Q   KKA  
   152  148 L W  E     +E  198   0L   3  207    2  WWWWWWWWWWWWWWWWW   W  W       W    WW W W WWWWWWWW WW  WWW  W   WWW  
   153  149 L K  E     +EF 197 158L  76  207   39  KKKKKKKKKKKKKKKKK   K  K       K    KK K K KKKKKKKK KK  KKK  K   KKK  
   154  150 L I  E    S-E  196   0L   0  207   67  IIIIIIIIIIIIIIIII   I  I       V    VV V V VVVVVVVV VV  VVV  V   VVK  
   155  151 L D  S    S-     0   0   71  207   19  DDDDDDDDDDDDDDDDD   D  D       D    DD D D DDDDDDDD DD  DDD  D   DDD  
   156  152 L G  S    S+     0   0   63  207   35  GGGGGGGGGGGGGGGGG   G  G       G    DG N N DGDDDGGN NN  DDG  N   GDT  
   157  153 L S  S    S-     0   0   33  206   68  SSSSSSSSSSSSSSSSS   T  T       V    VV A A VVVVVEVA AA  VVV  A   VVT  
   158  154 L E  B     -F  153   0L  85  206   78  EEEEEEEEEEEEEEEEE   E  E       V    VL L L VLVVVITL LL  VVV  L   TVT  
   159  155 L R        -     0   0   69  207   77  RRRRRRRRRRRRRRRRR   R  R       Q    QK Q Q QKQQQQKQ QQ  QQQ  Q   QQA  
   160  156 L Q        +     0   0  133  207   73  QQQQQQQQQQQQQQQQQ   R  R       S    ST S S STSSSNNS SS  SSN  S   SST  
   161  157 L N  S    S+     0   0  117  207   69  NNNNNNNNNNNNNNNNN   D  D       S    DG G G DGDDDTTG GG  DDK  G   SDT  
   162  158 L G  S    S+     0   0   29  207   34  GGGGGGGGGGGGGGGGG   G  G       G    nN N N nNnnnGGN NN  nnG  N   snG  
   163  159 L V  E     -D  183   0K  46   65   74  VVVVVVVVVVVVVVVVV   V  V       I    iS S S iSiiiIIS SS  iiI  S   fiV  
   164  160 L L  E     -D  182   0K  16  192   49  LLLLLLLLLLLLLLLLL   L  L       L    QQ Q Q QQQQQQLQ QQ  QQQ  Q   QQL  
   165  161 L N  E     +D  181   0K  52  196   54  NNNNNNNNNNNNNNNNN   D  D       D    DE E E DEDDDEEE EE  DDE  E   NDT  
   166  162 L S  E     -D  180   0K  12  204   50  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSS  
   167  163 L W  E     -D  179   0K  99  204   72  WWWWWWWWWWWWWWWWW   V  V       V    IV V V IVIIIVVV VV  IIT  V   FIT  
   168  164 L T        -     0   0   24  204   69  TTTTTTTTTTTTTTTTT   T  T       T    TT T T TTTTTTTT TT  TTT  T   TTK  
   169  165 L D        -     0   0   99  204   75  DDDDDDDDDDDDDDDDD   D  D       E    EE E E EEEEEEEE EE  EEE  E   DEQ  
   170  166 L Q        -     0   0   18  206   75  QQQQQQQQQQQQQQQQQ   Q  Q       Q    QQ Q Q QQQQQQQQ QQ  QQQ  Q   QQQ  
   171  167 L D     >  -     0   0   48  206   62  DDDDDDDDDDDDDDDDD   D  D       D    DD D D DDDDDDDD DD  DDN  D   DDD  
   172  168 L S  T  4 S+     0   0   54  206   61  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSP  
   173  169 L K  T  4 S+     0   0  180  206   55  KKKKKKKKKKKKKKKKK   K  K       K    KK K K KKKKKKKK KK  KKK  K   KKS  
   174  170 L D  T  4 S-     0   0   57  206   36  DDDDDDDDDDDDDDDDD   D  D       D    DD D D DDDDDDDD DD  DDD  D   KDD  
   175  171 L S     <  +     0   0    4  206   54  SSSSSSSSSSSSSSSSS   S  S       S    NN S S NNNNNSSS SS  NNS  S   SNH  
   176  172 L T        -     0   0    5  206   71  TTTTTTTTTTTTTTTTT   T  T       T    TT T T TTTTTTTT TT  TTT  T   TTK  
   177  173 L Y  E     -C  143   0K   7  204    1  YYYYYYYYYYYYYYYYY   Y  Y       Y    YY Y Y YYYYYYYY YY  YYY  Y   YYY  
   178  174 L S  E     -     0   0K   1  205   68  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSS  
   179  175 L M  E     -CD 140 167K   0  206   80  MMMMMMMMMMMMMMMMM   M  M       L    LL L L LLLLLLLL LL  LLL  L   LLL  
   180  176 L S  E     -CD 139 166K   3  206    3  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSS  
   181  177 L S  E     -CD 138 165K   0  206    0  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SSS  
   182  178 L T  E     -CD 137 164K   2  206   71  TTTTTTTTTTTTTTTTT   T  T       T    TT T T TTTTTTTT TT  TTT  T   ITT  
   183  179 L L  E     -CD 136 163K   0  206    0  LLLLLLLLLLLLLLLLL   L  L       L    LL L L LLLLLLLL LL  LLL  L   LLL  
   184  180 L T  E     +C  135   0K  36  206   53  TTTTTTTTTTTTTTTTT   S  S       S    TT T T TTTTTTTT TT  TTT  T   TTT  
   185  181 L L  E     -C  134   0K  16  206    9  LLLLLLLLLLLLLLLLL   L  L       L    LL L L LLLLLMML LL  LLM  L   LLL  
   186  182 L T  E  >  -C  133   0K  81  205   54  TTTTTTTTTTTTTTTTT   T  T       P    SS S S SSSSSSPS SS  SSS  S   PST  
   187  183 L K  H >> S+     0   0   66  204   67  KKEKKKKKKKKKKKKKK   K  K       T    SS K K SSSSSSSK KK  SSS  K   SSK  
   188  184 L D  H 3> S+     0   0  109  205   63  DDDDDDDDDDDDDDDDD   A  A       S    TT A A TTTTTTTA AA  TTT  A   STA  
   189  185 L E  H >4 S+     0   0   53  205   48  EEEEEEEEEEEEEEEEE   D  D       Q    ED D D EDEEEEED DD  EEE  D   EEE  
   190  186 L Y  H X< S+     0   0    6  205   12  YYYYYYYYYYYYYYYYY   Y  Y       Y    YY Y Y YYYYYYYY YY  YYY  Y   YYY  
   191  187 L E  H 3< S+     0   0   90  205   71  EEEEEEEEEEEEEEEEE   E  E       L    QQ E E QQQQQQLE EE  QQQ  E   QQD  
   192  188 L R  T << S+     0   0  160  205   58  RRRRRRRRRRRRRRRRR   S  S       S    RS K K RSRRRSSK KK  RRS  K   SRS  
   193  189 L H    <   -     0   0   24  203   55  HHHHHHHHHHHHHHHHH   H  H       H    HH H H HHHHHHHH HH  HHH  H   HHY  
   194  190 L N  S    S+     0   0   97  203   71  NNNNNNNNNNNNNNNNN   N  N       N    NN K K NNNNNEEK KK  NNE  K   DNQ  
   195  191 L S  E     + G   0 214L  37  203   71  SSSSSSSSSSSSSSSSS   L  L       L    VV V V VVVVVNKV VV  VVK  V   AVT  
   196  192 L Y  E     +EG 154 213L   0  203   15  YYYYYYYYYYYYYYYYY   Y  Y       Y    YY Y Y YYYYYYYY YY  YYF  Y   YYY  
   197  193 L T  E     -EG 153 212L   3  203   48  TTTTTTTTTTTTTTTTT   T  T       S    AA A A AAAAASSA AA  AAS  A   TAT  
   198  194 L b  E     -EG 152 211L   1  203    0  CCCCCCCCCCCCCCCCC   C  C       C    CC C C CCCCCCCC CC  CCC  C   CCC  
   199  195 L E  E     -EG 151 210L  34  203   61  EEEEEEEEEEEEEEEEE   E  E       E    EE E E EEEEEEEE EE  EEE  E   EEE  
   200  196 L A  E     -EG 150 209L   1  203   23  AAAAAAAAAAAAAAAAA   V  V       V    VV V V VVVVVVVV VV  VVV  V   VVV  
   201  197 L T  E     +E  149   0L  36  203   31  TTTTTTTTTTTTTTTTT   V  V       T    TT T T TTTTTTTT TT  TTT  T   STT  
   202  198 L H  E >   - G   0 205L  18  203   19  HHHHHHHHHHHHHHHHH   H  H       H    HH H H HHHHHHHH HH  HHH  H   HHH  
   203  199 L K  T 3  S+     0   0  145  202   55  KKKKKKKKKKKKKKKKK   K  K       K    QQ Q Q QQQQQKKQ QQ  QQK  Q   KQE  
   204  200 L T  T 3  S+     0   0   55  202   40  TTTTTTTTTTTTTTTTT   T  T       T    SG G G SGSSSSSG GG  SSS  G   SST  
   205  201 L S  E <   -G  202   0L  45  180   82  SSSSSSSSSSSSSSSSS   S  S       L    LL L L LLLLLLLL LL  LLL  L   LL   
   206  202 L T  E    S+     0   0L 140  180   32  TTTTTTTTTTTTTTTTT   S  S       A    TS S S TSTTTPSS SS  TTA  S   TT   
   207  203 L S  E    S-     0   0L  82   83   48  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   TS   
   208  204 L P  E     -     0   0L  43   67   33  PPPPPPPPPPPPPPPPP   P  P       P    PP P P PPPPPTPP PP  PPT  P   TP   
   209  205 L I  E     -G  200   0L  46   67   29  IIIIIIIIIIIIIIIII   V  V       L    LV V V LVLLLLLV VV  LLL  V   LL   
   210  206 L V  E     +G  199   0L  70   63   53  VVVVVVVVVVVVVVVVV   V  V       V    TT T T TTTTTIVT TT  TTV  T   VT   
   211  207 L K  E     +G  198   0L  85   63   26  KKKKKKKKKKKKKKKKK   K  K       K    KK K K KKKKKKKK KK  KKK  K   KK   
   212  208 L S  E     -G  197   0L  67   63   28  SSSSSSSSSSSSSSSSS   S  S       S    SS S S SSSSSSSS SS  SSS  S   SS   
   213  209 L F  E     -G  196   0L  30   63   18  FFFFFFFFFFFFFFFFF   F  F       F    FF F F FFFFFFFF FF  FFF  F   FF   
   214  210 L N  E      G  195   0L  99   63   62  NNNNNNNNNNNNNNNNN   N  N       S    RN N N RNRRRQQN NN  RRN  N   SR   
   215  211 L R              0   0   82   54   19  RRRRRRRRRRRRRRRRR   R  R       R    KR R R KRKKKRRR RR  KKR  R   KK   
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  192   30                   EQE EQ EEEEEQE EQQQ  E E Q        E  QE   EQ EQE   E 
   218    2 H V        +     0   0   30  194   40                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   V 
   219    3 H K  E     -A  241   0A 143  197   48                   KQN QQ QQQQQQK QQQQ  Q Q Q        Q  QQ   QQ KQQ   Q 
   220    4 H L  E     -A  240   0A  11  217    3                   LLL LL LILLLLL LLLL  L L L        L  LL   LL LLL   L 
   221    5 H Q  E     -A  239   0A 120  217   73                   VMV VQ VLVVVQV QQQQ  Q Q K        L  LV   HK EKV   V 
   222    6 H E  E     -A  238   0A   2  218   33                   EEE EQ EEEEEQE QQEE  Q Q Q        Q  QE   QQ EQE   E 
   223    7 H S  E     +A  237   0A  48  218   13                   SSS TS STSTSSS SSSS  S S S        S  SS   SS SSS   S 
   224    8 H G        -     0   0   35  218   20                   GGG GG GGGGGGG GGGG  G G G        G  GG   GG GGG   G 
   225    9 H P        -     0   0   50  218   49                   GPG GA GGGGGAG AAPP  A P A        T  PG   PA GAG   G 
   226   10 H A  S    S+     0   0   30  218   51                   GGG GE GGGGGEG EEGG  E E E        E  ED   EE GEG   G 
   227   11 H V  E     -d  334   0B  33  218   25                   LLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   L 
   228   12 H I  E     -d  335   0B   9  218   54                   VVV VA VVVVVAV VVVL  V V V        V  VV   VV VVV   V 
   229   13 H K        -     0   0  104  218   50                   QQQ QR QKQQKKQ RKKK  R K K        R  KK   ER QKK   Q 
   230   14 H P  S    S+     0   0   56  218    9                   PPP PP PPPPPPP PPPP  P T P        P  PP   AP PPP   P 
   231   15 H S  S    S+     0   0   90  218   20                   GSG GG GGGKGGG GGSS  G G G        G  GG   GG GGG   G 
   232   16 H Q  S    S-     0   0   76  218   59                   GEG RA RGRGGSG ASEE  S A A        A  AG   AA GAG   R 
   233   17 H S        -     0   0   51  217   20                   STS SS SSSSSSS SSTT  S S S        S  SS   SS SSS   S 
   234   18 H L  E     - B   0 300A   1  217   43                   LLL LV MLLLRVL VVLL  V V V        V  VL   VV MVL   L 
   235   19 H S  E     - B   0 299A  64  218   51                   KSR KR KRKKKKS KKSS  K K K        K  KR   KK KKR   R 
   236   20 H L  E     - B   0 298A   1  218   13                   LLL LL LLLLLIL LILL  L M I        L  IL   LL LLL   L 
   237   21 H T  E     -AB 223 297A  29  218   33                   SIS SS SSSSSSS SSTT  S S S        S  SS   SS SSS   S 
   238   22 H c  E     -AB 222 296A   0  219    1                   CCC CC CCCCCCC CCCC  C C C        C  CC   CC CCC   C 
   239   23 H I  E     -AB 221 295A  54  217   75                   ATA VK AAAAAKA TKTA  K K K        T  RV   KK VKA   A 
   240   24 H V  E     -A  220   0A   4  217   51                   AVA AA ATAAAAT AAVV  T A A        A  AA   AA AAA   A 
   241   25 H S  E     +A  219   0A  60  218    9                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   S 
   242   26 H G  S    S+     0   0   54  218    3                   GGG GG GGGGGG. GGGG  G G G        G  GG   GG GGG   G 
   243   27 H F  S    S-     0   0   37  199   23                   FFF FY FFFFFY. FYGG  Y Y Y        F  YF   YY FYF   F 
   244   28 H S    >   -     0   0   44  200   45                   TST TT TNTSTTG NTSS  T T T        S  AT   TI TTT   T 
   245   29 H I  T 3  S+     0   0    2   56   45                   FLF FF ...F..F ....  . . .        .  ..   .. ...   . 
   246   30 H T  T 3   +     0   0   59   61   59                   STT ST ...N..T ...I  . . .        .  ..   .. ...   . 
   247   31 H R  S X  S-     0   0  145  218   53                   SSD SG FFFTFFF IFIS  F F F        I  FF   FF FFF   FF
   248   32 H T  T 3  S+     0   0   72  204   59                   ... .Y SNSNSTI KTSG  T S T        K  SS   GT SNS   DF
   249   33 H N  T 3  S+     0   0   16  204   62                   ... .G NDDADSD DNGG  S D D        D  KS   DS NSN   DN
   250   34 H Y  E <   -E  317   0C  23  220   46                   YYY YV YYYMYYY SYYY  Y Y Y        S  SY   YY SYA   YY
   251   35 H d  E     -EF 316 270C   0  218   89                   TNY WS GFNNGDY LDYG  Y Y Y        L  WY   YW WIW   AA
   252   35AH W  E     -EF 315 269C   1  218   43                   MVM MW MMM.MVM MIWW  I M I        L  MM   VI MMM   MM
   253   35BH H  E     -EF 314 268C   0  219   73                   SHS YV ANA.HSS HHSG  N H N        H  ND   HH NHS   HH
   254   36 H W  E     +EF 313 267C   1  221    2                   WWW WK WWWWWWW WWWW  W W W        W  WW   WW WWW   WW
   255   37 H I  E     -EF 312 265C   0  221   15                   IVV IQ VVVVVIF VIII  V V V        V  VV   VV VVV   VV
   256   38 H R  E     -EF 311 264C  10  221   15                   RRR RR RRRRRKR KKRR  K K K        M  KR   KK RKR   RR
   257   39 H Q  E     -EF 310 263C  22  220    2                   QQQ Q. QQQQQQQ QQQQ  Q Q Q        Q  RQ   QQ QQQ   QQ
   258   40 H A    >   -     0   0   14  220   61                   TPP A. AAAAATP RQPP  R S R        R  RA   SR SRA   AA
   259   41 H P  T 3  S+     0   0   99  221   19                   PPP PT PPPPPTP PPAP  P H P        P  PP   HS PPP   PP
   260   42 H G  T 3  S+     0   0   94  221   12                   EGG GG KGKGEGG EGGG  G G G        E  GG   GG EGG   GG
   261   43 H K  S <  S-     0   0  140  221   34                   KKK KQ KKKKKQK QNKK  Q K Q        Q  KK   KQ KQK   KK
   262   44 H G        -     0   0   20  221   24                   RGA GG GGGGGGA GGGG  G S G        G  GG   SG GGG   GG
   263   45 H L  E     -F  257   0C  10  221    9                   LLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   LL
   264   46 H E  E     -F  256   0C  79  221    9                   EEE EE EEEEEEE EEEE  E E E        E  EQ   DE EEE   EE
   265   47 H W  E     +F  255   0C  13  221    9                   WWW WW WWWWWYW WWWW  W W W        W  WW   WW WWW   WW
   266   48 H M  E     -     0   0C   3  221   31                   VML VV VVVVVIL IIII  I I I        I  IL   II VIV   VV
   267   49 H G  E     -FG 254 277C   0  221   42                   AGG SG AVAAAGG GGGG  G G G        G  GS   GA AGG   SA
   268   50 H R  E     -FG 253 276C  10  221   93                   YVF SE YQTRYYL WWRS  H Y K        W  RE   NR QYR   GV
   269   51 H I  E     -FG 252 275C   3  221   16                   IMI II IIIIIII IIII  I I I        I  II   II IFI   II
   270   52 H d  E >   -F  251   0C   0  221   83                   SWR NY SRIRNNR DYYY  Y Y G        D  FS   YY RSK   SA
   271   53 H Y  T 3  S+     0   0   47  221   84                   Dsn TP YnYsSTn pPTp  P p P        p  pS   pP lps   WY
   272   54 H E  T 3  S-     0   0   63  207   63                   g.n dg dydnggn dgSg  g n g        d  ds   ng ddd   nd
   273   55 H G  S <  S+     0   0   25  200   53                   ggy gg gysytgy GgGG  g G g        G  Gs   Gg y.g   gs
   274   56 H S        -     0   0   42  217   74                   SNT SN YGRATGT ENSN  Y G S        E  DS   GS ADT   ST
   275   57 H I  E     -G  269   0C  71  220   53                   TTT TT TTTTIIM TTTT  T N T        T  TT   NT TTT   IQ
   276   58 H Y  E     -G  268   0C  70  221   79                   YDE YY YYYYYYE KKNY  E G Y        K  HY   DY HKD   AY
   277   59 H Y  E     -G  267   0C  41  221   17                   YYY YY YYYYYYY YYYY  Y Y Y        Y  YY   YY YCY   YY
   278   60 H S    >>  -     0   0   11  221   61                   PNS PS RARAATS ANNN  N N N        V  SA   NN ANA   AA
   279   61 H P  T 34 S+     0   0   76  221   51                   DSA DE DEDDDEA PQPP  E Q E        P  GD   QE EEA   DD
   280   62 H S  T 34 S+     0   0   79  221   52                   TAS SK PSSSTKS KKSS  K K K        K  KA   KK SKP   SS
   281   63 H I  T X4 S+     0   0    4  221   40                   LLV VF VLVVVFL FFLL  F F F        F  FV   FF VFV   VV
   282   64 H K  G >< S+     0   0  133  221   28                   KKK KK KEKKKKK QNKK  K K K        Q  QK   KK KKK   KR
   283   65 H S  G 3  S+     0   0  116  221   27                   GSG GG GGGDGGG DGSS  G G G        D  GG   GG GGG   GG
   284   66 H R  G <  S+     0   0   51  221   18                   RRR RK RRRRRKR KKRR  K K K        K  KR   KK RKR   RR
   285   67 H S  E <   -C  300   0A  11  221   54                   FLF FA FVFFFAF AAVA  A A A        A  AF   AA FAF   FF
   286   68 H T  E     -C  299   0A  67  221   23                   TST TT TTTTTTT TTTT  T T T        T  KT   TT TTT   TT
   287   69 H I  E     +C  298   0A   3  221   29                   VII IL IIIIILI ILMI  L L L        L  LI   LL ILI   IV
   288   70 H S  E     -C  297   0A  56  221   37                   SSS ST SSSSSTS TTSS  T T T        T  TS   TT STS   SS
   289   71 H R  E     -C  296   0A  71  221   60                   RRR RT RRRRRVR AAVT  S V A        A  AR   VA RAR   RR
   290   72 H D  E >>> -C  295   0A  55  221   10                   DDD DD DDDDDDD DDDD  D D D        A  DD   DD DDD   DD
   291   73 H T  T 345S+     0   0   78  220   57                   NTN NK NDNDNKN TKTT  T K K        T  KN   KK DKD   NN
   292   74 H S  T 345S+     0   0  105  220   44                   ASS AS ASASASS SSSS  S S S        S  SA   AS SSS   GS
   293   75 H L  T <45S-     0   0  103  217   69                   KKQ ES KKKQKSQ SSKK  S S S        S  SK   SS KSK   KA
   294   76 H N  T  <5 +     0   0   29  218   47                   NNS NS NSSSNSS NSNN  S S S        N  VN   SS SSN   NN
   295   77 H K  E   < -BC 239 290A  51  221   70                   TQI TT TSTMTTI TTQQ  T T T        T  TT   TT RTT   ST
   296   78 H F  E     -BC 238 289A   1  221   60                   LVL VA LVLLLAV AAFF  A A A        A  AL   AA LAL   LL
   297   79 H F  E     -BC 237 288A  50  221   32                   YFY YY YYYYFFY YYSS  Y Y Y        Y  FY   YF YYY   YF
   298   80 H I  E     -BC 236 287A   4  221    5                   LLL LM LLLLLML LMLL  M M M        L  LL   MM LML   LL
   299   81 H Q  E     -BC 235 286A  73  221   35                   QKQ QH QQQQQQH QQKK  Q E Q        Q  QQ   EQ QEQ   QE
   300   82 H L  E     -BC 234 285A   3  221   19                   MMM ML MVMMMLM LLLL  L L L        L  LM   LL MLM   MM
   301   82AH I        +     0   0   70  221   58                   SNN NS DTDNTSN SSSN  R R S        S  TN   RS SSN   NN
   302   82BH S  S    S-     0   0   59  221   33                   SSA SS SSSNSST SSSS  S S S        S  SS   SS SSS   SS
   303   82CH V        -     0   0    0  221   13                   LLL LL LFLLLLL LLVV  L L L        L  LL   LL LLL   LL
   304   83 H T    >   -     0   0   65  221   63                   KQR RT RRRKRTT TTTT  T T T        T  TR   TK RTK   RR
   305   84 H N  G >  S+     0   0  120  221   62                   SSA SS SPSTSPA SSAA  S S S        S  SA   SS AST   AP
   306   85 H E  G 3  S+     0   0  160  221   21                   EEE EE EEEEEEE EEAA  E E E        G  EE   EE EEE   EE
   307   86 H D  G <  S+     0   0    0  221    1                   DDD DD DDDDDDD DDDD  N D D        D  DD   DD DDD   DD
   308   87 H T    <   +     0   0   30  221   36                   TAS TS TTTTTTS TSTT  S S S        T  ST   SS TST   TT
   309   88 H A  E    S- H   0 333C   3  221    5                   ATA AA AAAAAAA AAAA  A A A        A  AA   AA GAA   AA
   310   89 H M  E     -EH 257 332C  43  221   61                   MTT TV TITMMVT IVVV  I V V        T  VV   VV IVV   LV
   311   90 H Y  E     -EH 256 331C   2  221    0                   YYY YY YYYYYYY YYYY  Y Y Y        Y  YY   YY YYY   YY
   312   91 H Y  E     -E  255   0C   1  221    3                   YYY YF YYYYYYY YFYF  F Y F        Y  FY   YF YYY   YY
   313   92 H c  E     +E  254   0C   0  221    1                   CCC CC CCCCCCC CCCC  C C C        C  CC   CC CCC   CC
   314   93 H S  E     -EI 253 327C   0  221   30                   AAA AA TTAVATA AAAA  A A A        L  AA   AA TAT   AA
   315   94 H R  E     -EI 252 326C  20  220   39                   .RR KR TRTKRRR RRRR  R R R        F  RR   RY NRT   KK
   316   95 H E  E     -EI 251 324C   0  220   75                   .ED GS DSNEEDV NDGD  T G S        Y  DG   GG AGN   EA
   317   96 H N  E  >> -E  250   0C   6  220   89                   .GR GS RRRGLGD LYRH  G Y G        G  SP   NY MYP   IH
   318   97 H H  T  45S+     0   0    0  220   93                   .YR EY YPWQWTY LFFS  G I Y        Y  DW   VD DYP   GS
   319   98 H M  T  45S+     0   0   73  221   94                   IPS YY YYLLLRG YDTD  Y S D        D  YQ   IA YVD   AG
   320   99 H Y  T  45S+     0   0  159  221   92                   NYS YS GYLGRIT GGYY  D Y Y        D  GC   YL WFY   HT
   321  100 H E  T  <5 -     0   0   54  221   92                   FYY GY YGLPRMN GYFH  G Y D        G  DD   YY GDY   NS
   322  100AH T      < +     0   0    0  221   92                   YFY YD NYHYIDY YDDS  Y S W        R  YN   SW QYY   FK
   323  100BH Y  S    S-     0   0   10  221   92                   GNY NL WNYYDAD YYYD  F Y F        D  FF   YG GWY   YF
   324  100CH F  E     +I  316   0C   0  221   93                   MYs yF FyFFYWY DWWa  D d A        y  DD   dQ TGg   yD
   325  101 H D  E     +     0   0C  42  133   50                   D.a dA TdDD... ...d  . d .        d  ..   d. ..d   d.
   326  102 H V  E     -I  315   0C  35  153   74                   S.Y YY YYYY... Y..F  Y Y Y        Y  DY   N. ..V   VP
   327  103 H W  E     -I  314   0C  28  177   14                   WWW WW WWWWW.W W..W  W W W        W  WW   W. ..W   WW
   328  104 H G        -     0   0    3  204   16                   GGG GG GGGGGGG GGGG  G G G        G  GG   GG S.G   GG
   329  105 H Q        -     0   0  100  183   48                   QQQ QQ QQQQQQQ QQQQ  Q Q Q        Q  QQ   Q. .QQ   QQ
   330  106 H G        -     0   0    3  191    7                   GGG GG GGGGGGG GGGG  G G G        G  GG   G. .GG   GG
   331  107 H T  E     -H  311   0C  27  202   47                   TVT VT TVVTTTT TVTL  T T T        T  AT   TT .TT   TT
   332  108 H T  E     -H  310   0C  48  208   81                   SML ML LMMTTST TMLR  T T L        T  TL   TP .TT   TL
   333  109 H V  E     -H  309   0C   0  214   25                   VVV VV VVVIIVL IVVV  I I V        I  VV   II VIV   VV
   334  110 H T  E     -d  227   0B  16  217   44                   TTT TT STTTTTT TTTT  T T T        T  TT   TT TTT   TT
   335  111 H V  E     +d  228   0B   2  218   17                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   336  112 H S        -     0   0   18  219   35                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   SS
   337  113 H S  S    S+     0   0   99  220   31                   SSA SA SSSSSSS SSSS  S S A        S  SS   SS SSS   SS
   338  114 H A  S    S-     0   0   31  221   51                   AAA AA AAAAAAA AAAA  A A A        A  AA   AA AAA   AA
   339  115 H K        -     0   0  143  209   69                   KEK EK EEEKKEK KESS  K K K        K  KS   KK KKS   SS
   340  116 H T        -     0   0   44  210   73                   TTT TT TTTTTTT TTTT  T T T        T  TT   TT TTT   TT
   341  117 H T  B     -J  370   0D  35  217   71                   TTT TT TTTTTTT TTKK  T T T        T  TT   TT TTK   KK
   342  118 H P        -     0   0   60  218   66                   PAP AP AAAAPAA AAGG  A A A        P  PA   AA AAG   GG
   343  119 H P        -     0   0   13  218   31                   PPP PP PPPPPPP PPPP  P P P        P  PP   PP PPP   PP
   344  120 H S  E     -K  367   0E  51  218   62                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   SS
   345  121 H V  E     -K  366   0E   6  219   45                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   346  122 H Y  E     -K  365   0E  27  220   34                   YYY YY YYYYYYY YYFF  Y Y Y        Y  YF   YY YYF   FF
   347  123 H P  E     -K  364   0E  15  220   29                   PPP PP PPPPPPP PPPP  P P P        P  PP   PP PPP   PP
   348  124 H L  E     +K  363   0E   4  221    3                   MLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   LL
   349  125 H A        -     0   0   10  221   68                   AAA AA AAAAAAA AAAA  A A A        A  AA   AA AAA   AA
   350  126 H P        -     0   0   24  216   47                   PPP PP PPPPPPP PPPP  P P P        P  PP   PP PPP   PP
   351  127 H G  S    S-     0   0   16  219   75                   GGG GG GGGVGGV VGSS  V V V        G  GS   VV VVS   SC
   352  128 H S  S    S+     0   0   99  219   60                   STS TS TTTCCTC CTSS  C C C        C  CC   CC CCS   SS
   353  129 H A        +     0   0   52  220   92                   AAA AA AAAGGAG GAKR  G G G        G  GG   GG GGK   KR
   354  130 H A        +     0   0   70  136   83                   ALA LA LLLDDLD DLSS  D D G        D  DS   GD DDS   SS
   355  133 H Q        +     0   0  178  159   73                   QKQ KQ KKKTTKT TKTT  T T T        T  TT   TT TTT   TT
   356  134 H T    >   -     0   0   64  220   50                   TST ST SSSTTST TSSS  T T T        T  TS   TT TTS   SS
   357  135 H N  T 3  S-     0   0  146  221   56                   NNN NN NNNGGNG GNGE  G G G        G  GG   GG GGG   GE
   358  136 H S  T 3  S+     0   0   63  221   63                   SSS SS SSSSSSS SSGS  S S S        S  SS   SS SSG   GS
   359  137 H M  E <   - L   0 408E  83  221   79                   MMM MM MMMSSMS SMTT  S S S        S  ST   SS SST   TT
   360  138 H V  E     - L   0 407E  15  221   34                   VVV VV VVVVVVV VVAA  V V V        V  VV   VV VVA   AA
   361  139 H T  E     + L   0 406E  15  221   70                   TTT TT TTTTTTT TTAA  T T T        T  TA   TT TTA   AA
   362  140 H L  E     + L   0 405E   0  221   27                   LLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   LL
   363  141 H G  E     -KL 348 404E   0  221   30                   GGG GG GGGGGGG GGGG  G G G        G  GA   GG GGG   GG
   364  142 H e  E     -KL 347 403E   1  221    0                   CCC CC CCCCCCC CCCC  C C C        C  CC   CC CCC   CC
   365  143 H L  E     -KL 346 402E   2  221   33                   LLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   LL
   366  144 H V  E     -KL 345 401E   1  221   49                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   367  145 H K  E     -KL 344 400E  38  220   74                   KKK KK KKKKKKK KKKK  K K K        K  KS   KK KKK   KK
   368  146 H G  E    S+     0   0E  19  221   50                   GGG GG GGGGGGG GGDD  G G G        G  GG   GG GGD   DD
   369  147 H Y  E     - L   0 399E   0  221   18                   YYY YY YYYYYYY YYYY  Y Y Y        Y  YY   YY YYY   YY
   370  148 H F  B     +J  341   0D   3  221   42                   FFF FF FFFFFFF FFFF  F F F        F  FF   FF FFF   FF
   371  149 H P  S    S-     0   0    0  221   37                   PPP PP PPPPPPP PPPP  P P P        P  PP   PP PPP   PP
   372  150 H E  S    S+     0   0   53  211   46                   EEE EE EEEEEEE EEEE  E E E        E  EE   EE EEE   EE
   373  151 H P        +     0   0   59  219   54                   PPP PP PPPPSPP PPPP  P P P        S  SP   PP PPP   PP
   374  152 H V        -     0   0   20  221   53                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   375  153 H T  E     +N  422   0F  83  220   71                   ATT TT TTTTTTT TTTT  T T T        T  TT   TT TTT   TT
   376  154 H V  E     +N  421   0F  23  221   43                   VVV VV VVVLVVL LVVV  L L L        V  VV   LL LLV   VV
   377  156 H T  E     -N  420   0F  48  221   56                   TTT TT TTTTTTT TTSS  T T T        T  TS   TT TTS   SS
   378  157 H W  E > >S-NO 419 383F   2  221    0                   WWW WW WWWWWWW WWWW  W W W        W  WW   WW WWW   WW
   379  162 H N  G > 5S-     0   0   38  221   69                   NNN NN NNNNNNN NNNN  N N N        N  NN   NN NNN   NN
   380  163 H S  G 3 5S-     0   0   91  218   63                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   SS
   381  164 H G  G < 5S+     0   0   39  218   55                   GGG GG GGGGGGG GGGG  G G G        G  GG   GG GGG   GG
   382  165 H S  T < 5 +     0   0   93  221   60                   SAS AS AAASSAS PAAS  S S S        S  SS   SS SSA   AA
   383  166 H L  B   < +O  378   0F  43  221   87                   LLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   LL
   384  167 H S        +     0   0   88  221   69                   SSS SS SSSSSSS SSTT  S S S        S  ST   SS SST   TT
   385  168 H S  S    S+     0   0  101  221   77                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   SS
   386  169 H G  S    S+     0   0   32  218   43                   GGG GG GGGGSGG GGGG  G G G        S  SG   GG GGG   GG
   387  171 H V        +     0   0   48  219   62                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   388  172 H H  E     -M  404   0E  17  220   80                   HHH HH HHHHHHH HHHH  H H H        H  HH   HH HHH   HH
   389  173 H T  E     -M  403   0E  69  220   82                   TTT TT TTTTTTT TTTT  T T T        T  TT   TT TTT   TT
   390  174 H F  E     -M  402   0E   1  219   43                   FFF FF FFFFFFF FFFF  F F F        F  FF   FF FFF   FF
   391  175 H P  E     -     0   0E  65  219   32                   PPP PP PPPPPPP PPPP  P P P        P  PP   PP PPP   PP
   392  176 H A  E     -     0   0E  19  215   65                   AAA AA AAAAAAA AAAA  A A A        A  AS   AV AAA   AA
   393  177 H V  E     -M  400   0E  42  214   63                   VVV VV VVVVLVV VVVV  V V L        L  LV   LV VVV   VV
   394  178 H L  E     -M  399   0E  77  214   65                   LLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   LL
   395  179 H Q  S    S-     0   0   83  214   70                   QQQ QQ QQQQQQQ QQQQ  Q Q Q        Q  QQ   QQ QQQ   QQ
   396  180 H S  S    S-     0   0  116  214   49                   SSS SS SSSSSSS SSss  S S S        S  Ss   SS SSs   ss
   397  183 H D  S    S+     0   0   90  206   25                   DGD GD GGGDGGD DGgg  D D G        G  Gg   GD DDg   gg
   398  184 H L        -     0   0   53  199   75                   LLL LL LLLLLLL LLLL  L L L        L  LL   LL LLL   LL
   399  185 H Y  E     -LM 369 394E  36  205    2                   YYY YY YYYYYYY YYYY  Y Y Y        Y  YY   YY YYY   YY
   400  186 H T  E     +LM 367 393E   5  195   48                   TTT TT TTTTTTT TTSS  T T T        T  TS   TT TTS   SS
   401  187 H L  E     -L  366   0E  11  190   56                   LLL LL LLLLMLL LLLL  L L L        M  ML   LL LLL   LL
   402  188 H S  E     -LM 365 390E   5  191   26                   STS TS TTTSSTS STSS  S S S        S  SS   SS SSS   SS
   403  189 H S  E     -LM 364 389E   2  191    0                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   SS
   404  190 H S  E     -LM 363 388E   0  191   77                   SSS SS SSSSSSS SSVV  S S S        S  SM   SS SSV   VV
   405  191 H V  E     -L  362   0E   0  190   27                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   406  192 H T  E     +L  361   0E  48  189   37                   TTT TT TTTTTTT TTTT  T T T        T  TT   TT TTT   TT
   407  193 H V  E     -L  360   0E  14  188   30                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   408  194 H P  E  >  -L  359   0E  56  188   40                   PPP PP PPPTPPT TPPP  T T T        P  PP   TT TTP   PP
   409  195 H S  T  4 S+     0   0   49  187   50                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   SS
   410  196 H S  T  4 S+     0   0   66  187   69                   SSS SS SSSSSSS SSSS  S S N        S  SS   NS SSS   SS
   411  198 H P  T  > S+     0   0   31  187   72                   TTT TT TTTTTTT TTSS  T T T        T  TR   TT TTS   SN
   412  199 H R  T  < S+     0   0   16  187  102                   WWW WW WWWWWWW WWLL  W W W        W  WW   WW WWL   LF
   413  200 H P  T  4 S+     0   0   80  188   68                   PSP PP PPSPPSP PSGG  P P P        P  PP   PP PPG   GG
   414  202 H S  T  4 S+     0   0  111  188   69                   SSS SS SSSSSSS SSTT  S S S        S  SS   SS SST   TT
   415  203 H E  S  < S-     0   0  128  188   76                   EQQ QE QQQQQQQ QQQQ  Q Q Q        Q  QE   QQ QQQ   QQ
   416  204 H T        -     0   0   83  188   70                   TAT TT TTASTAS SATT  S S T        T  TT   TS SST   TT
   417  205 H V        +     0   0    4  184   61                   VVV VV VVVIVVI IVYY  I I I        V  VF   II IIY   YY
   418  206 H T  E     - P   0 433F  23  183   70                   TTT TT TTTTTTT TTIV  T T T        T  TT   TT TTI   IT
   419  208 H e  E     -NP 378 432F   0  187    0                   CCC CC CCCCCCC CCCC  C C C        C  CC   CC CCC   CC
   420  209 H N  E     -NP 377 431F   4  187   60                   NNN NN NNNNSNN NNNN  N N N        S  SN   NN NNN   NN
   421  210 H V  E     -NP 376 430F   1  187   16                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   422  211 H A  E     -NP 375 429F  14  187   74                   AAA AA AAAAAAA AANN  A A A        A  AA   AA AAN   ND
   423  212 H H  E > > - P   0 428F   1  187    7                   HHH HH HHHHHHH HHHH  H H H        H  HH   HH HHH   HH
   424  213 H P  G > 5S+     0   0   77  177   83                   PPP PP PPPPPPP PPKK  P P P        P  PP   PP PPK   KK
   425  214 H A  G 3 5S+     0   0   40  177   67                   AAA AA AAAAAAA AAPP  A A A        A  AA   AA AAP   PP
   426  215 H S  G < 5S-     0   0   32  176   64                   SSS SS SSSSSSS SSSS  S S S        S  SS   SS SSS   SS
   427  216 H S  T < 5 +     0   0  111  176   72                   SSS SS SSSSSSS SSNN  S S S        S  SK   SS SSN   NN
   428  217 H T  E   < +P  423   0F  35  176   66                   TTT TT TTTTTTT TTTT  T T T        T  TT   TT TTT   TT
   429  218 H K  E     +P  422   0F 135  176   53                   KKK KK KKKKTKK KKKK  K K K        T  TK   KK KKK   KK
   430  219 H V  E     -P  421   0F  38  125   32                   VVV VV VVVVVVV VVVV  V V V        V  VV   VV VVV   VV
   431  220 H D  E     -P  420   0F  97  125   35                   DDD DD DDDDDDD DDDD  D D D        D  DD   DD DDD   DD
   432  221 H K  E     -P  419   0F  51  113   47                   KKK KK KKKKKKK KKKK  K K K        K  KK   KK KKK   KK
   433  222 H K  E     -P  418   0F 121  113   52                   KKK KK KKKKKKK KKKR  K K K        K  KP   KK KKK   RT
   434  223 H I        -     0   0    4  109   32                   III II IIIILII IIVV  I I I        L  LV   II IIV   VV
   435  224 H V        -     0   0   79  101   61                   VVV VV VVVEEVE EVEE  E E E        E  EP   EE EEE   EE
   436  225 H P              0   0   73   92   66                   PPP PP PPPPPPP PPPI  P P P        P  PK   PP PPP   PR
   437  226 H R              0   0  167   78   25                   RRR RR RRRR RR RRKK  R R R            R   RR RRK   KK
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 L D              0   0  100   71   31  EDD  ED D D D    DD                                       Q       QQQ 
     2    2 L I        -     0   0    0   77   33  IVI  IV V I I    II                                       I       III 
     3    3 L V        -     0   0   88   83   53  VVV  VV V Q E    EQ      V                                V       VVV 
     4    4 L M  E     -Q   25   0G  12   86   20  LLM  LL L M M    VM      V                                I       LLL 
     5    5 L T  E     -Q   24   0G  80   86   17  TTT  TT T T T    TI      T                                T       TTT 
     6    6 L Q  E     -Q   23   0G  19   86    6  QQQ  QQ Q Q Q    QQ      Q                                Q       QQQ 
     7    7 L S  E    S+Q   22   0G  57   86   54  STT  ST T S H    SS      S                                T       SSS 
     8    8 L P        -     0   0   47  128    7  PPP  PP P P L    PP      P                                P       PPP 
     9    9 L A  S    S-     0   0   79  136   69  GLP  AL L S L    YS      S                                A       DDD 
    10   10 L S  E     -t  107   0H  78  142   56  TSS  TS S S S    SS      S                                S       YYY 
    11   11 L L  E     -t  108   0H  34  176   45  LLL  LL L L L    LL      L                                L       VVV 
    12   12 L V  E     +t  109   0H  86  187   34  SSS  SS S F P    AS      S                                H       SSS 
    13   13 L V  E     -t  110   0H  17  189   58  FVV  LV V A V    VA      A                                V       VVV 
    14   14 L S  E >   -t  111   0H  46  199   61  SIS  SI I S P    SS      S                                N       SSS 
    15   15 L L  T 3  S+     0   0   79  198   66  PPP  PP P V P    LV      L                                P       LPP 
    16   16 L G  T 3  S+     0   0   39  206    7  GGR  GG G G G    GG      G                                G       GGG 
    17   17 L Q    <   -     0   0   97  206   52  EEE  EE E D E    ED      D                                D       EEE 
    18   18 L R        -     0   0  152  206   62  RTT  RT T R P    TR      R                                R       TTT 
    19   19 L A  E     - R   0  79G   2  206   44  AVA  AV V V A    VV      V                                V       VVA 
    20   20 L T  E     - R   0  78G  66  207   59  TTS  TT S T S    TT      S                                T       TTT 
    21   21 L I  E     - R   0  77G   0  207   22  LII  LI I I I    LI      I                                I       LIL 
    22   22 L S  E     -QR   7  76G  36  207   50  SSS  SS S T S    ST      T                                Q       TTT 
    23   23 L a  E     -QR   6  75G   0  207    0  CCC  CC C C C    CC      C                                C       CCC 
    24   24 L R  E     -QR   5  74G 153  207   75  RKK  RK K R R    RR      Q                                K       KKK 
    25   25 L A  E     -Q    4   0G   6  207   68  ASA  AS S A S    AA      A                                A       AAA 
    26   26 L S  S    S+     0   0   63  207   52  STS  ST T S S    SS      S                                S       SSS 
    27   27 L E  S    S-     0   0  105  207   72  QQQ  QQ Q Q Q    QQ      Q                                S       SSS 
    28   27AL S        -     0   0   29  207   74  Tss  Is s D s    sG      S                                S       ssS 
    29   27BL V        +     0   0    0   57   77  .kl  .k k I l    s.      .                                .       va. 
    30   27CL D  E     +Z   35   0I  45   79   82  .YH  .Y Y E H    N.      .                                .       YD. 
    31   27DL S  E >  S+Z   34   0I  15  116   82  .SS  .S S S S    Q.      .                                .       SS. 
    32   28 L Y  T 3  S-     0   0  173  119   89  .DD  .D N I D    S.      .                                .       DD. 
    33   29 L G  T 3  S+     0   0   81  200   60  vGG  vG G S G    II      I                                M       GGV 
    34   30 L K  E <  S-Z   31   0I 112  170   77  sKN  sK R . N    SS      D                                S       DDS 
    35   31 L S  E     -Z   30   0I   7  186   77  STT  AT T . T    NS      T                                N       SNN 
    36   32 L F        +     0   0    5  198   68  HYY  YY Y . Y    WC      K                                D       LRW 
    37   33 L M  E     -U   94   0H   0  205   51  LLL  LL F . L    LL      L                                M       IIL 
    38   34 L H  E     -U   93   0H   0  207   81  AQD  AQ F N D    HA      A                                A       FAA 
    39   35 L W  E     -UV  92  52H   0  207    0  WWW  WW W W W    WW      W                                L       WWW 
    40   36 L Y  E     -UV  91  50H   0  207   13  YFY  YF L Y Y    FY      G                                Y       FYY 
    41   37 L Q  E     -UV  90  49H   4  207   25  QQL  QQ Q Q L    QQ      Q                                Q       QQQ 
    42   38 L Q  E     -U   89   0H  16  207   13  QHQ  QH H Q Q    HQ      Q                                F       QQQ 
    43   39 L K    >   -     0   0   47  207   59  RKK  KK K K K    PK      K                                I       KKK 
    44   40 L P  T 3  S+     0   0   81  207   39  PPP  PP P P P    PP      P                                L       SSS 
    45   41 L G  T 3  S+     0   0   58  206   20  GGG  GG G G G    GG      G                                G       GGG 
    46   42 L Q  S <  S-     0   0  103  207   70  QQQ  QQ Q T Q    QK      K                                Q       KQQ 
    47   43 L P        -     0   0   34  207   58  ASS  AS S V S    AA      A                                K       AAA 
    48   44 L P        -     0   0    5  207   20  PPP  PP P L P    PP      P                                P       PPP 
    49   45 L K  E     -V   41   0H  96  207   71  RRQ  RR Q K Q    RK      K                                K       KKK 
    50   46 L V  E     +V   40   0H  10  207   43  LLL  LL S P L    LL      L                                L       TLL 
    51   47 L L  E     +     0   0H   2  207   26  LLL  LL L L L    LL      L                                L       LLL 
    52   48 L I  E     -VW  39  58H   0  207   24  III  MI I I I    II      I                                I       III 
    53   49 L Y  E  >  + W   0  57H  54  207   35  YYY  FW Y Y Y    YY      Y                                H       YYY 
    54   50 L I  T >4 S-     0   0   10  207   91  GQL  GQ E E T    LR      A                                D       WYG 
    55   51 L A  T 34 S+     0   0    2  207   75  AIV  SI V A I    AA      V                                A       AAA 
    56   52 L S  T 34 S+     0   0   73  207   57  SSS  SS S S S    SS      P                                T       TNS 
    57   53 L N  E <<  -W   53   0H  77  205   73  SNN  SN K K N    SN      R                                S       RST 
    58   54 L L  E     -W   52   0H  63  207   64  RRR  RR R L K    LL      S                                R       RRR 
    59   55 L E    >   -     0   0   49  207   82  AYF  AN N Q F    HE      P                                F       HHH 
    60   56 L S  T 3  S+     0   0  107  207   43  TTT  TT T S Y    ST      S                                T       TTT 
    61   57 L G  T 3  S+     0   0   67  207   15  GGG  GG G G G    GG      W                                G       GGG 
    62   58 L V    <   -     0   0   17  207   42  IVV  IV V V V    VV      F                                T       TTT 
    63   59 L P    >   -     0   0   62  207   24  PPS  PP P P P    PP      P                                P       PPP 
    64   60 L A  T 3  S+     0   0   99  207   57  DDD  DD S S N    AS      S                                D       EEE 
    65   61 L R  T 3  S+     0   0   30  207    7  RRR  RR R R K    RR      Q                                H       RRR 
    66   62 L F  E <   -S   79   0G   7  207    2  FFF  FF F F F    FF      F                                F       III 
    67   63 L S  E     -S   78   0G  59  207   17  STS  ST T S S    SS      S                                S       SSS 
    68   64 L G  E     +S   77   0G  17  207    7  GGG  GG G S G    GG      G                                G       GGG 
    69   65 L S  E     +S   76   0G  48  207   40  SSS  SS S S S    SS      S                                S       SSS 
    70   66 L G  E     -S   75   0G  35  207   76  GGG  GG G G R    GG      G                                Y       GGG 
    71   67 L S  E >   +S   74   0G  68  206   22  SSS  SS S S S    SF      F                                S       SSS 
    72   68 L R  T 3  S-     0   0  163  206   33  GEG  GE E G G    GG      G                                G       GGG 
    73   69 L T  T 3  S+     0   0   51  206   59  TTT  TT T A T    TS      A                                T       TTT 
    74   70 L D  E <   +RS  24  71G  77  206   64  DDD  DD D D G    DG      D                                D       DDD 
    75   71 L F  E     -RS  23  70G   0  206   82  FFF  FF F F F    FT      F                                F       FFF 
    76   72 L T  E     -RS  22  69G  33  206   58  TTT  TT T T T    SD      T                                T       TTT 
    77   73 L L  E     -RS  21  68G   0  206    3  LLL  LL L L L    LF      L                                F       LLL 
    78   74 L T  E     -RS  20  67G  28  206   44  TTR  TT T T K    TT      T                                T       TTT 
    79   75 L I  E     -RS  19  66G   0  206    3  III  II I I F    IL      I                                I       III 
    80   76 L D  S    S+     0   0   68  206   39  TSS  SS S T S    SS      S                                S       SSS 
    81   77 L P  S    S-     0   0   51  206   60  RSR  RS S S K    AS      S                                G       RRR 
    82   78 L V        +     0   0    0  206   50  LVV  LV V L V    VL      L                                V       MMM 
    83   79 L E    >   -     0   0   93  206   33  EQE  EQ Q Q E    EE      K                                R       EEE 
    84   80 L A  G >  S+     0   0   22  206   52  PAA  PA A P A    PP      A                                P       AAA 
    85   81 L D  G 3  S+     0   0   58  206   27  EEN  EE E E E    QE      D                                E       EEE 
    86   82 L D  G <   +     0   0    1  206    0  DDD  DD D D D    DD      D                                D       DDD 
    87   83 L A    <   +     0   0   12  206   78  FAT  FA A A E    IF      I                                A       AAA 
    88   84 L A  E    S- X   0 108H   8  206   19  AGG  AG G A G    GA      A                                A       AAA 
    89   85 L T  E     -UX  42 107H  35  207   69  VVV  VV V I F    LV      T                                E       DDD 
    90   86 L Y  E     -UX  41 106H   0  207    5  YYY  YY Y Y L    YY      Y                                Y       YYY 
    91   87 L Y  E     -U   40   0H   9  207    7  FYY  YY Y Y F    CY      Y                                Y       YYY 
    92   88 L a  E     -U   39   0H   0  207    4  CCC  CC C C S    CC      C                                C       CCC 
    93   89 L Q  E     -UY  38 102H   1  207   79  QLG  QL S Q K    SQ      Q                                G       MQQ 
    94   90 L Q  E     +UY  37 101H   0  207   84  QQQ  QQ Q N T    LQ      Q                                Q       QQQ 
    95   91 L N        +     0   0    0  185   59  YRE  YR G Y I    VY      D                                G       DGY 
    96   92 L N  S    S+     0   0    1  190   79  GSn  gs s L E    kS      h                                y       FWw 
    97   93 L E  S    S-     0   0   48  189   80  TD.  .. . . S    nS      n                                .       QEp 
    98   94 L D  S    S+     0   0   42  192   76  sS.  .. . . s    hW      c                                .       SLL 
    99   95 L P  S    S-     0   0   26  108   72  sPp  qp p . w    vP      v                                p       PP. 
   100   96 L P        -     0   0    4  141   88  LHH  GH Y . W    YP      N                                F       YLT 
   101   97 L T  E     -Y   94   0H  26  181   65  TTS  TT T . T    TT      T                                T       TNH 
   102   98 L F  E     -Y   93   0H  26  205    9  FFF  FF F . F    FF      F                                F       FFF 
   103   99 L G        -     0   0    3  207   13  GGG  GG G G G    GN      G                                G       GGG 
   104  100 L A        -     0   0   81  207   63  GQQ  PQ Q S Q    DP      Q                                A       GKG 
   105  101 L G        -     0   0   12  207   10  GGG  GG G S G    GR      G                                P       GGG 
   106  102 L T  E     - X   0  90H   0  207   10  TTT  TT T P T    TT      T                                T       TTT 
   107  103 L K  E     -tX  10  89H  74  207   54  RKK  KK K T K    QK      K                                K       RRR 
   108  104 L L  E     +tX  11  88H   2  206   19  VVL  VV V V L    LV      V                                L       VVV 
   109  105 L E  E     -t   12   0H  14  207   67  EEE  DE E L E    EE      E                                M       EEE 
   110  106 L M  E     -t   13   0H   0  207   27  III  II I Q I    II      I                                V       III 
   111  107 L R  E     +t   14   0H 126  207   85  KKK  KK K I K    KK      K                                K       KKK 
   112  108 L R        -     0   0   64  207   79  RRR  RR R R R    RR      R                                Q       RRR 
   113  109 L A        -     0   0   71  198   67  TSN  TS S T T    SA      S                                R       ANA 
   114  110 L D        -     0   0   58  203   71  VDD  VD D V V    VV      D                                d       DDD 
   115  111 L A  B     -A  144   0J  19  204   57  AAA  AA A A A    AA      A                                a       AAA 
   116  112 L A        -     0   0   40  206   62  AEQ  AE E A A    TA      E                                A       IKI 
   117  113 L P        -     0   0    9  206    1  PPP  PP P P P    PP      P                                P       PPP 
   118  114 L T  E     -B  141   0K  85  206   55  SSA  SS S S S    SS      S                                S       VAV 
   119  115 L V  E     -B  140   0K   8  206   18  VVV  VV V V V    AV      V                                A       VVV 
   120  116 L S  E     -B  139   0K  17  206   69  FFY  FF F F F    FF      F                                S       FFF 
   121  117 L I  E     -B  138   0K  22  207   30  ILL  IL L I I    II      L                                I       III 
   122  118 L F  E     -B  137   0K   4  207    7  FFF  FF F F F    FF      F                                F       FFF 
   123  119 L P        -     0   0    5  207   23  PKQ  PK K P P    QP      K                                P       KKK 
   124  120 L P        -     0   0    1  207    4  PPP  PP P P P    PP      P                                P       PPP 
   125  121 L S    >>  -     0   0    8  207    4  SSS  SS S S S    SS      S                                S       SSS 
   126  122 L S  H 3> S+     0   0   78  207   65  DDP  DD D E D    PE      D                                Q       EDE 
   127  123 L E  H 3> S+     0   0   76  207   23  EED  EE E D E    ED      E                                E       EEE 
   128  124 L Q  H <4>S+     0   0    8  207   27  QQQ  QQ Q Q Q    QQ      Q                                Q       QQQ 
   129  125 L L  H ><5S+     0   0   29  207   22  LLL  LL L V L    LV      L                                L       VVV 
   130  126 L T  H 3<5S+     0   0  111  207   71  KKH  KK K K K    QK      K                                K       KKK 
   131  127 L S  T 3<5S-     0   0   83  207   67  STT  ST T S S    TS      T                                T       EEE 
   132  128 L G  T < 5S+     0   0   34  207   53  GGG  GG G G G    GG      G                                N       GGG 
   133  129 L G  E   < - C   0 186K  21  205   60  TTS  TT T T T    ST      T                                S       NNN 
   134  130 L A  E     - C   0 185K   0  207   13  AVA  AV V A A    AA      V                                A       PPP 
   135  131 L S  E     - C   0 184K   2  207   38  SSS  SS S T S    ST      S                                T       TTT 
   136  132 L V  E     - C   0 183K   0  207   28  VVV  VV V V V    LV      V                                M       AAA 
   137  133 L V  E     -BC 122 182K   0  207   12  VVV  VV V V V    VV      V                                V       VVV 
   138  134 L b  E     -BC 121 181K   0  207    3  CCC  CC C C C    CC      C                                C       CCC 
   139  135 L F  E     -BC 120 180K   0  207   31  LLL  LL L L L    LL      L                                L       LLL 
   140  136 L L  E     -BC 119 179K   0  206   48  LVL  LV V L L    VL      V                                V       III 
   141  137 L N  E     -B  118   0K   2  207   48  NNN  NN N N N    NN      N                                T       NNN 
   142  138 L N  E    S+     0   0K  49  207   47  NDS  ND D G N    NG      D                                G       NNN 
   143  139 L F  E     - C   0 177K   0  207   30  FFF  FF F F F    FF      F                                F       FFF 
   144  140 L Y  B    S+A  115   0J   9  206   40  YYY  YY Y Y Y    YY      Y                                Y       YFY 
   145  141 L P  S    S-     0   0   18  207    7  PPP  PP P P P    PP      P                                P       PPP 
   146  142 L K  S    S+     0   0   83  206   75  RKK  RK K R R    KR      K                                S       RRR 
   147  143 L D        +     0   0  116  207   72  EDD  ED D D E    ED      D                                D       SDS 
   148  144 L I        -     0   0   19  206   60  AII  AI I A A    AA      I                                L       VLV 
   149  145 L N  E     -E  201   0L  82  207   67  KNN  KN N K K    SK      N                                N       TTT 
   150  146 L V  E     -E  200   0L  27  207   11  VVV  VV V V V    VV      V                                V       IVI 
   151  147 L K  E     -E  199   0L  53  207   75  QKK  QK K K Q    VK      K                                A       KTK 
   152  148 L W  E     +E  198   0L   3  207    2  WWW  WW W W W    WW      W                                W       WWW 
   153  149 L K  E     +EF 197 158L  76  207   39  KKK  KK K K K    KK      K                                K       KKK 
   154  150 L I  E    S-E  196   0L   0  207   67  VVV  VV V V V    VV      V                                A       VVV 
   155  151 L D  S    S-     0   0   71  207   19  DDD  DD D D D    DD      D                                D       DDD 
   156  152 L G  S    S+     0   0   63  207   35  NGG  NG G D N    ND      G                                G       GSG 
   157  153 L S  S    S-     0   0   33  206   68  AVV  AV V V V    AV      V                                K       QQQ 
   158  154 L E  B     -F  153   0L  85  206   78  LTI  LT T V L    VV      T                                A       DDD 
   159  155 L R        -     0   0   69  207   77  QQQ  QQ Q Q Q    KQ      Q                                V       VVV 
   160  156 L Q        +     0   0  133  207   73  SSD  SS S S S    NS      S                                T       ISI 
   161  157 L N  S    S+     0   0  117  207   69  GST  GS S D G    TD      S                                G       ASA 
   162  158 L G  S    S+     0   0   29  207   34  NsG  Ns s n N    Gn      s                                D       SSS 
   163  159 L V  E     -D  183   0K  46   65   74  Sf.  Sf f i S    Ii      f                                .       DDD 
   164  160 L L  E     -D  182   0K  16  192   49  QQI  QQ Q Q Q    SQ      Q                                V       IVI 
   165  161 L N  E     +D  181   0K  52  196   54  ENQ  EN N D E    TD      N                                Q       KKK 
   166  162 L S  E     -D  180   0K  12  204   50  SSE  SS S S S    SS      S                                T       NTN 
   167  163 L W  E     -D  179   0K  99  204   72  VFS  VF F I V    VI      F                                S       SSS 
   168  164 L T        -     0   0   24  204   69  TTV  TT T T T    TT      T                                S       DDD 
   169  165 L D        -     0   0   99  204   75  EDT  ED D E E    EA      D                                A       YFY 
   170  166 L Q        -     0   0   18  206   75  QQE  QQ Q Q Q    QA      Q                                A       MMM 
   171  167 L D     >  -     0   0   48  206   62  DDQ  DD D D D    D       D                                S       QQQ 
   172  168 L S  T  4 S+     0   0   54  206   61  SSD  SS S S S    S       S                                E       EEE 
   173  169 L K  T  4 S+     0   0  180  206   55  KKK  KK K K K    K       K                                A       SSS 
   174  170 L D  T  4 S-     0   0   57  206   36  DKD  DK K D D    D       K                                D       DDD 
   175  171 L S     <  +     0   0    4  206   54  SSS  SS S N N    N       S                                K       NSN 
   176  172 L T        -     0   0    5  206   71  TTT  TT T T T    T       T                                T       TTT 
   177  173 L Y  E     -C  143   0K   7  204    1  YYY  YY Y Y Y    Y       Y                                Y       YYY 
   178  174 L S  E     -     0   0K   1  205   68  SSS  SS S S S    S       S                                K       SSS 
   179  175 L M  E     -CD 140 167K   0  206   80  LLL  LL L L L    L       L                                L       QQQ 
   180  176 L S  E     -CD 139 166K   3  206    3  SSS  SS S S S    S       S                                S       SSS 
   181  177 L S  E     -CD 138 165K   0  206    0  SSS  SS S S S    S       S                                S       SSS 
   182  178 L T  E     -CD 137 164K   2  206   71  TIT  TI I T T    T       I                                T       MMM 
   183  179 L L  E     -CD 136 163K   0  206    0  LLL  LL L L L    L       L                                L       LLL 
   184  180 L T  E     +C  135   0K  36  206   53  TTT  TT T T T    A       T                                T       TTT 
   185  181 L L  E     -C  134   0K  16  206    9  LLM  LL L L L    L       L                                L       LLL 
   186  182 L T  E  >  -C  133   0K  81  205   54  SPS  SP P S S    S       P                                S       TTT 
   187  183 L K  H >> S+     0   0   66  204   67  KSS  KS S S K    A       S                                R       KKK 
   188  184 L D  H 3> S+     0   0  109  205   63  AST  AS S T A    N       S                                D       DDD 
   189  185 L E  H >4 S+     0   0   53  205   48  DEE  DE E E E    D       E                                E       KKK 
   190  186 L Y  H X< S+     0   0    6  205   12  YYY  YY Y Y Y    Y       Y                                Y       WWW 
   191  187 L E  H 3< S+     0   0   90  205   71  EQL  EQ Q Q E    N       Q                                N       DDD 
   192  188 L R  T << S+     0   0  160  205   58  KSS  KS S R K    N       S                                S       KKK 
   193  189 L H    <   -     0   0   24  203   55  HHH  HH H H H    H       H                                H       SAS 
   194  190 L N  S    S+     0   0   97  203   71  KDE  KD D N K    E       D                                D       EDE 
   195  191 L S  E     + G   0 214L  37  203   71  VAL  VA A V A    T       A                                T       KKK 
   196  192 L Y  E     +EG 154 213L   0  203   15  YYY  YY Y Y Y    Y       Y                                Y       FFF 
   197  193 L T  E     -EG 153 212L   3  203   48  ATS  AT T A A    S       T                                D       EEE 
   198  194 L b  E     -EG 152 211L   1  203    0  CCC  CC C C C    C       C                                C       CCC 
   199  195 L E  E     -EG 151 210L  34  203   61  EEE  EE E E E    E       E                                E       LLL 
   200  196 L A  E     -EG 150 209L   1  203   23  VVI  VV V V V    I       V                                V       VVV 
   201  197 L T  E     +E  149   0L  36  203   31  TST  TS S T T    I       S                                T       QKQ 
   202  198 L H  E >   - G   0 205L  18  203   19  HHH  HH H H H    H       H                                H       HHH 
   203  199 L K  T 3  S+     0   0  145  202   55  QKK  QK K Q Q    Q       K                                K       KKK 
   204  200 L T  T 3  S+     0   0   55  202   40  GSS  GS S S G    S       S                                T       TTT 
   205  201 L S  E <   -G  202   0L  45  180   82  LLL  LL L L L    L       L                                L           
   206  202 L T  E    S+     0   0L 140  180   32  STP  ST T T S    P       T                                T           
   207  203 L S  E    S-     0   0L  82   83   48  STS  ST T S S    S       T                                K           
   208  204 L P  E     -     0   0L  43   67   33  PTT  PT T P P    P       A                                P           
   209  205 L I  E     -G  200   0L  46   67   29  VLL  VL L L V    L       L                                L           
   210  206 L V  E     +G  199   0L  70   63   53  TVI  TV V T T    V       V                                V           
   211  207 L K  E     +G  198   0L  85   63   26  KKK  KK K K K    K       K                                K           
   212  208 L S  E     -G  197   0L  67   63   28  SSS  SS S S S    S       S                                S           
   213  209 L F  E     -G  196   0L  30   63   18  FFF  FF F F F    F       F                                F           
   214  210 L N  E      G  195   0L  99   63   62  NSQ  NS S R N    Q       S                                R           
   215  211 L R              0   0   82   54   19  RKR  RK K K R    R       K                                R           
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  192   30     QQ  Q E   QEEE  EDEEEE EQEQEEEEEEEEQEEQQ EEEEEEEEEEEEQQ EEEEEEE   E
   218    2 H V        +     0   0   30  194   40     VL  V V   VVVV  VVEEEV VVVAVVVEEEEEVIEVL VEVEEEEEEEEEVV EEEEEEE   E
   219    3 H K  E     -A  241   0A 143  197   48     QQ  Q Q   QQQQ  QQNKKK QHQQQQQKKKKKQQEQQ QKKKKKKKKKKKRQ KKKKRKK   N
   220    4 H L  E     -A  240   0A  11  217    3     LL  L L   LLLL  LLLLLL LLLVLLLLLLLLLLLLLLLVLLLLLLLLLLLL LVLLLLL   L
   221    5 H Q  E     -A  239   0A 120  217   73     QQ  V V   VVVV  VVVVVV LVVVVVVVVVVVVVVVQEVVVVVVVVVVVVVQ VVVVVVV   V
   222    6 H E  E     -A  238   0A   2  218   33     EE  E E E EEEE  EEEEEE EQEEEEEEEEEEQEEQEEEEEEEEEEEEEEEE EEEEEEE   E
   223    7 H S  E     +A  237   0A  48  218   13     SS  S S S SSSS  SSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSS   S
   224    8 H G        -     0   0   35  218   20     GG  G G E GGGG  GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGG   G
   225    9 H P        -     0   0   50  218   49     PP  G G G GGGG  GGGGGG GAGGGGGGGGGGAGGAPGGGGGGGGGGGGRGP GGGGGGG   G
   226   10 H A  S    S+     0   0   30  218   51     GG  G G G GGGG  GGGGGG GEGSGGGGGGGGEGGEGGGGGGGGGGGGGGNG GGGGGGG   G
   227   11 H V  E     -d  334   0B  33  218   25     LL  V L L VLLL  LLLLLL LVLVLLLLLLLLVLLLLVLLLLLLLLLLLLVL LLLLLLL   L
   228   12 H I  E     -d  335   0B   9  218   54     VV  V V F VVVV  VAVVVV VKVVVVVVVVVVKVVKVVVVVVVVVVVVVVVV VVVVVVV   V
   229   13 H K        -     0   0  104  218   50     KK  Q Q K QKQQ  QQQQQQ QKQQQQQQQQQQKQKRKQQQQQQQQQQQQQQK QQQQQQQ   Q
   230   14 H P  S    S+     0   0   56  218    9     PS  P P P PPPP  PPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSP PPPPPPP   P
   231   15 H S  S    S+     0   0   90  218   20     SA  G G T GGGG  GGGGGG GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGS GGGGGGG   G
   232   16 H Q  S    S-     0   0   76  218   59     QE  R G D KGGG  GGGGGG GAGRGGGGGGGGAGEAEKGGGGGGGGGGGGMQ GGGGGGG   G
   233   17 H S        -     0   0   51  217   20     TT  S S T SSSS  S.SSSS SSSSSSSSSSSSSSSSTSSSSSSSSSSSSSST SSSSSSS   S
   234   18 H L  E     - B   0 300A   1  217   43     LL  L L L VLLL  L.LLLL LVLLLLLLLLLLVLLVLLLLLLLLLLLLLLLL LLLLLLL   L
   235   19 H S  E     - B   0 299A  64  218   51     SS  R R T RRRR  RSRRRR RKKRRRRRRRRRKRRTSRRRKRRRRRRRRRRS RRRRRRS   R
   236   20 H L  E     - B   0 298A   1  218   13     LL  L L L LLLL  LLLLLL LVLLLLLLLLLLVLLILLLLLLLLLLLLLLLL LLLLLLL   L
   237   21 H T  E     -AB 223 297A  29  218   33     TT  S S T SSSS  SRSSSS SSSSSSSSSSSSSSSSTSSSSSSSSSSSSSST SSSSSSS   S
   238   22 H c  E     -AB 222 296A   0  219    1     CC  C C C CCCC  CLCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCC   C
   239   23 H I  E     -AB 221 295A  54  217   75     AS  T T T AATT  TSVVVV ATAITTTVVVVVEAART.TGVVVVVVVVVVTT VVVVVVV   V
   240   24 H V  E     -A  220   0A   4  217   51     IV  A G V AAGG  GCGGGG AAAAGGGGGGGGVAAAV.GGGGGGGGGGGGGV GGGGGGG   G
   241   25 H S  E     +A  219   0A  60  218    9     SP  S S S SSSS  SASSSS SSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSS SSSSSSS   S
   242   26 H G  S    S+     0   0   54  218    3     GD  G G G GGGG  GAGGGG GGGGGGGGGGGGGGGGGAGGGGGGGGGGGGGG GGGGGGG   G
   243   27 H F  S    S-     0   0   37  199   23     DG  F F F FFFF  FSFFFF FYFFFFFFFFFFHFFYGSFFYFFFFFFFFFFG FFFFLFI   I
   244   28 H S    >   -     0   0   44  200   45     SY  T T S DTTT  TGTTTT TPTSTTTTMTDRTTTSSGTTIDTRTTTTTDSS DDDTDDT   T
   245   29 H I  T 3  S+     0   0    2   56   45     VL  . . . ....  .F.... ................VF...........F.I .F.....   .
   246   30 H T  T 3   +     0   0   59   61   59     SS  . . . ....  .T.... ................SI...........S.G .S.....   .
   247   31 H R  S X  S-     0   0  145  218   53     SD  F F L FFFF  FFFFGF FFVFFFFFFFFNLFFFNFFLFFFFFFFGFRFS FDFFFFF   F
   248   32 H T  T 3  S+     0   0   72  204   59     NS  K S S SSSS  SSSSSN RTNSSSSSSSSTTSRSRSSSSSNSSSSSSSEG STSSSKS   S
   249   33 H N  T 3  S+     0   0   16  204   62     SS  N S S TSSS  SNSSST NNNGSSSSRSDNESSTNDSRSDSDSDSSSTTD DARYDKS   R
   250   34 H Y  E <   -E  317   0C  23  220   46     AS  Y Y N YYYY  YYTYTY YHYSYYYYTYYILFFYYFYDVYTYTSYYYHYY YFTYHYY   Y
   251   35 H d  E     -EF 316 270C   0  218   89     TY  A Y A ASYY  YYYEYN AFWAYYYPDAAYSENHYGYAGAYTYEEPE.AF A.YEAAA   S
   252   35AH W  E     -EF 315 269C   1  218   43     WW  M M I MMMM  MMIIIM MIMMMMMIIVFIRMMIWMMVMFIFILIIIIMW F.IIFVV   V
   253   35BH H  E     -EF 314 268C   0  219   73     NG  H Y S HNYY  YSNSNI NNHHYYYDKSSNHNNHGHYSTSNSNISGSNHS SSNSSTT   T
   254   36 H W  E     +EF 313 267C   1  221    2     WW  W W W WWWW  WWWWWW WWRWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWW   W
   255   37 H I  E     -EF 312 265C   0  221   15     II  V V V VVVV  VVVVVV VVVLVVVVVVVVVVVVIVVVVVVVVVVVVVVI VVVVVVV   V
   256   38 H R  E     -EF 311 264C  10  221   15     RR  R R R RRRR  RRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRR   R
   257   39 H Q  E     -EF 310 263C  22  220    2     QQ  Q Q Q QQQQ  QQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQ   Q
   258   40 H A    >   -     0   0   14  220   61     SP  A A A SAAA  AAAAAV AAAIAAAAAAAAAAAAPAAAAAAAAAAAAAAA AAAAAAA   A
   259   41 H P  T 3  S+     0   0   99  221   19     PP  P P P PPPP  PPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSP PPPPPPP   P
   260   42 H G  T 3  S+     0   0   94  221   12     SG  A G G GGGG  GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGG   G
   261   43 H K  S <  S-     0   0  140  221   34     RQ  K K N RKKK  KKKKKK KQKKKKKKKKKKKKKQKKKKKKKKKKKKKKKR KKKKKKK   K
   262   44 H G        -     0   0   20  221   24     GG  G G G RGGG  GGGGGG GSGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG GGGGGGG   G
   263   45 H L  E     -F  257   0C  10  221    9     LL  L L L LLLL  LLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLL   L
   264   46 H E  E     -F  256   0C  79  221    9     EE  E E E EEEE  EEEEEE EEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EEEEEEE   E
   265   47 H W  E     +F  255   0C  13  221    9     WW  W W W WWWW  WWWWWG WWWWWWWWWWWWWWWWWSWWWWWWWWWSWWWW SWWWWWW   W
   266   48 H M  E     -     0   0C   3  221   31     LI  V V I VVVV  VVLLLL VMVVVVVLLLVLMLIMIVWLLVLLLLLLLLLM LLLLLLL   L
   267   49 H G  E     -FG 254 277C   0  221   42     GG  A S G ASSS  SSAAAA SGSASSSAAAAAGSAGGAVAAAAAAAAAAAAG AAAAAAA   A
   268   50 H R  E     -FG 253 276C  10  221   93     RT  T A A VSAA  AYTVTY GWLVAAAGAGAQGYFISTSGCAGAAATSTSTY GVRASGG   G
   269   51 H I  E     -FG 252 275C   3  221   16     TV  I I I IFII  IIIIII IIMIIIIIIIIIFIIMIIAIIIIMIIIIIIII ITISMVI   V
   270   52 H d  E >   -F  251   0C   0  221   83     YS  S N G SSNN  NSSSSG SNRSNNNSSYASDTNNYWIWSAASSSTDTSSY WGSGGGD   D
   271   53 H Y  T 3  S+     0   0   47  221   84     yY  Y T S YsTT  TGTTTY STDYTTTfdStSpRSpySsNGtraSTTsTTFY STVcRTs   r
   272   54 H E  T 3  S-     0   0   63  207   63     kS  d g S eggg  gdgsst sgddgggdtsygdsrdedgtgyydsSsysadS sgdwSsy   y
   273   55 H G  S <  S+     0   0   25  200   53     WG  r g G gsgg  gsgvgv vgsngggG.sggGnn..silgggGgGgggrgG lgggGtg   g
   274   56 H S        -     0   0   42  217   74     YT  N S S KYSS  SYDGSI NNEHSSSSSSSTETESNNNGTSSSSTGNGDSS SDSRGTS   R
   275   57 H I  E     -G  269   0C  71  220   53     NP  I T A QETT  TITTTT TTTKTTTTTTTATVKKTETTTTSTTTTTTTKT TTTTTTA   T
   276   58 H Y  E     -G  268   0C  70  221   79     DY  Q W Y HYWW  WYSYYD YKALWWWYYYYYVYYTYKYFYYYYYSYYYYIY YYFYYHY   D
   277   59 H Y  E     -G  267   0C  41  221   17     YY  Y Y Y YYYY  YYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYY   Y
   278   60 H S    >>  -     0   0   11  221   61     AT  A T A AATT  TAAAAA ASASTTTAAAAAAAGASAPAVAAAAAAAAAAN ATAVAAA   A
   279   61 H P  T 34 S+     0   0   76  221   51     QP  D D S DDDD  DDDDDD DQEDDDDDDDDDQDEQPDDEDDDDDDDDDDRP EEDDDDD   D
   280   62 H S  T 34 S+     0   0   79  221   52     SS  S S W SSSS  SSSSSS SKFSSSSSSSSSTSSTSSSSSSSSSSSSSSSS SSFSSSS   S
   281   63 H I  T X4 S+     0   0    4  221   40     VL  V V A VVVV  VVVVVV VFVVVVVVVVVVFLVFLVMVVVVVVVVVVVVL VVVVVVV   V
   282   64 H K  G >< S+     0   0  133  221   28     QK  K K K KKKK  KKKKKK KQQKKKKKKTKKQQKQKTKKKKKLKKKKKKKE KKRKKKK   K
   283   65 H S  G 3  S+     0   0  116  221   27     NS  G G S GGGG  GGGGGG GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGS GGGGGGG   G
   284   66 H R  G <  S+     0   0   51  221   18     RR  R R R RRRR  RRRRRR RRRRRRRRRRRRRRRRRRQRRRRRRRRRRRRR RRRRRRR   R
   285   67 H S  E <   -C  300   0A  11  221   54     IL  C F S AFFF  FFFFFF FVFFFFFFFFFFVFFMLFFFFFFLFFFFFFFL FFFFFFF   F
   286   68 H T  E     -C  299   0A  67  221   23     ST  T T T TTTT  TTTTTT TTTTTTTTTTTTTTTTTATTTTTTTTTTTTVS TTTTTTT   T
   287   69 H I  E     +C  298   0A   3  221   29     II  F I I IIII  IIISII IIIIIIIIIIIIMIIMIIIIVIIVIIIIIVVI IIIIIII   I
   288   70 H S  E     -C  297   0A  56  221   37     NH  S S T SSSS  SSSSSS STSSSSSSSSSSTSSTFSSSSSSSSSSSSSSS SSSSSSS   S
   289   71 H R  E     -C  296   0A  71  221   60     PV  R K R RRKK  KRRKRR GRRRKKKRRRSRERRRVRRRRSRSRRRSRRRI RRRKSRR   R
   290   72 H D  E >>> -C  295   0A  55  221   10     DD  D E N DDEE  EDDDDD DDDDEEEDDDDDDDDDDDDDDDDDDDDDDDDD DFDDDDD   D
   291   73 H T  T 345S+     0   0   78  220   57     TP  N N T NNNN  NNNNNN ITNNNNNDNNDNTNNTTNTNNDNNNNNDNNNT DDNNDND   D
   292   74 H S  T 345S+     0   0  105  220   44     SS  S A N SAAA  AASSSS SWASAAASSSSWSAASSSTSSSSSSSSSSSTS SSSSSSS   S
   293   75 H L  T <45S-     0   0  103  217   69     KK  Q K L NKKK  KKQQQE TTKKKKKQQQQQTRDTKKKQLQRQQQQQQQNK QQQQQQQ   Q
   294   76 H N  T  <5 +     0   0   29  218   47     NS  D N N KNNN  NNNNNN NTNSNNNNNNNNDNNSNNNNNNNNNNNNNNSN NKNNNNN   N
   295   77 H K  E   < -BC 239 290A  51  221   70     QQ  T T T TSTT  TSTTTT TTTLTTTTTTMTTSSTHMSTTMTTTTTTTTTQ TTTTTTT   T
   296   78 H F  E     -BC 238 289A   1  221   60     FI  L L V VLLL  LLAAAA LALLLLLAAAVAALLVFLLAAVDAAAAVAALF AAAAVAA   A
   297   79 H F  E     -BC 237 288A  50  221   32     SF  Y Y T SYYY  YYYYYY YYFFYYYYYYYYYYFFSYYYWYYYYFYYYYFS YYYYFYY   Y
   298   80 H I  E     -BC 236 287A   4  221    5     LL  L L L LLLL  LLLLLL LMLLLLLLLLLLMLLMLLLLLLLLLLLLLLLL LLLLLLL   L
   299   81 H Q  E     -BC 235 286A  73  221   35     QN  Q Q K QQQQ  QQQQQQ QDQHQQQQQQQQDQQERHQQQQQQQQQQQQQR QQQQQQQ   Q
   300   82 H L  E     -BC 234 285A   3  221   19     LL  L M M LMMM  MMMMMM MLLVMMMMMMMMLMMLLMMMMMMIMMMMMMML MMMMMMM   M
   301   82AH I        +     0   0   70  221   58     NT  N D T SNDD  DNNNNN HSSNDDDNNNNNSNSNTDNNNNNYNKNTNNNN NNNNNST   N
   302   82BH S  S    S-     0   0   59  221   33     SS  S S S GSSS  SSSRSS SSSSSSSSSSSSNSSSSNSSSSSSSSSSSSSS SSSSSGS   S
   303   82CH V        -     0   0    0  221   13     VV  L L L LLLL  LLLVLL LLLLLLLLLLLLLLLLVLLLLLLLLQLLLLLL LLLLLLL   L
   304   83 H T    >   -     0   0   65  221   63     TT  R R T SRRR  RRRRRR RRRTRRRRKRRRRRRKTRRRRRRRRRRRRRRT RRRRRRR   R
   305   84 H N  G >  S+     0   0  120  221   62     PA  P A A TAAA  AATTTT ASASAAATTTTASAVSAAVTTTTTTTTTTTTA TTTTTTT   T
   306   85 H E  G 3  S+     0   0  160  221   21     EA  E E A EEEE  EEEEEE DEEAEEEEEEEEDEDGAEEEEEEEEEEEEENA EEEEEEE   E
   307   86 H D  G <  S+     0   0    0  221    1     DD  D D D DNDD  DDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDD   D
   308   87 H T    <   +     0   0   30  221   36     MT  T T T TTTT  TTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TTTTTTT   T
   309   88 H A  E    S- H   0 333C   3  221    5     AA  A A A GAAA  AAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAA   A
   310   89 H M  E     -EH 257 332C  43  221   61     VV  V V T VVVV  VVRRRR VVVIVVVRRRRHVVIVVVVRRRRRRRQRQRTV RRRRRRR   R
   311   90 H Y  E     -EH 256 331C   2  221    0     YY  Y Y Y YYYY  YYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYCYCYYY YYYYYYY   Y
   312   91 H Y  E     -E  255   0C   1  221    3     YY  Y Y F YYYY  YYYYYY YWYYYYYYYYWYYYYYYYYYYYYYYYYYYFYF FYYYYYF   Y
   313   92 H c  E     +E  254   0C   0  221    1     CC  C C C CCCC  CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCC   C
   314   93 H S  E     -EI 253 327C   0  221   30     AV  A A A AAAA  ATAAAA AAAAAAAAVATTAAATVAMTAAAGAATVTAAA AVVAASA   A
   315   94 H R  E     -EI 252 326C  20  220   39     RR  R K R RRKK  KRRRSR RRRRKKKRRRIRTRRRRRRSTMRRRRRGRRKR GSTRRRG   G
   316   95 H E  E     -EI 251 324C   0  220   75     DH  P D D DDDD  DDGGYN ADGDDDDGGGGGGQGDHDDTNAGGWYGCGGEG CMDPGGC   C
   317   96 H N  E  >> -E  250   0C   6  220   89     TG  V T T FLTT  TTRPRY DAGFTTTGDPGDVNKRVATSLGVGSYGSGRNV YFLYVLY   I
   318   97 H H  T  45S+     0   0    0  220   93     VG  R Q Q LGHQ  QCARSF YPFHHQQGIAAYYEWSEDVYGASWDDIGIGSG RKDDYNG   T
   319   98 H M  T  45S+     0   0   73  221   94     RY  S V C PWFR  GDSYAA RQGSPRSIRMVNDHVGGMRSCVYSLDACACAL WYVSVCA   S
   320   99 H Y  T  45S+     0   0  159  221   92     GS  R R D LFTW  HYSSVG DGNKWGTGFVAEVTPRPIRYGACALHIDILGG DVWRGFS   Y
   321  100 H E  T  <5 -     0   0   54  221   92     SF  W P Y SGFL  EFYGAD YVFTGGQPDLILLSAAYTSESFYYVGASAALT TIGCCWC   H
   322  100AH T      < +     0   0    0  221   92     QA  L Q F SLKA  LDIYIL QTDTSWPGGAAWTPGLGFQAGASYNQTGTDLA GLPWIYY   Y
   323  100BH Y  S    S-     0   0   10  221   92     WS  Q T N WDFL  CYIGAY VTQSSTWVAANGGWPWWASYGVFWITVFVCDF CGGGTGQ   D
   324  100CH F  E     +I  316   0C   0  221   93     ta  l F I hYWg  yWSLva stWigftEdllPyytfFrsgftggawwlwpiD sLIggdt   a
   325  101 H D  E     +     0   0C  42  133   50     dp  h . . d..s  d..Ddd dd.dsdp.ndd.ddddDddkhddddedddda. d..yddn   d
   326  102 H V  E     -I  315   0C  35  153   74     FF  I . . V..F  L.SLLL VY.TFSF.LLL.YYPIPVLLLLLLLLLLLLFI L..LLLL   L
   327  103 H W  E     -I  314   0C  28  177   14     WW  W W W WW.W  W.WWWW WW.WWWW.WWW.WWWWWWWWWWWWWWWWWWWW WW.WWWW   W
   328  104 H G        -     0   0    3  204   16     GG  G G G GGGG  GGGGGG GGGGGGG.GGGGGGGGGGGGGGGGGGGGGGGG GG.GGGG   G
   329  105 H Q        -     0   0  100  183   48     QQ  Q Q P QQQQ  PQRPPP RQQRQQQ.PPP.QQQQQQPPPPPPPPPPPPQQ PP.PPPP   P
   330  106 H G        -     0   0    3  191    7     GG  G G G GGGG  GGGGGG GGGGGGG.GGG.GGGGGGGGGGGGGGGGGGGG GG.GGGG   G
   331  107 H T  E     -H  311   0C  27  202   47     LA  T A T TTAA  TTVVVV TTTTAVA.VVVVTITTTTTVIVVVVVVVVVTT VV.VVVV   V
   332  108 H T  E     -H  310   0C  48  208   81     RP  M L L ALLL  PLEEEE LLLTLVL.EEEEQLLKLTPEEEEDEEEEEEDV EEKEEEE   E
   333  109 H V  E     -H  309   0C   0  214   25     VV  V V V VVVV  IVVVVV VVVVVVVVVVVVVVVVVVIVVVVVVVVVVVVV VVVVVVV   V
   334  110 H T  E     -d  227   0B  16  217   44     TT  T T T ITTT  TTTVVV STTITTTVVVVVTTTTTITVDVVVVVVVVVST VVAVVVV   V
   335  111 H V  E     +d  228   0B   2  218   17     VV  V V V VVVV  IVVVVV VVVVVVVVVVVVVVIVVVIVVVVVVVVVVVVV VVVVVVV   V
   336  112 H S        -     0   0   18  219   35     SS  S S S SSSS  SSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSYS SSSSSSS   S
   337  113 H S  S    S+     0   0   99  220   31     SS  S S S SSSS  SSSSSS ASSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSVSS   S
   338  114 H A  S    S-     0   0   31  221   51     AA  A A G AAAA  AAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAA   A
   339  115 H K        -     0   0  143  209   69     SS  S S Q SSSS  SSPPPP SSSSSSSPPPPPSSSSSSSYPPPPYPYPYPSS PPPPPPP   P
   340  116 H T        -     0   0   44  210   73     TT  T T P TTTT  TTKKKK TTTTTTTKKKKKTTTTPTTNKKKKNKNKNKTP KKKKKKK   K
   341  117 H T  B     -J  370   0D  35  217   71     KK  K K K KKKK  KKTTTT KKKKKKKTTTTTKKKKTKKTTTTTTTTTTTKT TTTTTTT   T
   342  118 H P        -     0   0   60  218   66     GG  G G A GGGG  GGAAAA GGGGGGGAAAAAGGGGSGGAAAAAAAAAAAGS AAAAAAA   A
   343  119 H P        -     0   0   13  218   31     PP  P P P PPPP  PPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPP   P
   344  120 H S  E     -K  367   0E  51  218   62     SS  S S S SSSS  SSSSSS SSSSSSSSSSSSSSSSKSSSSSSSSSSSSLSK LSLSLLS   L
   345  121 H V  E     -K  366   0E   6  219   45     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVV   V
   346  122 H Y  E     -K  365   0E  27  220   34     FF  F F F FFFF  FFYYYY FFFFFFFYYYYYFFFFFFFYYYYYYYYYYYFF YYYYYYY   Y
   347  123 H P  E     -K  364   0E  15  220   29     PP  P P P PPPP  PPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPP   P
   348  124 H L  E     +K  363   0E   4  221    3     LL  L L L LLLL  LLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLL   L
   349  125 H A        -     0   0   10  221   68     AA  A A A AAAA  AAAAAA AAAAAAAAAAAAAAAAsAAAAAAAAAAAAAAs AAAAAAA   A
   350  126 H P        -     0   0   24  216   47     PP  P P P PPPP  PPPPPP PPPPPPPPPPPPPPPPdPPPPPPPPPPPPPPd PPPPPPP   P
   351  127 H G  S    S-     0   0   16  219   75     SC  S S C CCSS  SCCCCC SCSSSSSCCCCCCSSSSSSCCCCCCCCCCCSS CCCCCCC   C
   352  128 H S  S    S+     0   0   99  219   60     SS  S S C SSSS  SSSSSG SSSSSSSGSGSGSSSSTSSGGGSGGGGGGGST GGGGGGG   G
   353  129 H A        +     0   0   52  220   92     RR  K R G RRRR  RTRRRR KRKKRRRRRRRRRKKKPKRRRRRRRRRRRRKP RRRRRRR   R
   354  130 H A        +     0   0   70  136   83     SS  S S D SSSS  SSDDDD SSSSSSSDDDDDSSSS.SSDDDDDDDDDDDS. DDDDDDD   D
   355  133 H Q        +     0   0  178  159   73     TT  T T T TTTT  TTTTTT TTTTTTTTTTTVTTTT.TTVTTTVVVTTTTT. TTTTTTT   T
   356  134 H T    >   -     0   0   64  220   50     SS  S S P SSSS  SSSSSS SSSSSSSSSSSSSSSSQSSSSSSSSSSSSSSQ SSSSSSS   S
   357  135 H N  T 3  S-     0   0  146  221   56     EE  G E S EEEE  EEGGGG GGGGEEEGGGGGGGGGDGEDGGGGDGGGGGGD GGGGGGG   G
   358  136 H S  T 3  S+     0   0   63  221   63     SS  G S S SSSS  SGPPPP GGGGSSSPPPPPGGGGGGSHPPPPHPPPPPGG PPPPPPP   P
   359  137 H M  E <   - L   0 408E  83  221   79     TT  T T T TTTT  TTNNNN TTTTTTTNNNNNTTTTNTTNNNNNNNNNNNTN NNNNNNN   N
   360  138 H V  E     - L   0 407E  15  221   34     AA  A A V AVAA  AAVVVV AAAAAAAVVVVVAAAAVAAVVVVVVVVVVVAV VVVVVVV   V
   361  139 H T  E     + L   0 406E  15  221   70     AA  A A T AAAA  AAAAAA AAAAAAAAAAAAAAAAVAAAAAAAAAAAAAAV AAAAAAA   A
   362  140 H L  E     + L   0 405E   0  221   27     LL  L L L LLLL  LLLLLL LLLLLLLLLLLLLLLLVLLLLLLLLLLLLLLV LLLLLLL   L
   363  141 H G  E     -KL 348 404E   0  221   30     GG  G G G GGGG  GGGGGG GGGGGGGGGGGGGGGGAGGGGGGGGGGGGGGA GGGGGGG   G
   364  142 H e  E     -KL 347 403E   1  221    0     CC  C C C CCCC  CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCC   C
   365  143 H L  E     -KL 346 402E   2  221   33     LL  L L L LLLL  LLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLL   L
   366  144 H V  E     -KL 345 401E   1  221   49     VV  V V V VVVV  VVAAAA VVVVVVVAVAAAVVVVVVVVAAAAVAVAVAVV AAAAAAA   A
   367  145 H K  E     -KL 344 400E  38  220   74     KK  K K K KKKK  KKSSSS KKKKKKKSSSSSKKKKQKKSSSSSSSSSSSKQ SSSSSSS   S
   368  146 H G  E    S+     0   0E  19  221   50     DD  D D G DDDD  DDSSSS DDDDDDDSSSSSDDDDGDDSSSSSSSSSSSDG SSSSSSS   S
   369  147 H Y  E     - L   0 399E   0  221   18     YY  Y Y Y YYYY  YYYYYY YYYYYYYYYYYYYYYYFYYYYYYYYYYYYYYF YYYYYYY   Y
   370  148 H F  B     +J  341   0D   3  221   42     FF  F F L FFFF  FFFFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FFFFFFF   F
   371  149 H P  S    S-     0   0    0  221   37     PP  P P P PPPP  PPPPPP PPPPPPPPPPPPPLPPpPPPPPPPPPPPPPPp PPPPPPP   P
   372  150 H E  S    S+     0   0   53  211   46     EE  E E E EEEE  EEEEEE EEEEEEEEEEEEEEEEeEEEEEEEEEEEEEEe EEEEEEE   E
   373  151 H P        +     0   0   59  219   54     PP  P P P PPPP  PPPPPP PPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPP PPPPPPP   P
   374  152 H V        -     0   0   20  221   53     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVVLVVVVVVVVVVVVVVL VVVVVVV   V
   375  153 H T  E     +N  422   0F  83  220   71     TT  T T T TTTT  TTTTTT TTTTTTTTTTTTTTTTSTTTTTTTTTTTTTTS TTTTTTT   T
   376  154 H V  E     +N  421   0F  23  221   43     VV  V V V VVVV  VVVVVV VVVVVVVVVMVVVVVVVVVVVMVVVVVVVVVV VMVVVVM   V
   377  156 H T  E     -N  420   0F  48  221   56     SS  S S T SSSS  SSTTTT SSSSSSSTTTTTSSSSTSSTTTTTTTTTTTST TTTTTTT   T
   378  157 H W  E > >S-NO 419 383F   2  221    0     WW  W W W WWWW  WWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWW   W
   379  162 H N  G > 5S-     0   0   38  221   69     NN  N N N NNNN  NNNNNN NNNNNNNNNNNNNNNNsNNNNNNNNNNNNNNs NNNNNNN   N
   380  163 H S  G 3 5S-     0   0   91  218   63     SS  S S S SSSS  SSSSSS SSSSSSSSSSSSSSSSsSSSSSSSSSSSSSSs SSSSSSS   S
   381  164 H G  G < 5S+     0   0   39  218   55     GG  G G G GGGG  GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGG   G
   382  165 H S  T < 5 +     0   0   93  221   60     SA  A S T AASS  SAAAAA AAAASSSAAAAAAAAAQASAAAAAAAAAAAAQ AAAAAAA   A
   383  166 H L  B   < +O  378   0F  43  221   87     LL  L L L LLLL  LLLLLL LLLLLLLLLLLLLLLLNLLLLLLLLLLLLLLN LLLLLLL   L
   384  167 H S        +     0   0   88  221   69     TT  T T T TTTT  TTSSST TTTTTTTTTTSTTTTTVTTSTTSTSTSTSTTV TTTTTTT   T
   385  168 H S  S    S+     0   0  101  221   77     SS  S S N SSSS  SRSSSS SSSSSSSSSSSSSSSSTSSRSSSSRSRSRSST SSSSSSS   S
   386  169 H G  S    S+     0   0   32  218   43     GG  G G G GGGG  GGGGGG GGGGGGGGGGGGGGGGAGGVGGGGVGVGVGGA GGGGGGG   G
   387  171 H V        +     0   0   48  219   62     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVVRVVVVVVVVVVVVVVR VVVVVVV   V
   388  172 H H  E     -M  404   0E  17  220   80     HH  H H R HHHH  HHHHHH HHHHHHHHHHHHHHHHNHHHHHHHHHHHHHHN HHHHHHH   H
   389  173 H T  E     -M  403   0E  69  220   82     TT  T T T TTTT  TTTTTT TTTTTTTTTTTTTTTTFTTTTTTTTTTTTTTF TTTTTTT   T
   390  174 H F  E     -M  402   0E   1  219   43     FF  F F F FFFF  FFFFFF FFFFFFFFFFFFFFFFPFFFFFFFFFFFFFFP FFFFFFF   F
   391  175 H P  E     -     0   0E  65  219   32     PP  P P P PPPP  PPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPP   P
   392  176 H A  E     -     0   0E  19  215   65     AA  A A S AAAA  AASSSS AAAAAAASSSSSAAAASAASSSSSSSSSSSAS SSSSSSS   S
   393  177 H V  E     -M  400   0E  42  214   63     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVVQVVVVVVVVVVVVVVQ VVVVVVV   V
   394  178 H L  E     -M  399   0E  77  214   65     LL  L L R LLLL  LLLLLL LLLLLLLLLLLLLLLLDLLLLLLLLLLLLLLD LLLLLLL   L
   395  179 H Q  S    S-     0   0   83  214   70     QQ  Q Q Q QQQQ  QQQQQQ QQQQQQQQQQQQQQQQAQQQQQQQQQQQQQQA QQQQQQQ   Q
   396  180 H S  S    S-     0   0  116  214   49     ss  s s s ssss  sspppp ssssssspppppssssssspppppppppppss ppppppp   p
   397  183 H D  S    S+     0   0   90  206   25     gg  g g g gggg  gggggg ggggggggggggggggdggggggggggggggd ggggggg   g
   398  184 H L        -     0   0   53  199   75     LL  L L L LLLL  LLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLL   L
   399  185 H Y  E     -LM 369 394E  36  205    2     YY  Y Y Y YYYY  YYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYY   Y
   400  186 H T  E     +LM 367 393E   5  195   48     SS  S S S SSSS  SSSSSS SSSSSSSSSSSSSSSSTSSSSSSSSSSSSSST SSSSSSS   S
   401  187 H L  E     -L  366   0E  11  190   56     LL  L L L LLLL  LLLLLL LLLLLLLLLLLLLLLLTLLLLLLLLLLLLLLT LLLLLLL   L
   402  188 H S  E     -LM 365 390E   5  191   26     SS  S S S SSSS  SSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSS   S
   403  189 H S  E     -LM 364 389E   2  191    0     SS  S S S SSSS  SSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSS   S
   404  190 H S  E     -LM 363 388E   0  191   77     VV  V V V VVVV  VVMMMT VVVVVVVMMMMMVVVVQVVMMMMMMMMMMMVQ MMMMMMM   M
   405  191 H V  E     -L  362   0E   0  190   27     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVVLVVVVVVVVVVVVVVL VVVVVVV   V
   406  192 H T  E     +L  361   0E  48  189   37     TT  T T S TTTT  TTTTTT TTTTTTTTTTTTTTTTTTTIITTTITITITTT TTTITTT   T
   407  193 H V  E     -L  360   0E  14  188   30     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVVLVVVVVVVVVVVVVVL VVVVVVV   V
   408  194 H P  E  >  -L  359   0E  56  188   40     PP  P P T PTPP  PPPPPP PPPPPPPPPPPPPPPPPPPAPPPPAPAPAPPP PPPPPPP   P
   409  195 H S  T  4 S+     0   0   49  187   50     SS  S S . SSSS  SCAAAA SSSSSSSAAAAASSSSASSAAAAAAAAAAASA AAAAAAA   A
   410  196 H S  T  4 S+     0   0   66  187   69     SS  S S . SSSS  SSSSSR SSSSSSSRHSSSSSSSTSSSSSSSSSSSSSST SSSSSSS   S
   411  198 H P  T  > S+     0   0   31  187   72     SS  S S . NNSS  SSSSSS SSSSSSSSSSSSSSSSQSSSSSSSSSSSSSSQ SSSSSSS   S
   412  199 H R  T  < S+     0   0   16  187  102     LL  L L S FFLL  LWLLLS LLLLLLLSLLLLLLLLCLLLLLLLLLLLLLLC LLLLLLL   L
   413  200 H P  T  4 S+     0   0   80  188   68     GG  G G S GGGG  GGSSSS GGGGGGGSSSSSGGGGPGGSSSSSSSSSSSGP SSSSSSS   S
   414  202 H S  T  4 S+     0   0  111  188   69     TT  T T S TTTT  TTSSSR TTTTTTTRSSSSTTTTDTTTSSSSTSTSTSTD SSSSSSS   S
   415  203 H E  S  < S-     0   0  128  188   76     QK  Q Q Q QQQQ  QQKKKK QQQQQQQKKKKKQQQQGQQLKKKKLKLKLKQG KKKKKKK   K
   416  204 H T        -     0   0   83  188   70     TT  T T P TTTT  TTSSSC TTTTTTTCRSSSTTTTkTTSSSSSSSSSSSTk SSSSSSS   S
   417  205 H V        +     0   0    4  184   61     YY  Y Y V YYYY  YYYYYF YYYYYYYFYYYYYYYYvYYYYYYYYYYYYYYv YYYYYYY   Y
   418  206 H T  E     - P   0 433F  23  183   70     VT  I V T TTVV  VTTTTT ITIIVVVTTTTTTIIITIVTTTTTTTTTTTIT TTTTTTT   T
   419  208 H e  E     -NP 378 432F   0  187    0     CC  C C C CCCC  CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCC   C
   420  209 H N  E     -NP 377 431F   4  187   60     NN  N N N NNNN  NNNNNN NNNNNNNNNNNNNNNNHNNNNNNNNNNNNNNH NNNNNNN   N
   421  210 H V  E     -NP 376 430F   1  187   16     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVV   V
   422  211 H A  E     -NP 375 429F  14  187   74     ND  N N A DDNN  NDNNNN NNNNNNNNNNNNNNNNKNNYNNNNYNYNYNNK NNNNNNN   N
   423  212 H H  E > > - P   0 428F   1  187    7     HH  H H H HHHH  HHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHH   H
   424  213 H P  G > 5S+     0   0   77  177   83     KK  K K P KKKK  KKPPPP KKKKKKKPPPPPKKKK KKPPPPPPPPPPPK  PPPPPPP   P
   425  214 H A  G 3 5S+     0   0   40  177   67     PP  P P A PPPP  PPAAAA PPPPPPPAAAAAPPPP PPAAAAAAAAAAAP  AAAAAAA   A
   426  215 H S  G < 5S-     0   0   32  176   64     SS  S S T SSSS  SSTTTT SSSSSSSTTTTTSSSS SSTTTTTTTTTTTS  TTTTTTT   T
   427  216 H S  T < 5 +     0   0  111  176   72     NN  N N N NNNN  NNTTTT NNNNNNNTKTTTNNNN NNNTTTTNTNTNTN  TTTTTTT   T
   428  217 H T  E   < +P  423   0F  35  176   66     TT  T T T TTTT  TTTTTT TTTTTTTTTTTTTTTT TTTTTTTTTTTATT  TTTTTTT   T
   429  218 H K  E     +P  422   0F 135  176   53     KK  K K K KKKK  KKKKKK KKKKKKKKKKKKKKKK KKKKKKKKKKKKKK  KKKKKKK   K
   430  219 H V  E     -P  421   0F  38  125   32     VV  V V V VVVV  VVVVVV VVVVVVVVVVVVVVVV VVVVVVVVVVVVVV  VVVVVVV   V
   431  220 H D  E     -P  420   0F  97  125   35     DD  D D D DDDD  DDDDDD DDDDDDDDDDDDDDDD DDDDDDDDDDDDDD  DDDDDDD   D
   432  221 H K  E     -P  419   0F  51  113   47     KK  K K K KKKK  KKKKK  KKKKKKK  KKKKKKK KKKKKKKKKKKKKK  KKKKKKK   K
   433  222 H K  E     -P  418   0F 121  113   52     RR  K R T TTRR  RRRRR  KRKKRRR  RRRRRKK KRRRRRRRRRRCRK  RRRRRRR   R
   434  223 H I        -     0   0    4  109   32     VV  V V V VVVV  VVVVV  VVVVVVV  VVVVVVV VVVVVVVVVVVVVV  VVVVVVV   V
   435  224 H V        -     0   0   79  101   61     EE  E E A EEEE  EGGGG  EEEEEEE  GGGEEEE EEDGGGGDGDGDGE  GGGGGGG   G
   436  225 H P              0   0   73   92   66     IS  P I P RRII  IETTT  PLPPIII  TT LPPP PI TTTI   R TP  TTTTTTT   T
   437  226 H R              0   0  167   78   25     KK  K K   KKKK  KRKKK  KKKKKKK  KK KKKK KK KKKH     KK  KKKKKKK   K
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 L D              0   0  100   71   31                  E         Q  Q                             Q          
     2    2 L I        -     0   0    0   77   33                  T         I  S                             I          
     3    3 L V        -     0   0   88   83   53                  I         T  V                             I          
     4    4 L M  E     -Q   25   0G  12   86   20                  V         V  L                             V          
     5    5 L T  E     -Q   24   0G  80   86   17                  T         T  T                             T          
     6    6 L Q  E     -Q   23   0G  19   86    6                  Q         Q  Q                             Q          
     7    7 L S  E    S+Q   22   0G  57   86   54                  S         S  P                             S          
     8    8 L P        -     0   0   47  128    7                  L         P  .    PPP         PPP P P P  PPPPPPP P    
     9    9 L A  S    S-     0   0   79  136   69                  A         S  P    PPP         PPP P P P  PGGPPSP P    
    10   10 L S  E     -t  107   0H  78  142   56                  L         S  S    SSS         SSS S S S  SAASSSS S    
    11   11 L L  E     -t  108   0H  34  176   45                V L  V   VV K  V    VVV         VVV VVA V VVVQAVVA V   V
    12   12 L V  E     +t  109   0H  86  187   34                S S  S   SS S  S    SSS   SS    SSS LSS S SSSSSSSS S  SS
    13   13 L V  E     -t  110   0H  17  189   58                VVA  A   VV V  G    VGG   VV    VVG VGG A VGSVGGGG A  GG
    14   14 L S  E >   -t  111   0H  46  199   61                SAA  AS SSSSL  A    AASSSSSS    AAASASS ASSNAVTTTT A  SS
    15   15 L L  T 3  S+     0   0   79  198   66                PPP  SP PPPPP  P    PPLPPPPP    PPPPPPP PPLPVAPPPP P  PP
    16   16 L G  T 3  S+     0   0   39  206    7                GGG  GG GGGGG  G    GGGGGGGG    GGGGGGG GGGGGGGGGG G  GG
    17   17 L Q    <   -     0   0   97  206   52                QQD  QQ QQQQE  Q    QQQQQQQQ    QQQQKQQ QQQQGQQQQR Q  QQ
    18   18 L R        -     0   0  152  206   62                PTK  TS SPPSS  R    TTRSSSTT    TTGSTSR KTTRTSRRRR R  SS
    19   19 L A  E     - R   0  79G   2  206   44                AAV  AV VAAVI  V    AVVVVVAA    AAVVAIV VAAIVVVVVV V  VI
    20   20 L T  E     - R   0  78G  66  207   59                SRT  RT TSSTT  T    RTTTTTSS    RTTTRTT TSSTSSPTTT T  TT
    21   21 L I  E     - R   0  77G   0  207   22                III  II IIIII  I    IIIIIIII    IIIIIII IIIIIIIIII I  II
    22   22 L S  E     -QR   7  76G  36  207   50                TTT  TS STTST  S    TSSSSSTT    STSSTSS STTSSTSSSS S  SS
    23   23 L a  E     -QR   6  75G   0  207    0                CCC  CC CCCCC  C    CCCCCCCC    CCCCCCC CCCCCCCCCC C  CC
    24   24 L R  E     -QR   5  74G 153  207   75                SGK  GT TSSTR  T    GTTTTTSS    SGTTGTS SSQSRRSSSS S  TT
    25   25 L A  E     -Q    4   0G   6  207   68                GGA  GG GGGGT  G    GGGGGGGG    EGGGGGG GGGGTTGGGG G  GG
    26   26 L S  S    S+     0   0   63  207   52                DNS  DT TDDTS  S    NSSTTTDD    NNSTDTS SDDSSSSSSS R  TT
    27   27 L E  S    S-     0   0  105  207   72                KDQ  NS SKKSS  S    NSSSSSKK    NNSSNSR SKDSQSSSSS S  SS
    28   27AL S        -     0   0   29  207   74                FID  IS SFFSS  S    ITSSSSLL    IISSVSS SLLSDsSSSS S  ST
    29   27BL V        +     0   0    0   57   77                ...  .. .....  .    ........    ....... ....Vy.... .  ..
    30   27CL D  E     +Z   35   0I  45   79   82                ...  .D D..D.  .    ..NDDD..    ...D.D. ....YS.... .  D.
    31   27DL S  E >  S+Z   34   0I  15  116   82                ...  .I I..I.  N    .NIIII..    ..NV.VN N.ENVINNNN N  VD
    32   28 L Y  T 3  S-     0   0  173  119   89                ...  .G G..G.  I    .IGGGG..    ..IG.GI I.LIYYIIII I  GV
    33   29 L G  T 3  S+     0   0   81  200   60                GGI  GG GGGGV  g    GgGGGGGG    GGgGGGG GGLgkyGGGG G  Gg
    34   30 L K  E <  S-Z   31   0I 112  170   77                NND  SY YNNYN  g    SgGYYYDD    TSgYSYS ND.snkSIAS N  Yh
    35   31 L S  E     -Z   30   0I   7  186   77                AKD  KN NAANG  Y    KYNNNNEE    KKYNKDN NN.NHNNNNN S  NS
    36   32 L F        +     0   0    5  198   68                YYD  NR RYYRY  D    SAGRRRYY    SSGYAFY YYSYCLTYNS Y  YL
    37   33 L M  E     -U   94   0H   0  205   51                AVM  VV VAAVM  V    VVVVVVAA    VVVVVVV VAAVLLVVVV V  VV
    38   34 L H  E     -U   93   0H   0  207   81                YYN  HS SYYSH  H    HHGSSSYY    HHHSHSY SCHNSSNYNN S  SS
    39   35 L W  E     -UV  92  52H   0  207    0                WWW  WW WWWWF  W    WWWWWWWW    WWWWWWW WWWWWWWWWW W  WW
    40   36 L Y  E     -UV  91  50H   0  207   13                YYY  YY YYYYH  Y    YYYYYYYY    YYYYYYY YYYYYYYYYY Y  YY
    41   37 L Q  E     -UV  90  49H   4  207   25                QQQ  QQ QQQQQ  Q    QQRQQQQQ    QRQQQQQ QQQQQLQQQQ Q  QQ
    42   38 L Q  E     -U   89   0H  16  207   13                QQQ  QQ QQQQQ  Q    QQQQQQQQ    QQQQQQQ QLQQQQQQQQ Q  QQ
    43   39 L K    >   -     0   0   47  207   59                KKK  KH HKKHK  L    KFIHHHKK    KKLHKNV LKKLKKFILF F  HH
    44   40 L P  T 3  S+     0   0   81  207   39                PPP  PP PPPPP  P    PPPPPPPP    SPPPPPP PPPPDPPPPP P  PP
    45   41 L G  T 3  S+     0   0   58  206   20                GGG  AG GGGGG  G    GGGGGGGG    GGGGGGG GGGGGGGGGG G  GG
    46   42 L Q  S <  S-     0   0  103  207   70                QQE  QK KQQKQ  T    QASKKKQQ    QQTKQKT TQQKKGTTTT A  KK
    47   43 L P        -     0   0   34  207   58                VAT  AA AVVAK  A    AAAAAASS    AAAVAAA ASAASAAAAA A  AA
    48   44 L P        -     0   0    5  207   20                PPL  PP PPPPP  P    PPPPPPPP    PPPPPPP PPPPPPPPPP P  PP
    49   45 L K  E     -V   41   0H  96  207   71                VVM  VK KVVKR  R    VKKKKKVV    VMKKVKK KVVKKKKKKR Q  KK
    50   46 L V  E     +V   40   0H  10  207   43                LLL  LL LLLLL  L    LVTLLLLL    LLLLLLL LLLLLLLLLL L  LF
    51   47 L L  E     +     0   0H   2  207   26                VVI  VM MVVML  L    VLLMMMVV    VVLMVIL LVVLLLLLLL L  ML
    52   48 L I  E     -VW  39  58H   0  207   24                III  II IIIII  I    VIIIIIII    VVIIIII IIIIIIIIII I  II
    53   49 L Y  E  >  + W   0  57H  54  207   35                YYR  YY YYYYY  Y    YYYYYYYY    YYSYYYY YYYYYYYSHY Y  YF
    54   50 L I  T >4 S-     0   0   10  207   91                KEE  AE EKKES  G    DGNEEEQQ    GDNEYDR DQASWHSTTG D  EE
    55   51 L A  T 34 S+     0   0    2  207   75                NDA  DV VNNVT  N    DNSVVVDD    DDNVDVN NDDNAANNTN N  VG
    56   52 L S  T 34 S+     0   0   73  207   57                SST  SS SSSSS  S    SYNSSSSS    SSSSTSD NNDSSTNDNH D  NS
    57   53 L N  E <<  -W   53   0H  77  205   73                NNT  KK KNNKN  N    DNNKKKKK    DANQDNQ KRNNTSQQQQ K  KK
    58   54 L L  E     -W   52   0H  63  207   64                RRR  RR RRRRR  R    RRRRRRRR    RRRRRRR RRLRRRRRRR R  RR
    59   55 L E    >   -     0   0   49  207   82                PPL  PP PPPPF  P    PPPPPPPP    PPPPPPP PPAPQQPPPP P  PP
    60   56 L S  T 3  S+     0   0  107  207   43                SSS  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSSSSSSS S  SS
    61   57 L G  T 3  S+     0   0   67  207   15                GGG  GG GGGGG  G    GGGGGGGG    GGGGGGG GGGGGGGGGG G  GG
    62   58 L V    <   -     0   0   17  207   42                IIV  IV VIIVV  V    IVVVVVII    IIVVIVV IIIVIVVVVV I  VV
    63   59 L P    >   -     0   0   62  207   24                PPP  PS SPPSS  P    PPPSSSPP    PPPPPSP PPPPPSPPPP P  PS
    64   60 L A  T 3  S+     0   0   99  207   57                EES  ED DEEDN  D    EDDDDDEE    EEDDEHD DEDDSDDDED D  DN
    65   61 L R  T 3  S+     0   0   30  207    7                RRR  RR RRRRR  R    RRRRRRRR    RRRRRRR RRRRRRRRRR R  RR
    66   62 L F  E <   -S   79   0G   7  207    2                FFF  FF FFFFF  F    FFFFFFFF    FFFFFFF FIFFFFFFFF F  FF
    67   63 L S  E     -S   78   0G  59  207   17                SST  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSTSSSSS S  SS
    68   64 L G  E     +S   77   0G  17  207    7                GGG  GG GGGGG  G    GGGGGGGG    GGGGGGG GGGGGGGGGG G  GG
    69   65 L S  E     +S   76   0G  48  207   40                SSS  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSSSSSSS S  SS
    70   66 L G  E     -S   75   0G  35  207   76                NNG  NK KNNKG  K    NKRKKKNN    NAKKNKK KNKKGGKKKK K  KK
    71   67 L S  E >   +S   74   0G  68  206   22                SS.  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSSSSSSS S  SS
    72   68 L R  T 3  S-     0   0  163  206   33                GG.  GG GGGGG  G    GGGGGGGG    GEGGGGG GGDGNKGGGG G  GG
    73   69 L T  T 3  S+     0   0   51  206   59                NN.  NN NNNNT  T    NTNNNNNN    NNTNNNT TNTTSTTTPT T  NN
    74   70 L D  E <   +RS  24  71G  77  206   64                TT.  TT TTTTD  S    TSTTTTTT    TTSTTTS STTSDDSSSS S  TT
    75   71 L F  E     -RS  23  70G   0  206   82                AA.  AA AAAAY  A    AAAAAAAA    AAAAAAA AAAAFFAAAA A  AA
    76   72 L T  E     -RS  22  69G  33  206   58                TT.  TS STTSS  S    TSTSSSTT    TTSSTSS TTTSTTSSSS T  SS
    77   73 L L  E     -RS  21  68G   0  206    3                LL.  LL LLLLF  L    LLLLLLLL    LLLLLLL LLLLLLLLLL L  LL
    78   74 L T  E     -RS  20  67G  28  206   44                TT.  TT TTTTT  A    TATTTTTT    TTATTTA GTTTTSAAVA A  TT
    79   75 L I  E     -RS  19  66G   0  206    3                II.  II IIIII  I    IIIIIIII    IIIVIII IIIIIIIIII I  VI
    80   76 L D  S    S+     0   0   68  206   39                SS.  SS SSSSS  T    STSSSSSS    SSASSSS TSRSSRSGSS T  SS
    81   77 L P  S    S-     0   0   51  206   60                GA.  RG GGGGN  G    RGSGGGGG    RGGGRGG GGGGGGGGGG G  GG
    82   78 L V        +     0   0    0  206   50                VV.  VL LVVLV  L    VLLLLLTT    VVLLVLL LTALIVLLLL L  LL
    83   79 L E    >   -     0   0   93  206   33                EE.  EQ QEEQQ  Q    DQQQQQQQ    EEQQEQR QQQQQQQRQQ Q  QQ
    84   80 L A  G >  S+     0   0   22  206   52                AA.  AA AAAAT  A    AAGAAAAA    AAAAALS TAADAASSSS T  AA
    85   81 L D  G 3  S+     0   0   58  206   27                GG.  GE EGGEE  E    GEEEEEMM    GGEEGEE GMEGEEEEEE E  EE
    86   82 L D  G <   +     0   0    1  206    0                DD.  DD DDDDD  D    DDDDDDDD    DDDDDDD DDDDDDDDDD D  DD
    87   83 L A    <   +     0   0   12  206   78                EE.  EE EEEEA  E    EEEEEEEE    DEEEEEE EEEDASDEEE E  EE
    88   84 L A  E    S- X   0 108H   8  206   19                AA.  AA AAAAG  A    AAAAAAAA    AAAAAAA AAAAAGAAAA A  AA
    89   85 L T  E     -UX  42 107H  35  207   69                DDP  DD DDDDD  D    DDDDDDDD    DDDDDDD DEDDVVVHED E  DD
    90   86 L Y  E     -UX  41 106H   0  207    5                YYG  YY YYYYY  Y    YYYYYYYY    YYYYYYY YYYYYYYYYY Y  YY
    91   87 L Y  E     -U   40   0H   9  207    7                YYF  YY YYYYY  Y    YYYYYYYY    FYYYYYY YYYYYYHYYY Y  YY
    92   88 L a  E     -U   39   0H   0  207    4                CCC  CC CLSCC  C    CCCCCCCC    CCCCCCC CCCCCCCCCC C  CC
    93   89 L Q  E     -UY  38 102H   1  207   79                AQS  QS SNFSQ  Q    QQASSSQQ    QQQSQSA GQQSQQAAAG G  SC
    94   90 L Q  E     +UY  37 101H   0  207   84                TVV  VS SILSQ  S    LSTSSSAA    VVSSISA TASSRsTAAT T  SS
    95   91 L N        +     0   0    0  185   59                SWR  WY YKYYG  Y    WYYYYYWW    WWYYWYW WWAYTwWWWW W  YY
    96   92 L N  S    S+     0   0    1  190   79                yda  da adeay  d    ddeaaadd    ahdadsd dDdkwndddd d  av
    97   93 L E  S    S-     0   0   48  189   80                cha  cs ccqsv  g    dstvgvss    hirnhth gSdhlfngss g  nt
    98   94 L D  S    S+     0   0   42  192   76                YCY  YL YYCLW  V    HVWLLLLL    LLVLFtV VsLsWvlYll V  YV
    99   95 L P  S    S-     0   0   26  108   72                ...  .C ...C.  .    P.H...CC    .....p. .s.p.ws.pg .  ..
   100   96 L P        -     0   0    4  141   88                .W.  .Y ..VYY  .    V.G...YY    V..VYF. .W.SWHW.YP .  ..
   101   97 L T  E     -Y   94   0H  26  181   65                IV.  II IILIT  M    V.V...VV    IV.VVVV .V.STTVAVV .  VV
   102   98 L F  E     -Y   93   0H  26  205    9                FFF  FF FFFFF  F    FFFFFFFF    FFFFFFF FFFWFFFFFF F  FF
   103   99 L G        -     0   0    3  207   13                GGL  GG GGGGG  G    GGGGGGGG    GGGGGGG GGGGGSGGGG G  GG
   104  100 L A        -     0   0   81  207   63                AGQ  AA AAGAK  G    GASGGGTT    GGGGTSG GGGIGGGTTT G  TG
   105  101 L G        -     0   0   12  207   10                GGG  GG GGGGG  G    GGGGGGGG    GGGGGGG GGGEGGGGGG G  GG
   106  102 L T  E     - X   0  90H   0  207   10                TTT  TT TTTTT  T    TTTTTTTT    TTTTTTT TTTTTTTTTT T  TT
   107  103 L K  E     -tX  10  89H  74  207   54                RKM  RR RRRRK  K    KKTRRRKK    KKRKKKK KKRKRRKKKK K  KK
   108  104 L L  E     +tX  11  88H   2  206   19                LLP  LL LLLLL  L    LVLLLLVV    LLLLVVL LLVLLLLVVV L  VL
   109  105 L E  E     -t   12   0H  14  207   67                TTE  TT TTTTR  T    TTTTTTTT    TTTTTTT TTTAEDTTTT T  TT
   110  106 L M  E     -t   13   0H   0  207   27                VVS  VV VVVVV  V    VVVVVVVV    VVVVVVV VVVLVVVVVV V  VV
   111  107 L R  E     +t   14   0H 126  207   85                LLK  LL LLLLK  L    LLLLLLLL    LLLLLLL LLLPDDLLLL L  LL
   112  108 L R        -     0   0   64  207   79                GGR  GG GGGGS  G    GGGGGGGG    SGSGGGS GGGGLLSRGG S  GG
   113  109 L A        -     0   0   71  198   67                QQN  QQ QQQQG  Q    QQQQQQQQ    QQQQQQQ QQQQGGQQQQ Q  QQ
   114  110 L D        -     0   0   58  203   71                ppV  pp ppppt  p    pppppppp    ppppppp ppppHQpppp p  pp
   115  111 L A  B     -A  144   0J  19  204   57                aaA  aa aaaat  a    aasaaaaa    aaaaaaa aasaVVaaaa a  aa
   116  112 L A        -     0   0   40  206   62                SKK  SS SSASA  A    ANPAAANN    AAAANNA AAPTPAANNN A  NA
   117  113 L P        -     0   0    9  206    1                PPP  PP PPPPP  P    PPPPPPPP    PPPPPPP PPPPPPPPPP P  PP
   118  114 L T  E     -B  141   0K  85  206   55                TTS  TT TTSTS  S    STSSSSTT    SSSSTTS SSSSSTSTTT S  TS
   119  115 L V  E     -B  140   0K   8  206   18                VVT  VV VVVVV  V    VVVVVVVV    VVVVVVV VVVVLLVVVV V  VV
   120  116 L S  E     -B  139   0K  17  206   69                TTF  TT TTTTS  T    TTTTTTTT    TTTTTTT TTTTTTTTTT T  TT
   121  117 L I  E     -B  138   0K  22  207   30                LLI  LL LLLLL  L    LLLLLLLL    LLLLLLL LLLVVVLLLL L  LL
   122  118 L F  E     -B  137   0K   4  207    7                FFF  FF FFFFL  F    FFFFFFFF    FFFFFFF FFFFLLFFFF F  FF
   123  119 L P        -     0   0    5  207   23                PPP  PP PPPPP  P    PPPPPPPP    PPPPPPP PPPPAPPPPP P  PP
   124  120 L P        -     0   0    1  207    4                PPP  PP PPPPP  P    PPPPPPPP    PPPPPPP PPPPPPPPPP P  PP
   125  121 L S    >>  -     0   0    8  207    4                SSS  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSSSSSSS S  SS
   126  122 L S  H 3> S+     0   0   78  207   65                SSQ  SS SSSSS  S    SSTSSSSS    SSSSSSS SSKSMRSSSS S  SS
   127  123 L E  H 3> S+     0   0   76  207   23                EEQ  EE EEEED  E    EEEEEEEE    EEEEEEE EEEEEEEEEE E  EE
   128  124 L Q  H <4>S+     0   0    8  207   27                EEQ  EE EEEEE  E    EEEEEEEE    EEEEEEE EEEEEEEEEE E  EE
   129  125 L L  H ><5S+     0   0   29  207   22                LLL  LL LLLLL  L    LLLLLLLL    LLLLLLL LLLLLLLLLL L  LL
   130  126 L T  H 3<5S+     0   0  111  207   71                QQQ  QQ QQQQA  Q    QQNQQQQQ    QQQQQQQ QQSQQQQQQQ Q  QQ
   131  127 L S  T 3<5S-     0   0   83  207   67                AAT  AA AAAAE  A    AAGAAAAA    AAAAAAA AAASQQAAAA A  AA
   132  128 L G  T < 5S+     0   0   34  207   53                NNG  NN NNNNn  N    NNNNNNNN    NNNNNNN NNNNGGNNNN N  NN
   133  129 L G  E   < - C   0 186K  21  205   60                KKK  KK KKKKk  K    KKKKKKKK    KKKKKKK KKKKEKKKKK K  KK
   134  130 L A  E     - C   0 185K   0  207   13                AAA  AA AAAAA  A    AAAAAAAA    AAAAAAA AAAAAAAAAA A  AA
   135  131 L S  E     - C   0 184K   2  207   38                TTS  TT TTTTT  T    TTTTTTTT    TTTTTTT TTTTTTTTTT T  TT
   136  132 L V  E     - C   0 183K   0  207   28                LLV  LL LLLLL  L    LLLLLLLL    LLLLLLL LLLLLLLLLL L  LL
   137  133 L V  E     -BC 122 182K   0  207   12                VVV  VV VVVVV  V    VVVVVVVV    VVVVVVV VVVVMMVVVV V  VV
   138  134 L b  E     -BC 121 181K   0  207    3                CCC  CC CCCCC  C    CCCCCCCC    CCCCCCC CCCCCCCCCC C  CC
   139  135 L F  E     -BC 120 180K   0  207   31                LLL  LL LLLLM  L    LLLLLLLL    LLLLLLL LLLLVLLLLL L  LL
   140  136 L L  E     -BC 119 179K   0  206   48                IIL  II IIIII  I    IIIIIIII    IIIIIII IIIIAAIIII I  II
   141  137 L N  E     -B  118   0K   2  207   48                SSN  SS SSSSN  S    SSSSSSSS    SSSSSSS SSSSNNSSSS S  SS
   142  138 L N  E    S+     0   0K  49  207   47                DDG  DD DDDDN  D    DDDDDDDD    DDDDDDD DDDDKKDDDD D  DD
   143  139 L F  E     - C   0 177K   0  207   30                FFF  FF FFFFF  F    FFFFFFFF    FFFFFFF FFFFGGFFFF F  FF
   144  140 L Y  B    S+A  115   0J   9  206   40                YYY  YY YYYYY  Y    YYYYYYYY    YYYYYYY YYYYFFYYYY Y  YY
   145  141 L P  S    S-     0   0   18  207    7                PPP  PP PPPPP  P    PPPPPPPP    PPPPPPP PPPPPPPPPP P  PP
   146  142 L K  S    S+     0   0   83  206   75                GGR  GG GGGGE  G    GGGGGGGG    GGGGGGG GGGGSSGGGG G  GG
   147  143 L D        +     0   0  116  207   72                VAE  VV VVAVD  A    AASAAAAA    AAAAAAA AASADDAAAA A  AA
   148  144 L I        -     0   0   19  206   60                VVI  VV VVVVV  V    VVVVVVVV    VVVVVVV VVVVWWVVVV V  VV
   149  145 L N  E     -E  201   0L  82  207   67                KTN  KK KKEKE  T    TTTEEETT    TTTTTTT TTTTTSTTTT T  TT
   150  146 L V  E     -E  200   0L  27  207   11                VVV  VV VVVVV  V    VVVVVVVV    VVVVVVV VVVVLLVVVV V  VV
   151  147 L K  E     -E  199   0L  53  207   75                AAK  AA AAAAE  A    AAVAAAAA    AAAAAAA AAAESSAAAA A  AA
   152  148 L W  E     +E  198   0L   3  207    2                WWW  WW WWWWW  W    WWWWWWWW    WWWWWWW WWWWWWWWWW W  WW
   153  149 L K  E     +EF 197 158L  76  207   39                KKK  KK KKKKR  K    KKKKKKKK    KKKKKKK KKKKKKKKKK K  KK
   154  150 L I  E    S-E  196   0L   0  207   67                AAV  AA AAAAM  A    AAAAAAAA    AAAAAAA AAAAVVAAAA A  AA
   155  151 L D  S    S-     0   0   71  207   19                DDD  DD DDDDD  D    DDDDDDDD    DDDDDDD DDDDEDDDDD D  DD
   156  152 L G  S    S+     0   0   63  207   35                GGG  GG GGGGK  S    SGGGGGGG    SSSSGGS SSGGSGSGGG S  GS
   157  153 L S  S    S-     0   0   33  206   68                SSV  SS SSSST  S    SSSSSSSS    SSSSSSS SSSN.SSSSS S  SS
   158  154 L E  B     -F  153   0L  85  206   78                APV  AA AAAAL  P    PPTAAAPP    PPPPPPP PPTS.SPPPP P  PP
   159  155 L R        -     0   0   69  207   77                VVQ  VV VVVVV  V    VVIVVVVV    VVVVVVV VVIVRCVVVV V  VV
   160  156 L Q        +     0   0  133  207   73                NKT  NN NNNNS  K    KKTNNNKK    KKKKKKK KKTRSSKKKK K  KK
   161  157 L N  S    S+     0   0  117  207   69                AAN  AA AAAAK  A    AARAAAAA    AAAAAAA AARDPSAAAA A  AA
   162  158 L G  S    S+     0   0   29  207   34                GGG  GG GGGGG  G    GGNGGGGG    GGGGGGG GGNGGsGGGG G  GG
   163  159 L V  E     -D  183   0K  46   65   74                ..I  .. .....  .    ........    ....... .....w.... .  ..
   164  160 L L  E     -D  182   0K  16  192   49                VVQ  VV VVVVV  V    VVVVVVVV    VVVVVVV VVVV.EVVVV V  VV
   165  161 L N  E     +D  181   0K  52  196   54                EEN  EE EEEEQ  E    EEEEEEEE    EEEEEEE EEKE.EEEEE E  EE
   166  162 L S  E     -D  180   0K  12  204   50                TTS  TT TTTTT  T    TTTTTTTT    TTTTTTT TTTT.GTTTT T  TT
   167  163 L W  E     -D  179   0K  99  204   72                TTA  TT TTTTS  T    TTTTTTTT    TTTTTTT TTTT.RTTTT T  TT
   168  164 L T        -     0   0   24  204   69                TTT  TT TTKTA  T    TKRKKKTT    TTTTKKT TTRK.STKKK T  KT
   169  165 L D        -     0   0   99  204   75                PPE  PP PPPPS  P    PPAPPPPP    PPPPPPP PPAP.PPPPP P  PP
   170  166 L Q        -     0   0   18  206   75                SSQ  SS SSSSL  S    SSSSSSSS    SSSSSSS SSSSVGSSSS S  SS
   171  167 L D     >  -     0   0   48  206   62                KKN  KK KKKKK  K    KKKKKKKK    KKKKKKK KKKKLVKKKK K  KK
   172  168 L S  T  4 S+     0   0   54  206   61                QQS  QQ QQQQE  Q    QQQQQQQQ    QQQQQQQ QQQQQLQQQQ Q  QQ
   173  169 L K  T  4 S+     0   0  180  206   55                SSK  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSKQSSSS S  SS
   174  170 L D  T  4 S-     0   0   57  206   36                NND  NN NNNNN  N    NNNNNNNN    NNNNNNN NNNNDENNNN N  NN
   175  171 L S     <  +     0   0    4  206   54                NNN  NN NNNNG  N    NNSNNNNN    NNNNNNN NNSNGDNNNN N  NN
   176  172 L T        -     0   0    5  206   71                KKT  KK KKKKL  K    KKKKKKKK    KKKKKKK KKKKLgKKKK K  KK
   177  173 L Y  E     -C  143   0K   7  204    1                YYY  YY YYYYY  Y    YYYYYYYY    YYYYYYY YYYYYyYYYY Y  YY
   178  174 L S  E     -     0   0K   1  205   68                AAS  AA AAAAS  A    AAAAAAAA    AAAAAAA AAAASSAAAA A  AA
   179  175 L M  E     -CD 140 167K   0  206   80                AAL  AA AAAAA  A    AAAAAAAA    AAAAAAA AAAAWWAAAA A  AA
   180  176 L S  E     -CD 139 166K   3  206    3                SSS  SS SSSSN  S    SSSSSSSS    SSSSSSS SSSSSSSSSS S  SS
   181  177 L S  E     -CD 138 165K   0  206    0                SSS  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSSSSSSS S  SS
   182  178 L T  E     -CD 137 164K   2  206   71                YYI  YY YYYYI  Y    YYYYYYYY    YYYYYYY YYYYTTYYYY Y  YY
   183  179 L L  E     -CD 136 163K   0  206    0                LLL  LL LLLLL  L    LLLLLLLL    LLLLLLL LLLLLLLLLL L  LL
   184  180 L T  E     +C  135   0K  36  206   53                SST  SS SSSST  S    SSSSSSSS    SSSSSSS SSSSRRSSSS S  SS
   185  181 L L  E     -C  134   0K  16  206    9                LLL  LL LLLLL  L    LLLLLLLL    LLLLLLL LLLLLLLLLL L  LL
   186  182 L T  E  >  -C  133   0K  81  205   54                TTS  TT TTTTS  T    TTTTTTTT    TTTTTTT TTTTPPTTTT T  TT
   187  183 L K  H >> S+     0   0   66  204   67                SPS  SS SSSSS  P    PPSSSSPP    PPPPPPP PPDPAAPPPP P  PP
   188  184 L D  H 3> S+     0   0  109  205   63                DES  DD DDDDS  E    EESDDDEE    EEEEEEE EESQDDEEEE E  EE
   189  185 L E  H >4 S+     0   0   53  205   48                QQE  QQ QQQQE  Q    QQDQQQQQ    QQQQQQQ QQDQQQQQQQ Q  QQ
   190  186 L Y  H X< S+     0   0    6  205   12                WWY  WW WWWWW  W    WWWWWWWW    WWWWWWW WWWWWWWWWW W  WW
   191  187 L E  H 3< S+     0   0   90  205   71                KKK  KK KKKKT  K    KKKKKKKK    KKKKKKK KKKKEEKKKK K  KK
   192  188 L R  T << S+     0   0  160  205   58                SSS  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSSKKSSSS S  SS
   193  189 L H    <   -     0   0   24  203   55                HHH  HH HHHHH  H    HHKHHHHH    HHHHHHH HHKR VHHHH H  HH
   194  190 L N  S    S+     0   0   97  203   71                KRN  KK KKKKS  R    RRGKKKKK    RKRRRRK RRGS CKRRR R  RR
   195  191 L S  E     + G   0 214L  37  203   71                SSV  SS SSSST  S    SSSSSSSS    SSSSSSS SSSS SSSSS S  SS
   196  192 L Y  E     +EG 154 213L   0  203   15                YYY  YY YYYYY  Y    YYYYYYYY    YYYYYYY YYYY VYYYY Y  YY
   197  193 L T  E     -EG 153 212L   3  203   48                SSA  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSS TSSSS S  SS
   198  194 L b  E     -EG 152 211L   1  203    0                CCC  CC CCCCC  C    CCCCCCCC    CCCCCCC CCCC CCCCC C  CC
   199  195 L E  E     -EG 151 210L  34  203   61                QQE  QQ QQQQN  Q    QQEQQQQQ    QQQQQQQ QQEH EQQQQ Q  QQ
   200  196 L A  E     -EG 150 209L   1  203   23                VVI  VV VVVVV  V    VVVVVVVV    VVVVVVV VVVV AVVVV V  VV
   201  197 L T  E     +E  149   0L  36  203   31                TTT  TT TTTTK  T    TTTTTTTT    TTTTTTT TTTT TTTTT T  TT
   202  198 L H  E >   - G   0 205L  18  203   19                HHH  HH HHHHH  H    HHHHHHHH    HHHHHHH HHHH QHHHH H  HH
   203  199 L K  T 3  S+     0   0  145  202   55                EEQ  EE EEEEE  E    EEEEEEEE    EEEEEEE EEEE GEEEE E  EE
   204  200 L T  T 3  S+     0   0   55  202   40                GGS  GG GGGGS  G    GGGGGGGG    GGGGGGG GGGG SGGGG G  GG
   205  201 L S  E <   -G  202   0L  45  180   82                SSL  SS SSSSS  S    SSSSSSSS    SSSSSSS SSSK HSSSS S  SS
   206  202 L T  E    S+     0   0L 140  180   32                TTN  TT TTTTQ  T    TTTTTTTT    TTTTTTT TTTT TTTTT T  TT
   207  203 L S  E    S-     0   0L  82   83   48                  S         S                                P          
   208  204 L P  E     -     0   0L  43   67   33                  A         P                                L          
   209  205 L I  E     -G  200   0L  46   67   29                  F         V                                L          
   210  206 L V  E     +G  199   0L  70   63   53                  V         S                                           
   211  207 L K  E     +G  198   0L  85   63   26                  K         D                                           
   212  208 L S  E     -G  197   0L  67   63   28                  S         S                                           
   213  209 L F  E     -G  196   0L  30   63   18                  F         F                                           
   214  210 L N  E      G  195   0L  99   63   62                  N         E                                           
   215  211 L R              0   0   82   54   19                  R         R                                           
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  192   30  EDDEE EEDQEQQD   EE  E     EQ DQQQ        QQDQ       Q          D ED  
   218    2 H V        +     0   0   30  194   40  EIVEE VVVVVVVV   VV  V     VV VVVV        VVVV       V          V VV  
   219    3 H K  E     -A  241   0A 143  197   48  KQQKK QQQQQQQQ   QQ  Q     QH QQHQ        TTQT       Q          Q QQ  
   220    4 H L  E     -A  240   0A  11  217    3  LLLVLLLLLLLLLL   LL  L     LL LLLL        LLLL       L          L LL  
   221    5 H Q  E     -A  239   0A 120  217   73  VVQVVQVVQRVQVD   VV  V     QK AVVV        KKAK       K          A VV  
   222    6 H E  E     -A  238   0A   2  218   33  EQEEEEEEEEEEEQ   EE  E     EE QQEQ        EEQG       E          Q EE  
   223    7 H S  E     +A  237   0A  48  218   13  SSSSSSSSSSSSSS   SS  S     ST SSSS        SSSS       S          S SS  
   224    8 H G        -     0   0   35  218   20  GGGGGGGGGGGGGE   GG  G     GG EGGG        GGEG       G          E GG  
   225    9 H P        -     0   0   50  218   49  GAPGGPGGPPGPGS   GG  G     PP SAGA        PPPP       P          S GG  
   226   10 H A  S    S+     0   0   30  218   51  GEDGGGGGGSGGGV   GG  G     GG VDGE        GGVG       D          V GG  
   227   11 H V  E     -d  334   0B  33  218   25  LVLLLTLLLLLLVV   LL  L     LL VVVV        IIVI       L          V LL  
   228   12 H I  E     -d  335   0B   9  218   54  VKVVVVVVVVVVVI   VV  V     VV IKVK        LLIL       V          I VV  
   229   13 H K        -     0   0  104  218   50  QRKQEKQQKKQRLK   QK  Q     KA KKQK        QQKQ       A          K QP  
   230   14 H P  S    S+     0   0   56  218    9  PPPPPPPPPPPPPP   PP  P     PP PPPT        PPPP       P          P LP  
   231   15 H S  S    S+     0   0   90  218   20  GGSGGSGGSSGSGG   GG  G     SS GGGG        SSGS       S          G GG  
   232   16 H Q  S    S-     0   0   76  218   59  GEQGGEGGQQGEGG   GG  G     QQ GARA        QQGQ       Q          G GG  
   233   17 H S        -     0   0   51  217   20  SSSSSSSSSTSTSS   SS  S     SS SSSS        TTST       S          S SS  
   234   18 H L  E     - B   0 300A   1  217   43  LLLLLLLLLLLLLH   LL  L     LL HVLV        LLHL       L          H LR  
   235   19 H S  E     - B   0 299A  64  218   51  RRSRRRRRSSRSRK   RR  R     SS KKRK        SSKS       S          K RK  
   236   20 H L  E     - B   0 298A   1  218   13  LILLLLLLLLLLLL   LL  L     LI LVLV        LLLL       I          L LL  
   237   21 H T  E     -AB 223 297A  29  218   33  ASTSSTSSTTSTSS   SS  S     TT SSSS        TTST       T          S SS  
   238   22 H c  E     -AB 222 296A   0  219    1  CCCCCCCCCCCCCC   CC  C     CC CCCC        CCCC       C          C CC  
   239   23 H I  E     -AB 221 295A  54  217   75  VKTVVTAASTAAAT   AA  A     ST TKAK        SSTS       T          T AA  
   240   24 H V  E     -A  220   0A   4  217   51  GGVGGVAAVAAVAA   AA  A     VV AAAA        VFAF       V          P TA  
   241   25 H S  E     +A  219   0A  60  218    9  SSTSSSSSTSSSSS   SS  S     TS SSFS        SSSS       S          S SS  
   242   26 H G  S    S+     0   0   54  218    3  GGGGGGGGGGGGGG   GG  G     GG GGGG        GGGG       G          G GG  
   243   27 H F  S    S-     0   0   37  199   23  FYYFFFFFYFFYFF   FL  F     YF FYFY        FFFF       F          F LF  
   244   28 H S    >   -     0   0   44  200   45  RTSTRETTSSTSRK   TS  T     SS TTTS        SSTS       A          T TT  
   245   29 H I  T 3  S+     0   0    2   56   45  ..............   ..  .     .. ....        LL.L       .          . ..  
   246   30 H T  T 3   +     0   0   59   61   59  ..I.....I..I..   ..  .     I. ....        TS.S       .          . ..  
   247   31 H R  S X  S-     0   0  145  218   53  .FTFFLFFTLFSFF   VF  F     TL FFFI        TTFT       L          F FF  
   248   32 H T  T 3  S+     0   0   72  204   59  NTSSSRSSSSNSRS   SS  S     ST STGS        FYSY       T          S TS  
   249   33 H N  T 3  S+     0   0   16  204   62  IDGTGSNSGSSGDS   NT  S     SD DNDD        GGTG       S          D KN  
   250   34 H Y  E <   -E  317   0C  23  220   46  NYYTYYYYYYYYYY   YY  Y     YY YYHN        LISM       Y          H YY  
   251   35 H d  E     -EF 316 270C   0  218   89  VWGYPSYAYGAWDW   GA  A     RG YFSY        GGWC       A          W WG  
   252   35AH W  E     -EF 315 269C   1  218   43  IIWIIMMMWIMWMM   IM  M     WV MFMI        VVMV       I          M MM  
   253   35BH H  E     -EF 314 268C   0  219   73  NGHNGDSDNNDSHN   HN  D     NH NHHH        GGNG       S          N TH  
   254   36 H W  E     +EF 313 267C   1  221    2  WWWWWWWWWWWWWW   WW  W     WW LWWW        WWWW       W          W WW  
   255   37 H I  E     -EF 312 265C   0  221   15  IVIVVITVIVVIVV   VV  V     IV VVVV        IIVI       V          V VV  
   256   38 H R  E     -EF 311 264C  10  221   15  RRRRRRRRRRRRRR   RR  R     RR RRRR        RRRR       R          R RR  
   257   39 H Q  E     -EF 310 263C  22  220    2  QQQQQQQQQQQQQQ   QQ  Q     KQ QQQQ        QQQQ       Q          Q QQ  
   258   40 H A    >   -     0   0   14  220   61  AMFASPAAFAAPSD   AA  A     FP AAAA        PPAS       P          A AA  
   259   41 H P  T 3  S+     0   0   99  221   19  PPPPPPPPPPPPPP   PP  P     PP PPPP        SSPS       P          P PP  
   260   42 H G  T 3  S+     0   0   94  221   12  GGGGGGGGGGGGGD   GG  G     GG GGGG        GGGG       G          G GE  
   261   43 H K  S <  S-     0   0  140  221   34  KKNKRKKKNKKKEK   KK  K     NK KQRQ        KKKK       K          K KK  
   262   44 H G        -     0   0   20  221   24  GGKGGGGGKAGGGR   GG  G     KG GGGG        GGGG       G          G GG  
   263   45 H L  E     -F  257   0C  10  221    9  LLLLPLLLLLLLLL   LL  L     LL LPLL        LLLL       L          L LL  
   264   46 H E  E     -F  256   0C  79  221    9  EEEEEEEEEEEEEQ   EE  E     EE QEEE        EEQE       E          Q EE  
   265   47 H W  E     +F  255   0C  13  221    9  WLWWWWWWWCWWWW   WW  W     WW WWWW        WWWW       W          W WW  
   266   48 H M  E     -     0   0C   3  221   31  LMMLLIVVMLVIVV   IV  V     ML VMMM        LLVL       L          L VV  
   267   49 H G  E     -FG 254 277C   0  221   42  AGGAAGSSGASGAS   SS  S     GI SGAA        AASA       G          S AA  
   268   50 H R  E     -FG 253 276C  10  221   93  TMYAMLYYYCYYLR   FS  A     YV RMLW        HHYN       V          N NY  
   269   51 H I  E     -FG 252 275C   3  221   16  FIIIIVIIIIIIII   LI  I     II IITI        IIII       I          I II  
   270   52 H d  E >   -F  251   0C   0  221   83  NDSSQYNNNTNYWT   SS  S     NW SNWR        WWSW       W          Y NS  
   271   53 H Y  T 3  S+     0   0   47  221   84  SpYtssYYYgYHYN   ys  g     SS DpFp        WwSw       t          d Es  
   272   54 H E  T 3  S-     0   0   63  207   63  gnSdggnnD.nSdd   dd  a     AD gddn        Dddd       .          s ds  
   273   55 H G  S <  S+     0   0   25  200   53  gSGSq.ggGggGtd   ..  G     GG gGsG        D.g.       g          . sG  
   274   56 H S        -     0   0   42  217   74  GGSAESSSSNSSKI   TY  S     SS SSNG        ENSD       V          K DT  
   275   57 H I  E     -G  269   0C  71  220   53  TTNDTTTTNTTTTT   II  T     TP TTNT        KKTK       T          I EI  
   276   58 H Y  E     -G  268   0C  70  221   79  FKNYKSYYNAYYYY   HY  Y     NN VKYV        HYYY       N          N YF  
   277   59 H Y  E     -G  267   0C  41  221   17  YYYAYIYYYYYYYY   YY  Y     YY YYYS        YYYY       Y          Y YY  
   278   60 H S    >>  -     0   0   11  221   61  ANNASAAANNANSN   AR  A     NN AAAA        NNAN       N          A VA  
   279   61 H P  T 34 S+     0   0   76  221   51  DRPDDDDDPPDPDD   DD  D     PP DQDE        PTDP       S          D GD  
   280   62 H S  T 34 S+     0   0   79  221   52  SSSFSSSSSASSSS   SS  S     SA SRSK        AASS       A          S ST  
   281   63 H I  T X4 S+     0   0    4  221   40  VFLVVLVVLLVLVF   VV  V     LL VFVF        LLVL       L          L VV  
   282   64 H K  G >< S+     0   0  133  221   28  KEKRRKKKKKKKKK   KK  K     KK KQKQ        KKRK       K          K EK  
   283   65 H S  G 3  S+     0   0  116  221   27  GGSGGNGGNSGSGG   GG  G     SS GGGG        SSGN       S          G GG  
   284   66 H R  G <  S+     0   0   51  221   18  RHRRRRRRRRRRRR   RR  R     RR RRRR        RRRR       R          R RR  
   285   67 H S  E <   -C  300   0A  11  221   54  FIIFFVFFILFALF   FF  F     IL FVFV        LLFL       L          F FF  
   286   68 H T  E     -C  299   0A  67  221   23  TTSTTTTTSNTTTT   TT  T     SS TSTT        TTTT       S          T TT  
   287   69 H I  E     +C  298   0A   3  221   29  IIIFIIIIIIIIVI   II  I     II IMII        IIII       I          I II  
   288   70 H S  E     -C  297   0A  56  221   37  SSTSSTSSTTSSSS   SS  S     TS STST        SSSS       S          S SS  
   289   71 H R  E     -C  296   0A  71  221   60  KARKRKRRRKRARR   RR  R     RK RRRI        KKRK       K          R RR  
   290   72 H D  E >>> -C  295   0A  55  221   10  VDDDDDDDDDDDDD   DD  D     DD DDDD        DDDD       D          D DD  
   291   73 H T  T 345S+     0   0   78  220   57  DMTDNNNNTKNTNN   NN  N     TN NTNT        TTNT       N          N NN  
   292   74 H S  T 345S+     0   0  105  220   44  SSSSSGAASSASYN   AA  A     SP NSIS        SSNS       S          N AA  
   293   75 H L  T <45S-     0   0  103  217   69  QIKQQKKKKKKKKK   KK  K     KK NTRL        INNN       K          N KK  
   294   76 H N  T  <5 +     0   0   29  218   47  NSNNGKNNNSNNNN   NN  N     NS NSNN        NNNN       S          N SN  
   295   77 H K  E   < -BC 239 290A  51  221   70  TTQTTQSSQQSQTN   SS  S     QQ KTIT        QQKQ       Q          K ST  
   296   78 H F  E     -BC 238 289A   1  221   60  AAFASVLLFVLFLL   LL  L     FV LILA        VVLA       V          L LL  
   297   79 H F  E     -BC 237 288A  50  221   32  YYFYYYYYFSYSYY   YY  Y     FF YYYY        LFYF       F          Y YF  
   298   80 H I  E     -BC 236 287A   4  221    5  LLLLLLLLLLLLLL   LL  L     LL LMLM        LLLL       L          L LL  
   299   81 H Q  E     -BC 235 286A  73  221   35  QQQQQQQQKSQREQ   QQ  Q     QK QEQE        KKQK       K          Q QQ  
   300   82 H L  E     -BC 234 285A   3  221   19  MWLMMMMMLLMLMM   MM  M     VM MLIL        IIMI       M          M MM  
   301   82AH I        +     0   0   70  221   58  NTNDNTSNNSNSKN   NN  N     NN NSNT        AANT       N          N NT  
   302   82BH S  S    S-     0   0   59  221   33  SSSSNGGSSSSSSN   SS  S     SS NSRS        SSNN       S          N SS  
   303   82CH V        -     0   0    0  221   13  LLVLLMLLVVLVLL   LL  L     VL LLLL        VVLM       L          L LL  
   304   83 H T    >   -     0   0   65  221   63  RKTRREKRTTRTGQ   RR  R     TQ QRRK        DDQD       Q          Q RR  
   305   84 H N  G >  S+     0   0  120  221   62  TATTSVTATTAAAT   DV  A     TT TSDS        TTTT       T          T AS  
   306   85 H E  G 3  S+     0   0  160  221   21  ESEEEKEEEEEAEE   ED  E     ED EEED        AAEA       N          E EE  
   307   86 H D  G <  S+     0   0    0  221    1  DDDDEDDDDDDDDD   DD  D     DD DDDD        DDDD       D          D DD  
   308   87 H T    <   +     0   0   30  221   36  TSTTSTTTTTTTTT   TT  T     TT TTTT        TTTT       T          T TT  
   309   88 H A  E    S- H   0 333C   3  221    5  AAAAAAAAAAAAAA   GA  A     AA AAAA        AAAA       A          A AA  
   310   89 H M  E     -EH 257 332C  43  221   61  HITRRMVVTTVVVV   FV  V     TM VMVL        RTVT       R          V VM  
   311   90 H Y  E     -EH 256 331C   2  221    0  YYYYYYYYYYYYYY   YY  Y     YY YFYY        YYYY       Y          Y YY  
   312   91 H Y  E     -E  255   0C   1  221    3  YYYFYYYYYYYYYY   YY  Y     YY YFYY        YYYY       Y          Y YY  
   313   92 H c  E     +E  254   0C   0  221    1  CCCCCCCCCCCCCC   CC  C     CC CCCC        CCCC       C          C CC  
   314   93 H S  E     -EI 253 327C   0  221   30  TAATVATAAAAAAG   VA  A     AA TAAA        AAAA       A          A AA  
   315   94 H R  E     -EI 252 326C  20  220   39  KRRRRRRRSKRGRR   RR  K     RR TRRR        QRSR       R          K RR  
   316   95 H E  E     -EI 251 324C   0  220   75  KLYGGGHDRYDHDD   SD  G     EG EAEG        IMTG       D          H YL  
   317   96 H N  E  >> -E  250   0C   6  220   89  SREPLPTTGSTSQT   AS  Q     SG GGRH        PALC       S          M HY  
   318   97 H H  T  45S+     0   0    0  220   93  WLGPSLVVYTVEGW   AC  E     PE GPGS        IDAN       N          G LY  
   319   98 H M  T  45S+     0   0   73  221   94  LSNAITRRSDRGYF   GN  R     SG NGTD        YSGS       Y          V VS  
   320   99 H Y  T  45S+     0   0  159  221   92  GGYVAGGVWDGQAG   SG  R     TS DYLW        YSTG       E          A PN  
   321  100 H E  T  <5 -     0   0   54  221   92  GTDAVVGSFCSSGA   DA  G     RA FGMS        GGAY       G          D GY  
   322  100AH T      < +     0   0    0  221   92  GNYMQAVVPAQVYD   II  L     RG ATSS        DAFG       A          A IG  
   323  100BH Y  S    S-     0   0   10  221   92  MSAGLDSSNCCYGN   WC  G     FY YSRY        FWDG       M          F YG  
   324  100CH F  E     +I  316   0C   0  221   93  DyMpsyppWsehvg   Vy  A     An Wady        hFYl       D          D da  
   325  101 H D  E     +     0   0C  42  133   50  .qDdsdnn.dssdd   Ds  .     .a .ddd        dA.d       .          . dd  
   326  102 H V  E     -I  315   0C  35  153   74  LFYLFYLL.ACGHY   PP  .     YY .YMY        NY.Y       Y          Y LY  
   327  103 H W  E     -I  314   0C  28  177   14  WWWWWWLL.WRWWW   WW  .     WW .WWW        WWWW       W          W WW  
   328  104 H G        -     0   0    3  204   16  GGGGGGQQGGGSGG   GG  C     GG GGGG        GGGG       G          G GG  
   329  105 H Q        -     0   0  100  183   48  PQQPPQ..QQ..QS   QQ  .     QQ QQQQ        PQPQ       Q          A QQ  
   330  106 H G        -     0   0    3  191    7  GGGGGGGGGG..GG   GG  .     GG GGGG        GGGG       G          G GG  
   331  107 H T  E     -H  311   0C  27  202   47  ITTVVTKTTL..TT   TT  T     TT TTTT        TTTV       T          T VT  
   332  108 H T  E     -H  310   0C  48  208   81  ELSEEMMPLL..LM   LL  Q     LL MLLL        SLMM       S          M LS  
   333  109 H V  E     -H  309   0C   0  214   25  VVVVVVRRVVP.VV   VV  L     VV VVVV        VVVV       V          V VV  
   334  110 H T  E     -d  227   0B  16  217   44  VITVFTSTTTLQTT   TT  C     TT TTTT        TTTT       T          T TT  
   335  111 H V  E     +d  228   0B   2  218   17  VVVVVVAVVVVVVV   VV  L     VV VVVV        VVVV       V          V VV  
   336  112 H S        -     0   0   18  219   35  SSSSSTSVSSTEST   SS  T     SS TSSS        SSTS       S          T SS  
   337  113 H S  S    S+     0   0   99  220   31  PLSSSSTTASAASS   SS  L     SA SSSS        SASS       S          S SS  
   338  114 H A  S    S-     0   0   31  221   51  AAEAAAAaEEavAA   AA  v     EE VATA        EEAE       E          V AE  
   339  115 H K        -     0   0  143  209   69  PSPPPTSsSSssST   SS  s     SP .SSS        PPQT       P          . SP  
   340  116 H T        -     0   0   44  210   73  KTAKKLTTAETPPL   PP  T     QA .PPP        AASP       A          . PA  
   341  117 H T  B     -J  370   0D  35  217   71  TKRTTHKKRTKTTH   TT  K     SR TTTT        RRSR       R          T TR  
   342  118 H P        -     0   0   60  218   66  AGEAAANNNSNKSA   SS  N     SE aSSS        EEAD       E          a SE  
   343  119 H P        -     0   0   13  218   31  PPPPPPPPPPPPPP   PP  P     PP pPPP        PPPP       P          p PP  
   344  120 H S  E     -K  367   0E  51  218   62  SSTSSSDDTSDQKS   KK  D     TT SKKK        TTST       T          S KT  
   345  121 H V  E     -K  366   0E   6  219   45  VVIVVVVVIIVVVV   VV  V     VI VVVV        IIVI       I          V VI  
   346  122 H Y  E     -K  365   0E  27  220   34  YFYYYFFFYFFFFF   FF  F     FY FFFF        YYFY       Y          F FY  
   347  123 H P  E     -K  364   0E  15  220   29  PPPPPPPPPPPPPP   PP  P     PP PPPP        PPPP       P          P PP  
   348  124 H L  E     +K  363   0E   4  221    3  LLLLLLLLLLLLLL   LL  L     LL LLLL        LLLL       L          L LL  
   349  125 H A        -     0   0   10  221   68  AAtAARTTtSTSSR   sS  T     Vt IsSs        ttKR       t          I st  
   350  126 H P        -     0   0   24  216   47  PPpPPPPPp.PLLP   dL  P     Sp PdLd        ppPP       p          P dp  
   351  127 H G  S    S-     0   0   16  219   75  CSQCCCCCPLCCCC   SC  C     CQ CSCS        QQCP       Q          C SQ  
   352  128 H S  S    S+     0   0   99  219   60  GSAGSCGGAGGSSC   TS  G     EA CTST        AACP       A          C TA  
   353  129 H A        +     0   0   52  220   92  RRLRRgTTLNTETg   PT  T     sL dPTP        LLSS       L          d PL  
   354  130 H A        +     0   0   70  136   83  DS.DDs...N...s   ..  .     l. v...        ....       .          v ..  
   355  133 H Q        +     0   0  178  159   73  TT.TTS...D.QQS   .Q  .     S. D.Q.        ..SL       .          D ..  
   356  134 H T    >   -     0   0   64  220   50  SSSSSSSSSPSPPS   QP  S     DS FQPQ        SSSS       S          F QS  
   357  135 H N  T 3  S-     0   0  146  221   56  GGSGGDGGSAGDDD   DD  G     ES NDDD        SSNS       S          N DS  
   358  136 H S  T 3  S+     0   0   63  221   63  PGDPPSTTDGTGGS   GG  T     ND DGGG        DDED       D          D GD  
   359  137 H M  E <   - L   0 408E  83  221   79  NTPNNHTTPQTNNH   NN  T     LP SNNN        PPIP       P          S NP  
   360  138 H V  E     - L   0 407E  15  221   34  VAVVVVTTVVTVVV   VV  T     VV VVVV        VVAV       V          V VV  
   361  139 H T  E     + L   0 406E  15  221   70  AAIAATAAIVAVVT   VV  A     AI TVVV        IITI       I          T VI  
   362  140 H L  E     + L   0 405E   0  221   27  LLILLILLIILVII   VI  L     MI MVIV        IIII       I          M VI  
   363  141 H G  E     -KL 348 404E   0  221   30  GGGGGGGGGGGAAG   AA  G     GG GAAA        GGGG       G          G AG  
   364  142 H e  E     -KL 347 403E   1  221    0  CCCCCCCCCCCCCC   CC  C     CC CCCC        CCCC       C          C CC  
   365  143 H L  E     -KL 346 402E   2  221   33  LLLLLLLLLLLLLL   LL  L     LL LLLL        LLFL       L          L LL  
   366  144 H V  E     -KL 345 401E   1  221   49  AVIAASVVIVVVVS   VV  V     AI VVVV        IIAI       I          V VI  
   367  145 H K  E     -KL 344 400E  38  220   74  SKHSSTKKHQKRQT   QQ  K     RH TQQQ        HHSQ       H          T QH  
   368  146 H G  E    S+     0   0E  19  221   50  SDDSSGDDDGDSGG   GG  D     DD GGGG        DDGN       D          G GD  
   369  147 H Y  E     - L   0 399E   0  221   18  YYYYYFYYYFYFFF   FF  Y     FY YFFF        YYFY       Y          Y FY  
   370  148 H F  B     +J  341   0D   3  221   42  FFFFFLFFFFFFFL   FF  F     LF MFFF        FFLF       F          M FF  
   371  149 H P  S    S-     0   0    0  221   37  PPpPPPPPppPppP   pp  P     Pp Appp        ppPp       p          A pp  
   372  150 H E  S    S+     0   0   53  211   46  EEgEEAEEgaEeeA   ee  E     Sg Deee        ggQg       g          D eg  
   373  151 H P        +     0   0   59  219   54  PPTPPPPPTPPPPP   PP  P     ST PPPP        TTPN       T          P PT  
   374  152 H V        -     0   0   20  221   53  VVMVVVVVMLVLLV   LL  V     IM LLLL        MMVM       M          L LM  
   375  153 H T  E     +N  422   0F  83  220   71  TTNTTDTTNSTSSD   SS  T     SN DSSS        NNNN       N          D SN  
   376  154 H V  E     +N  421   0F  23  221   43  MVVMVVVVVVVVVV   VV  V     FV IVVV        VVIV       V          I VV  
   377  156 H T  E     -N  420   0F  48  221   56  TSTTTKSSTTSTTK   TT  S     ST QTTT        TTQT       T          Q TT  
   378  157 H W  E > >S-NO 419 383F   2  221    0  WWWWWWWWWWWWWW   WW  W     WW WWWW        WWWW       W          W WW  
   379  162 H N  G > 5S-     0   0   38  221   69  NNGNNNNNGNNSsN   ss  N     nG Nsss        GGkG       G          N sG  
   380  163 H S  G 3 5S-     0   0   91  218   63  SSKSSSSSKQS.sS   ss  S     nK Dsss        KKsK       K          D sK  
   381  164 H G  G < 5S+     0   0   39  218   55  GGSGGGGGSNG.GG   GG  G     TS GGGG        SSGS       S          G GS  
   382  165 H S  T < 5 +     0   0   93  221   60  AAGAASAAGGAQQS   QQ  A     EG SQQQ        GGSG       G          S QG  
   383  166 H L  B   < +O  378   0F  43  221   87  LLKLLILLKDLSGI   NG  L     VK INGN        KKIK       K          I NK  
   384  167 H S        +     0   0   88  221   69  TTDTSTTTDSTGVT   VV  T     MD TVVV        DDTD       D          T VD  
   385  168 H S  S    S+     0   0  101  221   77  SSISSSSSIVSTTS   TT  S     QI TTTT        IISI       I          T TI  
   386  169 H G  S    S+     0   0   32  218   43  GGTGGGGGTSGTAG   AA  G     GT GAAA        TTGS       T          G AT  
   387  171 H V        +     0   0   48  219   62  VVTVVLVVTVVTRL   RR  V     VT IRRR        TTIV       T          I RT  
   388  172 H H  E     -M  404   0E  17  220   80  HHVHHKHHVRHHNK   NN  H     RV KNNN        VVKI       V          K NV  
   389  173 H T  E     -M  403   0E  69  220   82  TTNTTNTTNNTFFN   FF  T     TN TFFF        NNNN       N          T FN  
   390  174 H F  E     -M  402   0E   1  219   43  FFFFFFFFFFFPPF   PP  F     FF MPPP        FFFF       F          M PF  
   391  175 H P  E     -     0   0E  65  219   32  PPPPPPPPPPPPPP   PP  P     PP RPPP        PPPP       P          R PP  
   392  176 H A  E     -     0   0E  19  215   65  SAPSSAAAPAASSA   SS  A     TP PSSS        PPAP       P          P SP  
   393  177 H V  E     -M  400   0E  42  214   63  VVAVVVVVAVVQQV   QQ  V     LA VQQQ        AAVA       A          V QA  
   394  178 H L  E     -M  399   0E  77  214   65  LLLLLLLLLLLADL   DD  L     RL LDDD        LLAQ       L          L DL  
   395  179 H Q  S    S-     0   0   83  214   70  QQAQQQRRAARAAQ   AA  R     TA sAAA        AAQI       A          s AA  
   396  180 H S  S    S-     0   0  116  214   49  pssppqsssGspsq   ss  s     Gs vsss        ssqs       s          v ss  
   397  183 H D  S    S+     0   0   90  206   25  gggggggggSggdg   dd  g     Dg gddd        gggg       g          g dg  
   398  184 H L        -     0   0   53  199   75  LLRLLLLLRLLLLL   LL  L     KR LLLL        RRYP       R          L LR  
   399  185 H Y  E     -LM 369 394E  36  205    2  YYYYYFYYYYYYYF   YY  Y     YY YYYY        YYFY       Y          Y CY  
   400  186 H T  E     +LM 367 393E   5  195   48  SSTSSASSTTSTTA   TT  S     TT TTTT        TTAT       T          T TT  
   401  187 H L  E     -L  366   0E  11  190   56  LLMLLSLLMMLTTS   TT  L     AM LTTT        MMSM       M          L TM  
   402  188 H S  E     -LM 365 390E   5  191   26  SSSSSSSSSSSSSS   SS  S     TS SSSS        SSSC       S          S SS  
   403  189 H S  E     -LM 364 389E   2  191    0  SSSSSSSSSSSSSS   SS  S     SS SSSS        SSSS       S          S SS  
   404  190 H S  E     -LM 363 388E   0  191   77  MVQMMQMMQQMQQQ   QQ  M     QQ QQQQ        QQQQ       Q          Q QQ  
   405  191 H V  E     -L  362   0E   0  190   27  VVLVVLVVLLVLLL   LL  V     VL LLLL        LLLL       L          L LL  
   406  192 H T  E     +L  361   0E  48  189   37  TTTTTTTTTTTTTT   TT  T     LT TTTT        TTTT       T          T TT  
   407  193 H V  E     -L  360   0E  14  188   30  VVLVVITTLLTLLI   LL  T     LL ILLL        LLIL       L          I LL  
   408  194 H P  E  >  -L  359   0E  56  188   40  PPPPPPSSPPSPPP   PP  S     SP LPPP        PPPP       P          L PP  
   409  195 H S  T  4 S+     0   0   49  187   50  ASAAALSSAASAAL   AA  S     AA AAAA        AAIA       A          A AA  
   410  196 H S  T  4 S+     0   0   66  187   69  SSVSSSAAVSAATS   TT  A     KV STTT        VVSA       V          S TV  
   411  198 H P  T  > S+     0   0   31  187   72  SSESSDGGELGQQD   QQ  G     nE EQQQ        EERE       E          E QE  
   412  199 H R  T  < S+     0   0   16  187  102  LLCLLWSSCCSCCW   CC  S     eC WCCC        CCWC       C          W CC  
   413  200 H P  T  4 S+     0   0   80  188   68  SGPSSKQQPPQPLK   PL  Q     GP KPLP        PPNP       P          K PP  
   414  202 H S  T  4 S+     0   0  111  188   69  ITESSATTEKTDAA   DA  T     SE NDAD        EESE       E          N DE  
   415  203 H E  S  < S-     0   0  128  188   76  KQGKKKYYGGYTGK   GG  Y     DG SGGG        GGED       G          S GG  
   416  204 H T        -     0   0   83  188   70  STeSSkTTeqTkkk   kk  T     ee Tkkk        eeSt       e          T ke  
   417  205 H V        +     0   0    4  184   61  YYvYYf..vv.vvf   vv  .     lv Yvvv        vvFv       v          Y vv  
   418  206 H T  E     - P   0 433F  23  183   70  TIKTTE..KT.KTE   TT  .     VK KTTT        KKTK       K          K TK  
   419  208 H e  E     -NP 378 432F   0  187    0  CCCCCCCCCCCCCC   CC  C     CC CCCC        CCCC       C          C CC  
   420  209 H N  E     -NP 377 431F   4  187   60  NNSNNNNNSQNSHN   HH  N     KS KHHH        SSTS       S          K HS  
   421  210 H V  E     -NP 376 430F   1  187   16  VVVVVVVVVVVVVV   VV  V     IV VVVV        VVVV       V          V VV  
   422  211 H A  E     -NP 375 429F  14  187   74  NDQNNEVVQQVKKE   KK  V     HQ VKKK        QQTQ       Q          V KQ  
   423  212 H H  E > > - P   0 428F   1  187    7  HHHHHHHHHHHHHH   HH  H     HH HHHH        HHHY       H          H HH  
   424  213 H P  G > 5S+     0   0   77  177   83  PKDPPKTTDLT  K       T     GD NYY         DDGN       D          N  D  
   425  214 H A  G 3 5S+     0   0   40  177   67  APSAAPPPSSP  P       P     NS YTT         SSST       S          Y  S  
   426  215 H S  G < 5S-     0   0   32  176   64  TSNTTTTTNKT  T       T     KN TNN         NNTS       N          T  N  
   427  216 H S  T < 5 +     0   0  111  176   72  TNPTTSGGPAG  S       G     NP NSP         PPSP       P          N  P  
   428  217 H T  E   < +P  423   0F  35  176   66  TTVTTTFFVSF  T       F     KV TSS         VVTV       V          T  V  
   429  218 H K  E     +P  422   0F 135  176   53  KKQKKKKKQKK  K       K     DQ KQQ         QQPK       Q          K  Q  
   430  219 H V  E     -P  421   0F  38  125   32  VV VVVKK  K  V       K     L  Q             V                   Q     
   431  220 H D  E     -P  420   0F  97  125   35  DD DDTDD  D  T       D     H  E             T                   E     
   432  221 H K  E     -P  419   0F  51  113   47  KK KKQVV  V  Q       V     V  K             S                   K     
   433  222 H K  E     -P  418   0F 121  113   52  RK RRKPP  P  K       P     P  S             E                   S     
   434  223 H I        -     0   0    4  109   32  VV VVIVV  V  I       V     I  L             L                   L     
   435  224 H V        -     0   0   79  101   61  GE GGEPP  P  E       P     P                                          
   436  225 H P              0   0   73   92   66  TP TT VV  V          V     A                                          
   437  226 H R              0   0  167   78   25  KK KK KK  K          K                                                
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 L D              0   0  100   71   31           EE                          EEE   Q                       D  
     2    2 L I        -     0   0    0   77   33           LL                          LLL   V                       L  
     3    3 L V        -     0   0   88   83   53           VV                          VVV   T                       V  
     4    4 L M  E     -Q   25   0G  12   86   20           MM                          MMM   V                       M  
     5    5 L T  E     -Q   24   0G  80   86   17           TT                          TTT   T                       T  
     6    6 L Q  E     -Q   23   0G  19   86    6           QQ                          QQQ   Q                       Q  
     7    7 L S  E    S+Q   22   0G  57   86   54           TT                          TTT   T                       T  
     8    8 L P        -     0   0   47  128    7  PP      PPP        P    PP PP PP     PPP P PP  P                 P PP 
     9    9 L A  S    S-     0   0   79  136   69  SP      GSS        P    SP SP SP     SSS SASS  S         A       A SP 
    10   10 L S  E     -t  107   0H  78  142   56  SS      AMMS       S    SV SS SS    SIMM SSVS  S        SS       S MS 
    11   11 L L  E     -t  108   0H  34  176   45  VV      VLLV     V VV   VVVVVVVV VV VLLL EVLV  V        VVVV V  VV LV 
    12   12 L V  E     +t  109   0H  86  187   34  SSSSSS  SPPSS    S SS   STSSSSSS SS SPPP SSLS  S        TSSS S  SS PS 
    13   13 L V  E     -t  110   0H  17  189   58  GGVVVV  SVVVV    G VV   TSVGGVGG VV KVVV VVSG  G        AVGG G  VA VG 
    14   14 L S  E >   -t  111   0H  46  199   61  SSTSAS  ATTSS    S AS   SASSSASN AA STTT SSES  S        QSTT T  AN TN 
    15   15 L L  T 3  S+     0   0   79  198   66  LLLPPP  VVVPP    P PP   LPPLLLLP QQ LVVV PVPL  L        AVPP P  QL VP 
    16   16 L G  T 3  S+     0   0   39  206    7  GGGGGGG GGGGG G  G GG   GGGGGGGG GG GGGG GGGG  G        GGGG G  GG GGG
    17   17 L Q    <   -     0   0   97  206   52  QQQQQQQ GQQQQ Q  Q KQ   SSGQQQQQ QQ QQQQ GGQQ  Q        QGQQ S  QG QQQ
    18   18 L R        -     0   0  152  206   62  RTTTTTT TTTNT T  S TT   TTTRTTRR TT STTT TTSR  R        ATSS S  TT TRT
    19   19 L A  E     - R   0  79G   2  206   44  VVAAAAA VAAAA V  V AA   AVVVVAVI AA VAAA VVLV  V        VVVV V  AV AVA
    20   20 L T  E     - R   0  78G  66  207   59  STSRRKR STTQR R  T RR   KTTSTKST SS TTTT KTTS  S        SKTT T  SK TTR
    21   21 L I  E     - R   0  77G   0  207   22  IIIIIII IIILI I  I II   LLLIIIII II IIII LLVI  I        ILII I  II MII
    22   22 L S  E     -QR   7  76G  36  207   50  TSTTTTT STTTT T  P TT   PTTTSTTS TT STTT STHT  T        TTSS S  TT TST
    23   23 L a  E     -QR   6  75G   0  207    0  CCCCCCC CCCCC C  C CC   CCCCCCCC CC CCCC CCCC  C        CCCC C  CC CCC
    24   24 L R  E     -QR   5  74G 153  207   75  TTRSGSG RKKSS Q  T GS   KKGSTSSS SS TKKK TERS  S        KETT A  SS KAR
    25   25 L A  E     -Q    4   0G   6  207   68  GGGGGGG TAAGG G  G AG   ATLGGGGG RR GAAA LGLG  G        TGGG G  RG AGG
    26   26 L S  S    S+     0   0   63  207   52  SSNDNDD SSSND D  T DD   SSSSSDSS DD TSSS TDSS  S        SDTT S  DG SSD
    27   27 L E  S    S-     0   0  105  207   72  SSSANAS QSSNA S  S NA   TQSSSLSS NN SNSS GDRS  S        TDSS S  NS RSN
    28   27AL S        -     0   0   29  207   74  SnILILI DSSIL l  S IL   GAGtnLSS II SSSS VIDS  S        AISS N  IS SSI
    29   27BL V        +     0   0    0   57   77  .i..... V.... .  . ..   .V.ii... .. .... T...  .        .... .  .. ...
    30   27CL D  E     +Z   35   0I  45   79   82  .G....E Y.... .  . ..   .Y.GG... .. .... F...  .        V.DD .  .. ...
    31   27DL S  E >  S+Z   34   0I  15  116   82  DI....S V.... .  D ..   NRSIN.NN .. D... S.PN  N        W.VV D  .. .N.
    32   28 L Y  T 3  S-     0   0  173  119   89  VL....Y Y.... .  V ..   IDVYL.II .. I... N.VI  V        N.GG I  .. .I.
    33   29 L G  T 3  S+     0   0   81  200   60  GGGPGPA kIIGP .  g GP   GssGGDGG GG gIII VGCG  G        GGGG g  GG IGG
    34   30 L K  E <  S-Z   31   0I 112  170   77  K.RKSK. nSSSR t  y AK   Dgs..KSV SS ySSS .SCR  N        .SYY t  S. SGS
    35   31 L S  E     -Z   30   0I   7  186   77  G.KKKK. HNNKK Y  N KK   SDY..KYY YY NNNN .KYD  G        NMNN S  YY DYK
    36   32 L F        +     0   0    5  198   68  Y.DYYY. CYYAY Y  Y SY   YWY..YNT YY AYYY DAYN  Y        HAYY G  YA YYY
    37   33 L M  E     -U   94   0H   0  205   51  VVVAVAV LLLVA A  V VA   VMPVVTVV II VLLL VVVV  V        LVVV V  IY LVA
    38   34 L H  E     -U   93   0H   0  207   81  ASHYHYS SSSHF S  S HY   NFSNSRGQ HH SSSS RQSG  S        AHSS S  HG SQY
    39   35 L W  E     -UV  92  52H   0  207    0  WWWWWWW WWWWW W  W WW   WWWWWWWW WW WWWW WWWW  W        WWWW W  WW WWW
    40   36 L Y  E     -UV  91  50H   0  207   13  FYYFYYY YYYYY Y  Y YY   YYYYYYYY YY YYYY LYYY  Y        YYYY Y  YY YHY
    41   37 L Q  E     -UV  90  49H   4  207   25  QQQQQQQ QQQQQ Q  R QQ   QQQQQQQQ QQ QQQQ QQLQ  Q        QQQQ Q  QQ QQQ
    42   38 L Q  E     -U   89   0H  16  207   13  QQQQQQQ QQQQQ Q  Q QQ   QQQQQQQQ QQ QQQQ QQQQ  L        QQQQ Q  QQ QQQ
    43   39 L K    >   -     0   0   47  207   59  IIKKKKK KKKKK K  H KK   YKTVIKVH KK HKKK KMKV  I        KMHH R  KK KLK
    44   40 L P  T 3  S+     0   0   81  207   39  PPPPPSP DAAPS P  P TS   MSPPPPPP PP PAAA sLPP  P        PLPP P  Ps APP
    45   41 L G  T 3  S+     0   0   58  206   20  GGGGGGG GGGGG G  G DG   GGGGGGGG GG GGGG sPGG  G        GPGG G  Gg GRS
    46   42 L Q  S <  S-     0   0  103  207   70  SSQQQQL KEESQ Q  K QQ   RQQSSQSS QQ QEEE ASES  S        ESSS T  QS EKQ
    47   43 L P        -     0   0   34  207   58  AAASATA SRRAA A  A AT   SPAGAGGA AA VRRR PAAG  A        AAAA A  AV RAA
    48   44 L P        -     0   0    5  207   20  PPPPPPP PPPPP P  P PP   PPPLPPLP PP PPPP RPPL  P        PPPP P  PP PPP
    49   45 L K  E     -V   41   0H  96  207   71  KRLVVVV KKKLV V  K VV   TKRKRVRK VV VKKK YRKR  R        KRKK K  VV KEL
    50   46 L V  E     +V   40   0H  10  207   43  TTLLLLL LLLLL L  L LL   NLTTTSTL LL LLLL LLLT  T        LLLL L  LT LLL
    51   47 L L  E     +     0   0H   2  207   26  LLIIVIL LLLVV V  M VV   MLLILVIV AA VLLL LILI  L        LIMM L  AV LLI
    52   48 L I  E     -VW  39  58H   0  207   24  IIIIIII IIIII I  I VI   IIIIIIII II IIII WIII  I        IIII I  II III
    53   49 L Y  E  >  + W   0  57H  54  207   35  YYYYYYY YYYYY Y  Y HY   YKYYYYYY CC YYYY YYYY  Y        YYYY Y  CY YYY
    54   50 L I  T >4 S-     0   0   10  207   91  GNNEDER WDDSE A  D DD   GLYENKGG NN KDDD rVYS  G        YSDD S  NY RDG
    55   51 L A  T 34 S+     0   0    2  207   75  DSDDNDD AAADD K  V DD   DVTDGDSN SS NAAA eDTS  D        ADVV D  SN AND
    56   52 L S  T 34 S+     0   0   73  207   57  TNNSSSS STTSS D  N NT   DSNKNSSN NN STTT KSTS  T        TDSS S  NN TYS
    57   53 L N  E <<  -W   53   0H  77  205   73  KKSKNKK TTTNK N  K DE   LTAYKESN SS NTTT HNVS  S        TNSS E  SN TKN
    58   54 L L  E     -W   52   0H  63  207   64  RRQRRRW RLLRR R  R RR   RRRRRRRR RR RLLL QRLR  R        RRRR R  RR LRR
    59   55 L E    >   -     0   0   49  207   82  APPPPPP QYYPP P  P PP   PESPPPPP PP PYYY GPQP  A        YPPP P  PP YPP
    60   56 L S  T 3  S+     0   0  107  207   43  SSSSSSS STTSS S  S SS   SSYSSSSS SS STTT SDSS  S        SDSS S  SS TSS
    61   57 L G  T 3  S+     0   0   67  207   15  GGGGGGG GGGGG G  G GG   GGGGGGGG GG GGGG GGGG  G        NGGG G  GN GGG
    62   58 L V    <   -     0   0   17  207   42  VVIIIII ITTII V  V II   VTVVVIVV TT ITTT VITV  V        TIVV I  TI TVI
    63   59 L P    >   -     0   0   62  207   24  PPPPSPP PPPPP P  P PP   SPPPPPPS PP PPPP PPAP  P        PPSS P  PP PPP
    64   60 L A  T 3  S+     0   0   99  207   57  DDEEEED SAADE D  D EE   DADDDDDN DD EAAA AESD  D        SENN D  DS ADE
    65   61 L R  T 3  S+     0   0   30  207    7  RRRRRRR RRRRR R  R RR   RRRRRRRR RR QRRR RRRR  R        RRRR R  RR RRR
    66   62 L F  E <   -S   79   0G   7  207    2  FFFFFFF FFFFF F  F FF   FFFFFFFF FF FFFF FFFF  F        FFFF F  FF FFF
    67   63 L S  E     -S   78   0G  59  207   17  SSSSSSS TSSSS S  S SS   SSSSSSSS SS SSSS SSSS  S        SSSS S  SS SSS
    68   64 L G  E     +S   77   0G  17  207    7  GGGGGGG GGGGG G  G GG   gGGGGGGG GG GGGG gGGG  G        GGGG G  GG GGG
    69   65 L S  E     +S   76   0G  48  207   40  STTSSSS SHHAS S  S SS   dSSSTSSS SS SHHH dTSS  S        GKSS S  SS HST
    70   66 L G  E     -S   75   0G  35  207   76  RKNSNSN GQQNS G  K NS   SGIKKSKK NN NQQQ GNGK  R        GNKK S  NK QKN
    71   67 L S  E >   +S   74   0G  68  206   22  SSSSSSS SSSSS S  S SS   SSLSSSSS SS SSSS SSSS  S        SSSS S  SS SSS
    72   68 L R  T 3  S-     0   0  163  206   33  GGGGGGG NSSGG G  G GG   SSGGGGGG GG GSSS KGNG  G        RGGG G  GG SGG
    73   69 L T  T 3  S+     0   0   51  206   59  NNSTNTN STTNT N  N NT   NSNNNKNN NN NTTT DNSN  N        TNNN K  NS TNN
    74   70 L D  E <   +RS  24  71G  77  206   64  TTTVTMT DTTTM T  T TV   SDKTTTTT TT TTTT ITDT  T        DTTT T  TT TST
    75   71 L F  E     -RS  23  70G   0  206   82  AGAAAAA FFFAA A  A AA   AFAAGVAA AA AFFF FAFA  A        FAAA N  AG FAA
    76   72 L T  E     -RS  22  69G  33  206   58  TTTTTTT TTTTT S  S TT   FTATTTTS TT TTTT YSTT  T        TSSS T  TT TTT
    77   73 L L  E     -RS  21  68G   0  206    3  LLLLLLL LMMLL L  L LL   LLLLLLLL LL LMMM LLLL  L        LLLL L  LL MLL
    78   74 L T  E     -RS  20  67G  28  206   44  TTTTTTT TTTTT T  T ST   TTTTTTTT TT TTTT TEST  T        SETT T  TT TTT
    79   75 L I  E     -RS  19  66G   0  206    3  IIIIIII IIIII I  I IL   IIIIIIII II IIII IIII  I        IIII I  II III
    80   76 L D  S    S+     0   0   68  206   39  IASSSSS STTTS T  S SS   QSTNASSS SS STTT SSSS  S        SSSS S  ST TAS
    81   77 L P  S    S-     0   0   51  206   60  SSEGGGR GGGGG G  G RG   NGGSSGSG RR NGGG SGGS  S        GGGG G  RG GGG
    82   78 L V        +     0   0    0  206   50  LLAAVTA IVVVA A  L VA   VVALLALL VV TVVV VAVL  L        VALL V  VV VLA
    83   79 L E    >   -     0   0   93  206   33  QQQQEQQ QQQQQ Q  Q EQ   QQQQQQQQ QQ QQQQ EQQQ  Q        QQQQ L  QQ QQQ
    84   80 L A  G >  S+     0   0   22  206   52  AATVAVA APPAV A  A PV   ATAAATAA AA APPP AATA  P        TAAA A  AA PAA
    85   81 L D  G 3  S+     0   0   58  206   27  DENEGEG EEEQE E  E GE   DEDEEEEE EE LEEE EGEE  E        EGEE E  EE EEE
    86   82 L D  G <   +     0   0    1  206    0  DDDDDDD DDDDD D  D DD   DDDDDDDD DD DDDD DDDD  D        DDDD D  DD DDD
    87   83 L A    <   +     0   0   12  206   78  EEEEEEE AFFEE E  E EE   EAEEEEEE EE EFFF EEAE  E        AEED E  EE FEE
    88   84 L A  E    S- X   0 108H   8  206   19  AAAAAAA AAAAG A  A AA   AASAAAAA AA AAAA AAGA  A        GAAA A  AA AAA
    89   85 L T  E     -UX  42 107H  35  207   69  DDDDDDD VDDDD D  D DD   DVDDDDDD DD NDDD DDHD  D        DDGD D  DV DDD
    90   86 L Y  E     -UX  41 106H   0  207    5  YYYYYYY YYYYY Y  Y YY   YYYYYYYY YY TYYY YYYY  Y        YYCY Y  YY YYY
    91   87 L Y  E     -U   40   0H   9  207    7  FYYYYYY YYYYY Y  Y FY   YYYFYYFY YY VYYY YYYF  F        YYYY Y  YY SYY
    92   88 L a  E     -U   39   0H   0  207    4  CCCCCCC CCCCC C  C CC   CCCCCCCC CC RCCC CCCC  C        CCCC C  CC CCC
    93   89 L Q  E     -UY  38 102H   1  207   79  AAQYQYQ QMMQY N  C QY   QQVAAQAS QQ RMMM AQQV  A        QQSS Q  QG MSQ
    94   90 L Q  E     +UY  37 101H   0  207   84  asVsVSL sGGys S  S VS   SsVassAS sI gGGG EVSA  s        sVSS S  sN GAs
    95   91 L N        +     0   0    0  185   59  ..W.W.F yYYv. .  Y W.   YhFy..YY .W lYYY WWYY  e        y.YY W  .A YW.
    96   92 L N  S    S+     0   0    1  190   79  ..p.dat iQqa. r  a ds   snlS..dt .d hqQq ddhd  d        pdkk d  .d qd.
    97   93 L E  S    S-     0   0   48  189   80  dsqhdhs lSscg h  t qh   gag.faah sk ssS. nant  a        lgvt t  sg ssg
    98   94 L D  S    S+     0   0   42  192   76  NLCsvWl WsshY L  F LW   IWIvFVVs AF Lss. VVVV  V        WMVF l  sI sll
    99   95 L P  S    S-     0   0   26  108   72  .C.ct.c .npv. .  . ..   .V.t...p P. Cpns ....  .        ...V c  a. sgc
   100   96 L P        -     0   0    4  141   88  AAWVV.Y WPNYP .  G W.   RVSA...G VY YYPN W.F.  .        YV.V F  A. TIY
   101   97 L T  E     -Y   94   0H  26  181   65  VVVLCVV TTTVV V  V MV   VTVVV..S AS ITGT VYT.  .        TYFF V  H. TVV
   102   98 L F  E     -Y   93   0H  26  205    9  FFFFCFF FFFFF F  F FF   FFFFFFFW WI FFFF FFFF  F        FFWW F  SF FFF
   103   99 L G        -     0   0    3  207   13  GGGGGGG GGGGG G  G GG   GGGGGGGG VG GGGG GGGG  G        GGGG G  DG GGG
   104  100 L A        -     0   0   81  207   63  SSEGGEG GKKGG T  G GG   GGGGSSST GS AKKK KGGS  S        GGII G  TS KGG
   105  101 L G        -     0   0   12  207   10  GGGGGGG GGGGG G  G GG   GGGGGGGE GG GGGG GGGG  G        GGEE G  GG GGG
   106  102 L T  E     - X   0  90H   0  207   10  TTTTTTT TTTTT T  T TT   TTTTTTTT LL TTTT TTTT  T        TTTT T  RT TTT
   107  103 L K  E     -tX  10  89H  74  207   54  TTQRTKQ REEQK K  K KK   KKKTTTTK RS REEE KQKT  T        KQKN Q  WT EQQ
   108  104 L L  E     +tX  11  88H   2  206   19  LLLLLLL LLLLV V  L LL   LLVLLLLT LF LLLL LLLL  L        LLLL L  IL LVL
   109  105 L E  E     -t   12   0H  14  207   67  TTTTTTT EVVTT T  T TT   TVTTTTTA AS TVVV YTDT  T        LTAP T  TT VTT
   110  106 L M  E     -t   13   0H   0  207   27  VVVVVIV VLLVV V  V VV   VVVVVVVL DV VLLL VVVV  V        IVLL V  EV LVV
   111  107 L R  E     +t   14   0H 126  207   85  LLLLLLT DNNLL L  L LL   LDLLLLLG ML LNNN QLGL  L        SLGA L  LL NLL
   112  108 L R        -     0   0   64  207   79  GGGGGGG LRRGG G  G RG   SLGGGGGQ ga GRRR KTTG  G        tTQQ G  GG RGG
   113  109 L A        -     0   0   71  198   67  QQQQQQQ GDDQQ Q  Q QQ   QGQQQQQ. hh QDDD SG.Q  Q        sG.. Q  HQ DQQ
   114  110 L D        -     0   0   58  203   71  ppppppp HVVpp p  p pp   pVpppppp ll pVVV SdVp  p        Pdpp p  lp Vpp
   115  111 L A  B     -A  144   0J  19  204   57  sssaavv VAAaa a  a aa   tVassssa aa aAAA SkSs  s        Vkaa s  av Ass
   116  112 L A        -     0   0   40  206   62  PPSATAT PKKSA N  A AA   SRAPPPPT SS SKKK VSPP  P        KSAA A  SA KAA
   117  113 L P        -     0   0    9  206    1  PPPPPPP PPPPP P  P PP   PPPPPPPP PP PPPP PPPP  P        PPPP P  PP PPP
   118  114 L T  E     -B  141   0K  85  206   55  SSLSSLS SVVTS T  S SS   STSSSSSS SS LVVV LSQS  S        SSSS S  ST VTS
   119  115 L V  E     -B  140   0K   8  206   18  VVVVVVV LLLVV V  V VV   VLVVVVVV II VLLL VVVV  V        VVVV V  II LVV
   120  116 L S  E     -B  139   0K  17  206   69  TTTTTTI TTSHT T  T TT   TTTTTTTT TT TTTT SSST  T        SSTT S  TT TTT
   121  117 L I  E     -B  138   0K  22  207   30  LLLLVLL VLLLL L  L LL   LVLLLLLV LL LLLL LIVL  L        LILL L  LL LLL
   122  118 L F  E     -B  137   0K   4  207    7  FFFFFFF LLLFF F  F FF   FLFFFFFF FF FLLL LFLF  F        LFFF F  FF LFF
   123  119 L P        -     0   0    5  207   23  PPPPPPP APPPP P  P PP   PPPPPPPP PP PPPP PPTP  P        GPPP P  PP PPP
   124  120 L P        -     0   0    1  207    4  PPPPPPP PPPPP P  P PP   PPPPPPPP PP PPPP PPPP  P        SPPP P  PP PPP
   125  121 L S    >>  -     0   0    8  207    4  SSSSSSS SSSSS S  S SS   SSSSSSSS SS SSSS SSSS  S        SSSS S  SS SSS
   126  122 L S  H 3> S+     0   0   78  207   65  TTSSSSS MTTSS S  S SS   SRSTTTTS SS STTT LEST  T        SESS A  SK TTS
   127  123 L E  H 3> S+     0   0   76  207   23  EEEEEEE EEEEE E  E EE   EEEEEEEE EE EEEE AEAE  E        LEEE E  EE EEE
   128  124 L Q  H <4>S+     0   0    8  207   27  EEEEEEE EEEEE E  E EE   EEEEEEEE EE EEEE EEEE  E        QEEE E  EE EEE
   129  125 L L  H ><5S+     0   0   29  207   22  LLLLLLL LIILL L  L LL   LLLLLLLL II LIII LIIL  L        SILL L  IL ILL
   130  126 L T  H 3<5S+     0   0  111  207   71  NNGQQQK QSSQQ Q  Q QQ   EQQNNNNQ QQ QSSS TASN  N        SAQQ N  QD SSA
   131  127 L S  T 3<5S-     0   0   83  207   67  GGAASAD QKKTA A  A AA   TQAGGGGS AA AKKK DTSG  G        GTAA N  AQ KNT
   132  128 L G  T < 5S+     0   0   34  207   53  NNNNNNN GGGkN N  N NN   NDNNNNNN NN NGGG kKkN  N        DKNN N  NN GNN
   133  129 L G  E   < - C   0 186K  21  205   60  KKKKKKK ETTkK K  K KK   KSKKKKKK KK KTTT rKaK  K        SKKK K  KK TKK
   134  130 L A  E     - C   0 185K   0  207   13  AAAAAAA AAAAA A  A AA   AAAAAAAA AA AAAA AAAA  A        AAAA A  AA AAA
   135  131 L S  E     - C   0 184K   2  207   38  TTTTTTT TTTTT T  T TT   TTTTTTTT TT TTTT TTTT  T        ATTT T  TT TTT
   136  132 L V  E     - C   0 183K   0  207   28  LLLLLLL LLLLL L  L LL   LLLLLLLL LL LLLL LLLL  L        LLLL L  LL LLL
   137  133 L V  E     -BC 122 182K   0  207   12  VVVVVVV MLLVV V  V VV   VVVVVVVV VV VLLL VVLV  V        LVVV V  VV LVV
   138  134 L b  E     -BC 121 181K   0  207    3  CCCCCCC CCCCC C  C CC   CCCCCCCC CC CCCC CCCC  C        CCCC C  CC CCC
   139  135 L F  E     -BC 120 180K   0  207   31  LLLLLLL VLLLL L  L LL   TVLLLLLL LL LLLL LSVL  L        LSLL L  LL LLL
   140  136 L L  E     -BC 119 179K   0  206   48  IIIIIII AAALI I  I II   IAIIIIII II IAAA VLAI  I        LLII M  II AMI
   141  137 L N  E     -B  118   0K   2  207   48  SSSSSSN NNNGS S  S SS   SSSSSSSS NN SNNN NSNS  S        SSSS S  NS NSS
   142  138 L N  E    S+     0   0K  49  207   47  DDDDDDD KHHSD D  D DD   DGDDDDDD DD DHHH NDKD  D        SDDD D  DD HDD
   143  139 L F  E     - C   0 177K   0  207   30  FFFFFFF GFFFF F  F FF   FGFFFFFF FF FFFF FFGF  F        YFFF F  FF FFF
   144  140 L Y  B    S+A  115   0J   9  206   40  YYYYYYY FFFYY Y  Y YY   YFYYYYYY YY YSFF STFY  Y        STYY Y  YY FYY
   145  141 L P  S    S-     0   0   18  207    7  PPPPPPP PPPPP P  P PP   PPPPPPPP PP PPPP PPPP  P        PPPP P  PP PPP
   146  142 L K  S    S+     0   0   83  206   75  GGSGGGR SNNGG G  G GG   GSGGGGGG GG GNNN GRSG  G        PRGG G  GS NGS
   147  143 L D        +     0   0  116  207   72  SSGAAAT DTTSA A  A AA   VAASSSSA TT VTTT SGDS  S        GGAA S  TP TAG
   148  144 L I        -     0   0   19  206   60  VVLVVVV WLLVV V  V VV   VWVVVVVV VV VLLL VAWV  V        AAVV V  VV LVV
   149  145 L N  E     -E  201   0L  82  207   67  TTKETTK TQQQT T  T TT   TRTTTTTT VV KQQQ ETRT  T        KTTT T  VT QTT
   150  146 L V  E     -E  200   0L  27  207   11  VVVVVVV LLLVV V  V VV   VLVVVVVV VV VLLL VVLV  V        VVVV V  VV LVV
   151  147 L K  E     -E  199   0L  53  207   75  VVAAEAN SVVTA A  A AA   DGAVVVVE AA AVVV TKVV  V        SKAA A  AE VAA
   152  148 L W  E     +E  198   0L   3  207    2  WWWWWWW WWWWW W  W WW   WWWWWWWW WW WWWW WWWW  W        WWWW W  WW WWW
   153  149 L K  E     +EF 197 158L  76  207   39  KKKKKKK KQQKK K  K KK   KKKKKKKK KK KQQQ TQKK  K        TQKK K  KL QKR
   154  150 L I  E    S-E  196   0L   0  207   67  AAAAAAA VKKAA A  A AA   AVAAAAAA EE AKKK VVVA  A        RVAA A  EV KED
   155  151 L D  S    S-     0   0   71  207   19  DDDDDDD EDDDD D  D DD   DGDDDDDD DD DDDD DDSD  D        DDDD N  DD DNG
   156  152 L G  S    S+     0   0   63  207   35  GGGGGGG EMMGS G  S SS   GGSGGGGG GG GMMM GGGG  G        GGGG G  GG MGS
   157  153 L S  S    S-     0   0   33  206   68  SSSSNSN SVVKS S  S SS   TSSSSSSN KK SVVV VKSS  S        SKNN T  KS VSP
   158  154 L E  B     -F  153   0L  85  206   78  TTTASPS RTTQP P  P PP   PSPTTTTS TT ATTT AEST  T        EESS P  TT TPV
   159  155 L R        -     0   0   69  207   77  IIIVVVV SVVIV V  V VV   VSVIIIIV II VVVV QKGI  I        LKVV V  IR VVT
   160  156 L Q        +     0   0  133  207   73  TTINRKT PTTSK K  K KK   TSKTTTTR TT NTTT RTGT  T        STRR T  TK TSQ
   161  157 L N  S    S+     0   0  117  207   69  RRQADAQ GDDTA A  A AA   QSARRRRD QQ ADDD SDQR  R        EDDD Q  QG DQG
   162  158 L G  S    S+     0   0   29  207   34  NNGGGGG VGGGG G  G GG   GGGNNNNG GG GGGG GGEN  N        GGGG G  GE GGV
   163  159 L V  E     -D  183   0K  46   65   74  ....... ..... .  . ..   ........ .. .... ..S.  .        F... .  .. ...
   164  160 L L  E     -D  182   0K  16  192   49  VVVVVVV .VVVV V  V VV   VVVVVVVV VV VVVV IV.V  V        .VVV V  V. VV.
   165  161 L N  E     +D  181   0K  52  196   54  EEEEEED .KKEE E  E EE   ESEEEEEE QQ EKKK QV.E  E        .VEE E  Q. KEE
   166  162 L S  E     -D  180   0K  12  204   50  TTTTTTT .TTTT T  T TT   THTTTTTT TT TTTT TSST  T        LSTT T  TT TTT
   167  163 L W  E     -D  179   0K  99  204   72  TTTTTTT .SSTT T  T TT   TSTTTTTT TT TSSS SSST  T        TSTT T  TT STT
   168  164 L T        -     0   0   24  204   69  RRKKKKQ .GGKT K  T TT   QLTRRRRK KK TGGG LGAR  R        SGKK K  KP GKK
   169  165 L D        -     0   0   99  204   75  AAPPPPP .SSPP P  P PP   PEPAAAAP PP PSSS ALGA  A        ALPP P  PA SPP
   170  166 L Q        -     0   0   18  206   75  SSSSSSS .VVSS S  S SS   SVSSSSSS SS SVVV QSLS  S        ESSS S  SQ VSS
   171  167 L D     >  -     0   0   48  206   62  KKKKKKK LTTKK K  K KK   KLKKKKKK KK KTTT KKLK  K        SKKK K  KR TKK
   172  168 L S  T  4 S+     0   0   54  206   61  QQQQQQQ QGGQQ Q  Q QQ   QGQQQQQQ QQ QGGG QQEQ  Q        QQQQ Q  QQ GQQ
   173  169 L K  T  4 S+     0   0  180  206   55  SSSSSSS KSSSS S  S SS   NRSSSSSS SS SSSS NSKS  S        QSSS S  SS SSS
   174  170 L D  T  4 S-     0   0   57  206   36  NNNNNNN DDDDN N  N NN   NDNNNNNN NN NDDD EDDN  N        DDNN N  NN DNN
   175  171 L S     <  +     0   0    4  206   54  SSNNNNN GHHNN N  N NN   NGNSSSSN NN NHHH NSGS  S        GSNN N  NS HNN
   176  172 L T        -     0   0    5  206   71  KKKKKKK LSSKK K  K KK   KHKKKKKK KK KSSS TLLK  K        RLKK K  KQ SKK
   177  173 L Y  E     -C  143   0K   7  204    1  YYYYYYY YYYYY Y  Y YY   YYYYYYYY YY EYYY YYYY  Y        YYYY Y  YY YYY
   178  174 L S  E     -     0   0K   1  205   68  AATAAAA SSSMA A  A AA   MSAAAAAA AA ASSS SMSA  A        SMAA A  AM SVA
   179  175 L M  E     -CD 140 167K   0  206   80  AAAAAAA WVVAA A  A AA   AWAAAAAA AA AVVV VEWA  A        CEAA A  AA VAA
   180  176 L S  E     -CD 139 166K   3  206    3  SSSSSSS SSSSS S  S SS   SSSSSSSS SS SSSS SSSS  S        TSSS S  SS SSS
   181  177 L S  E     -CD 138 165K   0  206    0  SSSSSSS SSSSS S  S SS   SSSSSSSS SS SSSS SSSS  S        SSSS S  SS SSS
   182  178 L T  E     -CD 137 164K   2  206   71  YYYYYYF TTTYY Y  Y YY   YTYYYYYY YY YTTT FYSY  Y        VYYY Y  YY TYY
   183  179 L L  E     -CD 136 163K   0  206    0  LLLLLLL LLLLL L  L LL   LLLLLLLL LL LLLL LLLL  L        LLLL L  LL LLL
   184  180 L T  E     +C  135   0K  36  206   53  SSSSSSS RTTSS S  S SS   TSSSSSSS TT STTT TSTS  S        KSSS S  TS TSS
   185  181 L L  E     -C  134   0K  16  206    9  LLLLLLL LLLLL L  L LL   LLLLLLLL LL RLLL LLLL  L        LLLL V  LL LML
   186  182 L T  E  >  -C  133   0K  81  205   54  TTTTTTS PPPDT T  T TT   TPTTTTTT TT TPPP PTST  T        KTTT S  TT PSS
   187  183 L K  H >> S+     0   0   66  204   67  SSPSPPA AAAAP P  P PP   AAPSSSSP PP SAAA VSES  S        RSPP S  PA AAL
   188  184 L D  H 3> S+     0   0  109  205   63  SSDDQEN DQQSE E  E EE   KDESSSSQ AA DQQQ LDQS  S        EDQQ Q  AS QSD
   189  185 L E  H >4 S+     0   0   53  205   48  DDKQQQQ QVVKQ Q  Q QQ   AQQDDDDQ QQ QVVV EEQD  D        EEQQ D  QD VKK
   190  186 L Y  H X< S+     0   0    6  205   12  WWWWWWW WWWWW W  W WW   WWWWWWWW WW WWWW WWWW  W        WWWW W  WW WWW
   191  187 L E  H 3< S+     0   0   90  205   71  KKKKKKK EAATR K  K KK   ERKKKKKK KK KAAA NLMK  K        ELKK K  KS AKQ
   192  188 L R  T << S+     0   0  160  205   58  SSSSSSS KSSSS S  S SS   TKSSSSSS SS SSSS SKES  S        KKSS S  SS SSS
   193  189 L H    <   -     0   0   24  203   55  KKHHRHY  DDHH H  H HH   HAHKKKKR HH HDDD KHSK  K        RHRR A  HH DAH
   194  190 L N  S    S+     0   0   97  203   71  GGSKSRQ  AADK R  K KR   SGRGGGGS NN KAAA NDVG  G        EDSS S  NE ASS
   195  191 L S  E     + G   0 214L  37  203   71  SSSSSSS  RRTS S  S SS   SSSSSSSS SS SRRR ILSS  S        RLSS A  ST RQS
   196  192 L Y  E     +EG 154 213L   0  203   15  YYFYYYV  FFYY Y  Y YY   YVYYYYYY YY YFFF YYVY  Y        YYYY Y  YY FYF
   197  193 L T  E     -EG 153 212L   3  203   48  SSSSSST  SSTS S  S SS   SSSSSSSS SS SSSS TSSS  S        ASSS S  ST SSS
   198  194 L b  E     -EG 152 211L   1  203    0  CCCCCCC  CCCC C  C CC   CCCCCCCC CC CCCC CCCC  C        CCCC C  CC CCC
   199  195 L E  E     -EG 151 210L  34  203   61  EELQHQQ  VVQQ Q  Q QQ   QEQEEEEH QQ QVVV EKEE  E        RKHH Q  QR VHL
   200  196 L A  E     -EG 150 209L   1  203   23  VVVVVVV  VVVV V  V VV   VAVVVVVV VV VVVV VVAV  V        VVVV V  VV VVV
   201  197 L T  E     +E  149   0L  36  203   31  TTTTTTT  TTTT T  T TT   TSTTTTTT TT ATTT KTTT  T        TTTT T  TT TTT
   202  198 L H  E >   - G   0 205L  18  203   19  HHHHHHH  HHHH H  H HH   HLHHHHHH HH HHHH HHRH  H        HHHH H  HH HHH
   203  199 L K  T 3  S+     0   0  145  202   55  EEQEEEE  EEDE E  E EE   ENEEEEEE EE EEEE QQSE  E        AQEE D  ED EDE
   204  200 L T  T 3  S+     0   0   55  202   40  GGGGGGG  SSGG G  G GG   GGGGGGGG GG GSSS NGGG  G        GGGG G  GG SVG
   205  201 L S  E <   -G  202   0L  45  180   82  SSSSKSH  LLKS S  S SS   HQSSSSSK SS SLLL   QS  S        G KK K  ST LSN
   206  202 L T  E    S+     0   0L 140  180   32  TTTTTTT  TTTT T  T TT   TSTTTTTT TT TMTT   PT  T        D TT T  TA TTT
   207  203 L S  E    S-     0   0L  82   83   48           GG              P           GGG   A            Q          G  
   208  204 L P  E     -     0   0L  43   67   33           PP                          PPP                E          P  
   209  205 L I  E     -G  200   0L  46   67   29           LL                          LLL                I          L  
   210  206 L V  E     +G  199   0L  70   63   53           TT                          TTT                           T  
   211  207 L K  E     +G  198   0L  85   63   26           QQ                          QQQ                           Q  
   212  208 L S  E     -G  197   0L  67   63   28           TT                          TTT                           T  
   213  209 L F  E     -G  196   0L  30   63   18           II                          III                           I  
   214  210 L N  E      G  195   0L  99   63   62           RR                          RRR                           R  
   215  211 L R              0   0   82   54   19                                                                        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  192   30               D QQ E  QEQ        E  Q    E    QQ DDQEQEDQ    E         
   218    2 H V        +     0   0   30  194   40               V VI A  EVV        V  V    V    VV VVVQVVVV    V         
   219    3 H K  E     -A  241   0A 143  197   48               Q QT Q  QHH        Q  Q    Q    QQ KQQQQKKT    Q         
   220    4 H L  E     -A  240   0A  11  217    3         L     L LL V  LLL        L  L    L    LL LLLLLLLV    L LL  L   
   221    5 H Q  E     -A  239   0A 120  217   73         T     A LD V  EVV        V  Q    V    QQ VAVVQVVS    V TT  T   
   222    6 H E  E     -A  238   0A   2  218   33         Q     Q QQ E  QEQ        E  E    E    QQ EQQQQEEL    E QQ  Q   
   223    7 H S  E     +A  237   0A  48  218   13         S     S SP S  SSS        S  S    S    PP SSSSPSSS    S SS  S   
   224    8 H G        -     0   0   35  218   20         E     E GG G  GGG        G  G    G    GG GEGAGGGV    G EE  E   
   225    9 H P        -     0   0   50  218   49         A     P AS G  AGA        G  P    G    AA GSAGAGGP    G AA  P   
   226   10 H A  S    S+     0   0   30  218   51         V     V ET G  EGE        G  G    G    EE GVEGEGGE    G VV  V   
   227   11 H V  E     -d  334   0B  33  218   25         I     V VL L  VLL        L  L    L    LL LVVLLLLL    L II  V   
   228   12 H I  E     -d  335   0B   9  218   54         K     I KV V  TVK        V  V    V    VV VIKVVVVV    V KK  K   
   229   13 H K        -     0   0  104  218   50         R     K TK Q  KKM        Q  K    Q    RK QKKQKQKK    Q RR  R   
   230   14 H P  S    S+     0   0   56  218    9         P     P PP P  PPP        P  P    P    PP PPPPPPPP    P PP  P   
   231   15 H S  S    S+     0   0   90  218   20         E     G GS G  GGG        G  S    G    GG GGGGGGGS    G EE  G   
   232   16 H Q  S    S-     0   0   76  218   59         E     G AD G  AGS        G  Q    N    TV RGAGATGE    G EE  E   
   233   17 H S        -     0   0   51  217   20         S     S ST S  SSS        S  T    S    SS SSSSSSST    S SS  S   
   234   18 H L  E     - B   0 300A   1  217   43         H     H VL L  VLV        L  L    L    VV LHVLVLLL    L HH  H   
   235   19 H S  E     - B   0 299A  64  218   51         R     K KK R  KKK        R  S    R    KK KKKRKTRR    R RR  T   
   236   20 H L  E     - B   0 298A   1  218   13         L     L LI L  VLV        L  L    L    LM LLVLLLLL    L LL  L   
   237   21 H T  E     -AB 223 297A  29  218   33         T     S SA S  SSS        S  T    S    SS SSSSSSSA    S TT  T   
   238   22 H c  E     -AB 222 296A   0  219    1         C     C CC C  CCC        C  C    C    CC CCCCCCCC    C CC  C   
   239   23 H I  E     -AB 221 295A  54  217   75         T     T K. A  KVK        A  A    V    KK ATKSKAAK    A TT  S   
   240   24 H V  E     -A  220   0A   4  217   51         T     A P. A  AVA        A  I    A    AA AAAAATAV    A TT  A   
   241   25 H S  E     +A  219   0A  60  218    9         S     S S. S  SSS        S  S    S    SS SSSSSSSS    S SS  S   
   242   26 H G  S    S+     0   0   54  218    3         G     G GK G  GGA        G  G    G    GG GGGGGGGg    G GG  G   
   243   27 H F  S    S-     0   0   37  199   23         F     F NL F  YFN        F  D    F    FY F.YFYFFi    F ..  F   
   244   28 H S    >   -     0   0   44  200   45         T     T TS P  TSM        T  S    T    ST T.TTTTIT    T ..  T   
   245   29 H I  T 3  S+     0   0    2   56   45         .     . .V .  ...        F  V    .    .. .F.....D    . FF  .   
   246   30 H T  T 3   +     0   0   59   61   59         .     . .S .  ...        S  S    .    .. .T.....G    . TT  .   
   247   31 H R  S X  S-     0   0  145  218   53         F     F VV F  FFF        S  S    F    FF FFFFFFFS    F FF  F   
   248   32 H T  T 3  S+     0   0   72  204   59         R     S NS S  ITR        .  N    D    TT SSSETTSK    S SS  S   
   249   33 H N  T 3  S+     0   0   16  204   62         S     S IS S  ASS        .  S    D    SS DSDNSENI    S SS  D   
   250   34 H Y  E <   -E  317   0C  23  220   46         Y     Y YY F  YYY        Y  A    Y    YY YYHHYYSH    Y YY  Y   
   251   35 H d  E     -EF 316 270C   0  218   89         E     A AY W  DDA        A  T    A    WW GYSAWYYA    A WY  G   
   252   35AH W  E     -EF 315 269C   1  218   43         M     M LW M  IMF        M  W    M    MI MMIMMMMV    M MM  M   
   253   35BH H  E     -EF 314 268C   0  219   73         N     S HT T  NST        D  N    S    NN ANTHHSSD    G HN  H   
   254   36 H W  E     +EF 313 267C   1  221    2         W     W WW W  WWW        W  W    W    WW WWWWWWWF    W WW  W   
   255   37 H I  E     -EF 312 265C   0  221   15         I     V LV V  VVV        V  I    V    VV VVLVVVVI    V II  V   
   256   38 H R  E     -EF 311 264C  10  221   15         R     R RR R  RRR        R  R    R    KR RRRRKRRR    R RR  R   
   257   39 H Q  E     -EF 310 263C  22  220    2         Q     Q QQ Q  QQQ        Q  Q    Q    QQ QQQQQQQQ    Q QQ  Q   
   258   40 H A    >   -     0   0   14  220   61         A     A AT A  ATA        A  S    A    RR AAAVRPTF    A AA  V   
   259   41 H P  T 3  S+     0   0   99  221   19         P     P PP P  PPP        P  P    P    PP PPPPPPPS    P PP  P   
   260   42 H G  T 3  S+     0   0   94  221   12         G     G GG G  GEG        G  S    G    GG GGGGGGEG    G GG  G   
   261   43 H K  S <  S-     0   0  140  221   34         K     K HK K  QRQ        K  R    K    QQ KKQKRRKS    K KK  K   
   262   44 H G        -     0   0   20  221   24         G     G GG G  GRG        G  G    G    GG GGGRGARR    G GG  G   
   263   45 H L  E     -F  257   0C  10  221    9         L     L PL L  LLL        L  L    L    LL PLLLLLLF    L LL  L   
   264   46 H E  E     -F  256   0C  79  221    9         E     Q EE E  EEQ        E  E    E    EE EQEEEEEE    E EE  E   
   265   47 H W  E     +F  255   0C  13  221    9         W     W WY W  WWW        W  W    W    WW CWWWWWWF    W WW  W   
   266   48 H M  E     -     0   0C   3  221   31         I     V MM V  MVM        V  L    V    II VLIVILVL    V II  I   
   267   49 H G  E     -FG 254 277C   0  221   42         A     S TG A  GAG        G  G    S    GG ACGSGGAA    S AA  A   
   268   50 H R  E     -FG 253 276C  10  221   93         F     A WR S  WAG        F  R    Y    MD FQWGRFTH    T YI  Y   
   269   51 H I  E     -FG 252 275C   3  221   16         I     I LI I  MII        I  T    I    II IIIIIIII    I II  I   
   270   52 H d  E >   -F  251   0C   0  221   83         S     S NT N  NTI        R  Y    N    HY SNSDDRSN    Y GH  Y   
   271   53 H Y  T 3  S+     0   0   47  221   84         t     D vS K  PsP        n  y    K    pP nPaWPnNy    n tp  S   
   272   54 H E  T 3  S-     0   0   63  207   63         s     g nS d  q.n        n  k    n    dg ydsnnnsq    . ss  s   
   273   55 H G  S <  S+     0   0   25  200   53         S     g GG r  ggg        g  W    d    Sg .gGggyy.    g SS  s   
   274   56 H S        -     0   0   42  217   74         P     S NV D  NNA        T  Y    T    EM NSQDGTAG    S PP  S   
   275   57 H I  E     -G  269   0C  71  220   53         I     T MT S  TTP        A  N    T    TT ITTATPTT    T II  Q   
   276   58 H Y  E     -G  268   0C  70  221   79         Y     Y ME Y  EYN        E  D    Y    RN YYYGKEHA    Y YY  Y   
   277   59 H Y  E     -G  267   0C  41  221   17         Y     Y SH Y  FYY        Y  Y    N    LY YYYYYYYL    Y YY  Y   
   278   60 H S    >>  -     0   0   11  221   61         S     A ST V  APA        A  A    A    NN AAAANSPN    A SS  S   
   279   61 H P  T 34 S+     0   0   76  221   51         P     D HS E  QDQ        A  Q    N    QD DDQDEADS    D PP  E   
   280   62 H S  T 34 S+     0   0   79  221   52         S     S YS S  KNN        S  S    S    RK TSNSKSSA    S SS  S   
   281   63 H I  T X4 S+     0   0    4  221   40         V     V FF V  FVF        V  V    V    FF VVLVFVML    V VV  V   
   282   64 H K  G >< S+     0   0  133  221   28         K     K RQ K  QKQ        K  Q    K    KK TKQKKQKK    K KK  K   
   283   65 H S  G 3  S+     0   0  116  221   27         G     G PN G  GGD        G  N    G    DT GGGGSGGS    G GG  G   
   284   66 H R  G <  S+     0   0   51  221   18         R     R RR R  RRR        R  R    R    KK RRRRKRRR    R RR  R   
   285   67 H S  E <   -C  300   0A  11  221   54         F     F LV F  LFV        F  I    F    AA FFVFAFFL    F FF  F   
   286   68 H T  E     -C  299   0A  67  221   23         T     T TT T  TTT        T  S    T    ST TTTTTTTT    T TT  I   
   287   69 H I  E     +C  298   0A   3  221   29         I     I VL I  FVI        I  I    I    LL IIMILIIL    I II  I   
   288   70 H S  E     -C  297   0A  56  221   37         S     S TT S  SSS        S  N    S    TT SSTSTSSS    S SS  S   
   289   71 H R  E     -C  296   0A  71  221   60         R     R RR R  RRA        R  P    R    VL RRTRVRRR    R RR  R   
   290   72 H D  E >>> -C  295   0A  55  221   10         D     D DD D  DDD        D  D    D    DD DDDDDDDD    D DD  D   
   291   73 H T  T 345S+     0   0   78  220   57         D     N AA N  TND        D  T    N    TT NNTNKNNT    N DN  N   
   292   74 H S  T 345S+     0   0  105  220   44         S     N SA A  SAS        S  S    A    ST ANSSPSAA    A SP  N   
   293   75 H L  T <45S-     0   0  103  217   69         S     N AK E  IKT        K  K    K    SS KNTKSQQR    K SS  R   
   294   76 H N  T  <5 +     0   0   29  218   47         S     N NN T  NYT        N  N    N    NS NNSKSNNN    N SS  A   
   295   77 H K  E   < -BC 239 290A  51  221   70         K     K TE S  TTT        S  Q    T    VT TKTSTITE    S KK  Q   
   296   78 H F  E     -BC 238 289A   1  221   60         L     L VI L  ALV        L  F    L    VA LLALALVA    L LL  L   
   297   79 H F  E     -BC 237 288A  50  221   32         Y     Y YY Y  YYY        Y  S    Y    YY YYYYYYLY    Y YY  N   
   298   80 H I  E     -BC 236 287A   4  221    5         L     L ML L  MLM        L  L    L    MM LLMLMLLL    L LL  L   
   299   81 H Q  E     -BC 235 286A  73  221   35         Q     Q EA Q  VQE        Q  Q    Q    QQ QQEQQQQE    Q QQ  Q   
   300   82 H L  E     -BC 234 285A   3  221   19         M     M LL M  LML        M  L    M    LL MMLMLMMF    M MM  M   
   301   82AH I        +     0   0   70  221   58         N     N TS G  SST        N  N    N    SS SNRSSNTR    N NN  N   
   302   82BH S  S    S-     0   0   59  221   33         S     N SS S  SSS        R  S    N    SS SNSSSTSG    S SS  S   
   303   82CH V        -     0   0    0  221   13         L     L LM L  LLL        L  V    L    PL LLLLLLLM    L LL  L   
   304   83 H T    >   -     0   0   65  221   63         K     Q TR R  SKT        K  T    R    TT RQRRTRNT    R KK  K   
   305   84 H N  G >  S+     0   0  120  221   62         T     T SS A  TSF        T  P    V    SS STSPSASA    A TT  T   
   306   85 H E  G 3  S+     0   0  160  221   21         E     E EE E  EEE        E  E    E    EE EEDDEEEE    E EE  E   
   307   86 H D  G <  S+     0   0    0  221    1         D     D DD D  DDD        D  D    D    DD DDDDDDDD    D DD  D   
   308   87 H T    <   +     0   0   30  221   36         S     T TS T  STT        A  M    T    SS TTTSSSTT    T SS  S   
   309   88 H A  E    S- H   0 333C   3  221    5         A     A AG A  AAA        A  A    A    AA AAAAAAAA    A AA  A   
   310   89 H M  E     -EH 257 332C  43  221   61         V     V VT V  IMF        M  V    M    VV LVVFVTVM    V VV  V   
   311   90 H Y  E     -EH 256 331C   2  221    0         Y     Y YY Y  YYY        Y  Y    Y    YY YYYYYYYY    Y YY  Y   
   312   91 H Y  E     -E  255   0C   1  221    3         Y     Y FY Y  FYY        Y  Y    Y    YY YYYFYYYY    Y YY  Y   
   313   92 H c  E     +E  254   0C   0  221    1         C     C CC C  CCC        C  C    C    CC CCCCCCCC    C CC  C   
   314   93 H S  E     -EI 253 327C   0  221   30         A     A AG A  AVG        A  A    A    AS AAAATATA    A AA  A   
   315   94 H R  E     -EI 252 326C  20  220   39         R     R SS R  RRR        G  R    K    RR RSKRRRRK    R RR  R   
   316   95 H E  E     -EI 251 324C   0  220   75         D     H EG K  GPG        D  D    V    RA HQDDEAGD    D DD  W   
   317   96 H N  E  >> -E  250   0C   6  220   89         T     G RV F  NEL        T  T    A    NG KQQTGYDY    T AP  I   
   318   97 H H  T  45S+     0   0    0  220   93         Q     G GG M  LIT        V  V    G    NS LYSVDSYS    V HH  R   
   319   98 H M  T  45S+     0   0   73  221   94         V     G GL F  RPY        R  R    S    PN RAYSYNWG    G DD  L   
   320   99 H Y  T  45S+     0   0  159  221   92         Y     S LD D  GIY        G  G    N    YY LSTGDYYG    A DG  N   
   321  100 H E  T  <5 -     0   0   54  221   92         H     W FY S  GYG        A  S    N    YA YGTWAYFN    S YA  G   
   322  100AH T      < +     0   0    0  221   92         S     Y DW W  RYS        Q  Q    W    YF VYIMMFDY    C FF  T   
   323  100BH Y  S    S-     0   0   10  221   92         V     F VG S  GYG        C  C    Y    AA MSPDDDVA    P DD  T   
   324  100CH F  E     +I  316   0C   0  221   93         g     E WQ s  fss        e  d    q    LM DwnwYNWF    d YY  F   
   325  101 H D  E     +     0   0C  42  133   50         d     . .. d  ddq        g  d    e    DD .dhd...D    s ..  D   
   326  102 H V  E     -I  315   0C  35  153   74         Y     H .. L  PSH        A  V    Y    YY YYIL...Y    G ..  V   
   327  103 H W  E     -I  314   0C  28  177   14         W     W .. W  WWW        R  W    W    WW WWWWWW.W    W WW  W   
   328  104 H G        -     0   0    3  204   16         G     G G. G  GGG        g  G    G    GG GGGGGGGG    S GG  G   
   329  105 H Q        -     0   0  100  183   48         Q     Q P. R  HQQ        q  P    Q    QQ QAQRQQAP    . KK  N   
   330  106 H G        -     0   0    3  191    7         G     G GG G  GGG        G  G    G    GG GGGGGGGG    . GG  G   
   331  107 H T  E     -H  311   0C  27  202   47         T     T TT T  TTT        A  V    T    TT TTTTTTTT    . TT  T   
   332  108 H T  E     -H  310   0C  48  208   81         T     M TM Q  LTL        T  L    L    SS SMMLSTTM    . QM  K   
   333  109 H V  E     -H  309   0C   0  214   25         V     V VV V  VIV        V  V    V    VV VVVVVLVV    . VV  V   
   334  110 H T  E     -d  227   0B  16  217   44         T     T TT T  TTT        T  T    T    TT TTTSTTTT    Q TT  T   
   335  111 H V  E     +d  228   0B   2  218   17         V     V VV V  VVV        L  V    V    VV VVVVVVVV    V VV  V   
   336  112 H S        -     0   0   18  219   35         S     T ST S  SSS        A  S    S    SS STSSSSST    E TT  S   
   337  113 H S  S    S+     0   0   99  220   31         S     S SS S  SSS        S  S    S    SS SSSSSSSS    A SS  S   
   338  114 H A  S    S-     0   0   31  221   51         E     A AA A  AEA        E  G    V    EE EAAAEEEV    v VA  G   
   339  115 H K        -     0   0  143  209   69         T     . ST S  SSS        S  S    D    PP PTSSPPP.    s ..  S   
   340  116 H T        -     0   0   44  210   73         T     . PL P  PAP        P  A    P    AA ASPPAAA.    P ..  T   
   341  117 H T  B     -J  370   0D  35  217   71         A     T TH T  TRT        T  S    N    RR RKTTRRRT    T A.  K   
   342  118 H P        -     0   0   60  218   66         S     s SA S  NNS        K  A    S    EE ESSSEEEa    K aa  S   
   343  119 H P        -     0   0   13  218   31         P     p PP P  PPP        P  P    L    PP PPPPPPPp    P pp  P   
   344  120 H S  E     -K  367   0E  51  218   62         T     S KS K  KTK        Q  T    R    TT TSKKTTTS    Q TT  T   
   345  121 H V  E     -K  366   0E   6  219   45         L     L VV V  VIV        V  L    S    II ILVVIIIV    V LL  L   
   346  122 H Y  E     -K  365   0E  27  220   34         F     F FF F  FYF        F  F    F    YY YFFFYYYF    F FF  F   
   347  123 H P  E     -K  364   0E  15  220   29         P     P PP P  PPP        P  P    P    PP PPPPPPPP    P PP  P   
   348  124 H L  E     +K  363   0E   4  221    3         L     L LL L  LLL        L  L    L    LL LLLLLLLL    L LL  L   
   349  125 H A        -     0   0   10  221   68         V     I SR s  StS        S  V    s    tt tIsStttI    S MM  V   
   350  126 H P        -     0   0   24  216   47         M     S LP d  LpL        .  S    q    pp pSdLpppP    L QQ  .   
   351  127 H G  S    S-     0   0   16  219   75         C     C CC S  CRC        L  C    S    QQ QCSCQQQC    C CC  Q   
   352  128 H S  S    S+     0   0   99  219   60         Q     G SC T  SAS        C  E    T    AA AGTSAAAC    S GG  C   
   353  129 H A        +     0   0   52  220   92         P     E Tg P  TLT        S  n    D    LL LEPTLLLg    E SS  n   
   354  130 H A        +     0   0   70  136   83         .     . .s .  ...        E  p    .    .. .......v    . ..  d   
   355  133 H Q        +     0   0  178  159   73         G     . QS .  Q.Q        Q  L    .    .. ...Q...D    Q GG  R   
   356  134 H T    >   -     0   0   64  220   50         C     S PS Q  PSP        P  D    S    SS SSQPSSSF    P TT  S   
   357  135 H N  T 3  S-     0   0  146  221   56         A     M DD D  DSD        D  T    D    SS SMDDSSSE    D GG  A   
   358  136 H S  T 3  S+     0   0   63  221   63         D     D GS G  GDG        G  N    G    DD DDGGDDDN    G DN  S   
   359  137 H M  E <   - L   0 408E  83  221   79         E     P NH N  NPN        N  E    H    PP PPNNPPPS    N TT  Q   
   360  138 H V  E     - L   0 407E  15  221   34         I     V VV V  VVV        V  V    V    VV VVVVVVVV    V VV  I   
   361  139 H T  E     + L   0 406E  15  221   70         T     T VT V  VIV        V  A    V    II ITVVIIIT    V TT  A   
   362  140 H L  E     + L   0 405E   0  221   27         V     I II V  III        V  V    I    II IIVIIIIM    V LL  V   
   363  141 H G  E     -KL 348 404E   0  221   30         G     G AG A  AGA        A  G    G    GG GGAAGGGG    A GG  G   
   364  142 H e  E     -KL 347 403E   1  221    0         C     C CC C  CCC        C  C    C    CC CCCCCCCC    C CC  C   
   365  143 H L  E     -KL 346 402E   2  221   33         L     L LL L  LLL        L  L    M    LL LLLLLLLL    L IF  L   
   366  144 H V  E     -KL 345 401E   1  221   49         A     A VS V  VIV        V  A    V    II IAVVIIIV    V AA  A   
   367  145 H K  E     -KL 344 400E  38  220   74         H     K QT Q  QHQ        R  Q    Q    HH HKQQHHHT    R SS  L   
   368  146 H G  E    S+     0   0E  19  221   50         D     D GG G  GDG        S  D    D    DD DDGGDDDG    S GG  D   
   369  147 H Y  E     - L   0 399E   0  221   18         F     F FF F  FYF        F  F    F    YY YFFFYYYY    F FF  F   
   370  148 H F  B     +J  341   0D   3  221   42         F     L FL F  FFF        F  L    F    FF FLFFFFFM    F SS  F   
   371  149 H P  S    S-     0   0    0  221   37         P     P pP p  ppp        p  P    p    pp pPpppppA    p PP  P   
   372  150 H E  S    S+     0   0   53  211   46         E     E eA e  ege        e  D    e    gg gEeegggD    e SS  E   
   373  151 H P        +     0   0   59  219   54         S     T PP P  PTP        P  S    S    TT TTPPTTTP    P SS  S   
   374  152 H V        -     0   0   20  221   53         L     I LV L  LML        L  I    V    MM MILLMMML    L LL  L   
   375  153 H T  E     +N  422   0F  83  220   71         T     S SD S  SNS        S  T    N    NN NSSSNNNE    S TT  T   
   376  154 H V  E     +N  421   0F  23  221   43         F     F VV V  VVV        V  F    V    VV VFVVVVVI    V FF  Y   
   377  156 H T  E     -N  420   0F  48  221   56         Q     T TK T  TTT        T  S    T    TT TTTTTTTQ    T AA  Q   
   378  157 H W  E > >S-NO 419 383F   2  221    0         W     W WW W  WWW        W  W    W    WW WWWWWWWW    W WW  W   
   379  162 H N  G > 5S-     0   0   38  221   69         T     g sN s  sGs        S  k    D    GG GgssGGGN    S nn  S   
   380  163 H S  G 3 5S-     0   0   91  218   63         N     n sS s  sKs        Q  n    H    KK KnssKKKD    . nn  N   
   381  164 H G  G < 5S+     0   0   39  218   55         A     A GG G  GSG        S  S    K    SS SAGGSSSG    . GG  Q   
   382  165 H S  T < 5 +     0   0   93  221   60         K     S QS Q  QGQ        G  D    G    GG GSQQGGGS    Q PP  G   
   383  166 H L  B   < +O  378   0F  43  221   87         G     Y GI N  GKG        T  I    K    KK KYNGKKKI    S AA  S   
   384  167 H S        +     0   0   88  221   69         A     S VT V  VDV        T  S    G    DD DSVVDDDT    G LL  Q   
   385  168 H S  S    S+     0   0  101  221   77         V     T TS T  TIT        T  K    T    II ITTTIIIT    T TT  S   
   386  169 H G  S    S+     0   0   32  218   43         T     G AG A  ATA           G    S    TT TGAATTTG    T DD  E   
   387  171 H V        +     0   0   48  219   62         S     L RL R  RTR           V    V    TT TLRRTTTI    T FF  Q   
   388  172 H H  E     -M  404   0E  17  220   80         D     K NK N  NVN           W    M    VV VKNNVVVK    H II  Y   
   389  173 H T  E     -M  403   0E  69  220   82         K     S FN F  FNF           G    N    NN NSFFNNNT    F QQ  P   
   390  174 H F  E     -M  402   0E   1  219   43         Y     Y PF P  PFP           F    F    FF FYPPFFFM    P YY  V   
   391  175 H P  E     -     0   0E  65  219   32         P     K PP P  PPP           P    P    PP PKPPPPPG    P PP  I   
   392  176 H A  E     -     0   0E  19  215   65         S     P SA S  SPS           S    P    PP PPSSPPPP    S PP  A   
   393  177 H V  E     -M  400   0E  42  214   63         T     V QV Q  QAQ           V    V    AA AVQQAAAV    Q VV  K   
   394  178 H L  E     -M  399   0E  77  214   65         L     M DL D  DLD           L    H    LL LMDDLLLL    A RR  D   
   395  179 H Q  S    S-     0   0   83  214   70         N     Q AQ A  AAA           R    V    AA AQAAAAAs    A KE  G   
   396  180 H S  S    S-     0   0  116  214   49         N     s sq s  sss           G    a    ss sssssssa    p GG  S   
   397  183 H D  S    S+     0   0   90  206   25         K     g dg d  dgd           G    g    gg ggddgggg    g DD  .   
   398  184 H L        -     0   0   53  199   75         K     S LL L  LGL           K    L    RR RTLLRRRL    L FF  .   
   399  185 H Y  E     -LM 369 394E  36  205    2         Y     Y YF Y  YYY           Y    Y    YY YYYYYYYY    Y YY  F   
   400  186 H T  E     +LM 367 393E   5  195   48         T     S TA T  TTT           A    T    TT TSTTTTTT    T TT  S   
   401  187 H L  E     -L  366   0E  11  190   56         G     A TS T  TMT           A    M    MM MATTMMML    T GG  R   
   402  188 H S  E     -LM 365 390E   5  191   26         V     S SS S  SSS           T    S    SS SSSSSSSS    S VV  V   
   403  189 H S  E     -LM 364 389E   2  191    0         S     S SS S  SSS           S    S    SS SSSSSSSS    S SS  S   
   404  190 H S  E     -LM 363 388E   0  191   77         L     Q QQ Q  QQQ           Q    Q    QQ QQQQQQQQ    Q NN  L   
   405  191 H V  E     -L  362   0E   0  190   27         L     V LL L  LLL           V    L    LL LVLLLLLL    L II  I   
   406  192 H T  E     +L  361   0E  48  189   37         K     N TT T  TTT           L    T    TT TNTTTTTT    T RR  R   
   407  193 H V  E     -L  360   0E  14  188   30         V     V LI L  LLL           L    L    LL LVLLLLLI    L VV  V   
   408  194 H P  E  >  -L  359   0E  56  188   40         S     A PP P  PPP           A    P    PP PAPPPPPL    P SS  S   
   409  195 H S  T  4 S+     0   0   49  187   50         K     S AL A  AAA           S    A    AA ASAAAAAA    A RR  K   
   410  196 H S  T  4 S+     0   0   66  187   69         S     A TS T  TVT           K    D    VV VATTVVVS    A QQ  T   
   411  198 H P  T  > S+     0   0   31  187   72         D     V QD Q  QEQ           d    Q    EE EVQqEEEE    Q dd  D   
   412  199 H R  T  < S+     0   0   16  187  102         W     W CW C  CCC           q    C    CC CWClCCCW    C ee  W   
   413  200 H P  T  4 S+     0   0   80  188   68         N     D LK P  LPL           G    P    PP PDPAPPPK    P AA  D   
   414  202 H S  T  4 S+     0   0  111  188   69         S     K AA D  AEA           T    A    EE ENDGEEEN    D KK  A   
   415  203 H E  S  < S-     0   0  128  188   76         R     M GK G  GGG           D    K    GG GIGKGGGT    T DD  G   
   416  204 H T        -     0   0   83  188   70         r     e kK k  kek           e    g    ee eekSeeeT    k aa  k   
   417  205 H V        +     0   0    4  184   61         f     f vI v  vvv           v    q    vv vfvVvvvY    v ff  y   
   418  206 H T  E     - P   0 433F  23  183   70         Q     Y T  T  TKT           V    K    KK KYTTKKKR    K RR  N   
   419  208 H e  E     -NP 378 432F   0  187    0         C     C C  C  CCC           C    C    CC CCCCCCCC    C CC  C   
   420  209 H N  E     -NP 377 431F   4  187   60         S     N H  H  HSH           K    H    SS SNHHSSSK    S AA  S   
   421  210 H V  E     -NP 376 430F   1  187   16         V     A V  V  VVV           V    V    VV VAVVVVVV    V AA  V   
   422  211 H A  E     -NP 375 429F  14  187   74         T     K K  K  KQK           Q    Q    QQ QKKKQQQV    K TT  S   
   423  212 H H  E > > - P   0 428F   1  187    7         H     H H  H  HHH           H    H    HH HHHHHHHH    H HH  H   
   424  213 H P  G > 5S+     0   0   77  177   83         T     L Y     YDY           P    N    DD DLYYDDDN      AA  K   
   425  214 H A  G 3 5S+     0   0   40  177   67         G     D T     TST           N    S    SS SDTTSSSS      AA  G   
   426  215 H S  G < 5S-     0   0   32  176   64         G     T N     NNN           G    S    NN NTNNNNNT      GG  Q   
   427  216 H S  T < 5 +     0   0  111  176   72         S     I P     PAP           N    P    PP PISPPPPN      PP  S   
   428  217 H T  E   < +P  423   0F  35  176   66         K     K S     SVS           K    S    VV VKSSVVVT      VV  K   
   429  218 H K  E     +P  422   0F 135  176   53         S     S Q     QQQ           E    Q    QQ QSQQQQQK      EE  H   
   430  219 H V  E     -P  421   0F  38  125   32         V     V                     Q             V     Q      VV  V   
   431  220 H D  E     -P  420   0F  97  125   35         T     E                     N             E     E      TT  T   
   432  221 H K  E     -P  419   0F  51  113   47               L                     V             L     K          L   
   433  222 H K  E     -P  418   0F 121  113   52               K                     P             K     S          K   
   434  223 H I        -     0   0    4  109   32                                     L             K     L              
   435  224 H V        -     0   0   79  101   61                                                   D                    
   436  225 H P              0   0   73   92   66                                                   P                    
   437  226 H R              0   0  167   78   25                                                                        
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    1 L D              0   0  100   71   31                Q          E           Q                Q         Q     
     2    2 L I        -     0   0    0   77   33                V          L           N                V         P     
     3    3 L V        -     0   0   88   83   53                T          I           V                T         V     
     4    4 L M  E     -Q   25   0G  12   86   20                V          MM          V                V         L     
     5    5 L T  E     -Q   24   0G  80   86   17                T          TT          L                T         T     
     6    6 L Q  E     -Q   23   0G  19   86    6                Q          QQ          T                Q         Q     
     7    7 L S  E    S+Q   22   0G  57   86   54                S          TT          Q                S         S     
     8    8 L P        -     0   0   47  128    7       P    P   P        P PP      P   P                P   P     S     
     9    9 L A  S    S-     0   0   79  136   69       A    P  AAA       P SS      A   A                A AAV     S     
    10   10 L S  E     -t  107   0H  78  142   56       S    V  SVS    S  S MM      S   A S   S          V SSS     A     
    11   11 L L  E     -t  108   0H  34  176   45     L V    VV VRVVVL V  V LL      VV  KLV VVL          K VVE    VL LL  
    12   12 L V  E     +t  109   0H  86  187   34     T S    TS SSSSSTSS  S SP      SS  STS SSS          S SSS    SA SS  
    13   13 L V  E     -t  110   0H  17  189   58     V V    SA VIVGGTVA  V VV      VG  VTA GGA          I VVV    GT VV  
    14   14 L S  E >   -t  111   0H  46  199   61     S S    AN STSTTSNN  S TT      SS  QSNATTK    T     T SSK    TL SS  
    15   15 L L  T 3  S+     0   0   79  198   66     P V    PP VQVPPPLP  L VV      VP  LPPPPPV    P     Q VVL    P. PP  
    16   16 L G  T 3  S+     0   0   39  206    7     G G    GG GGGGGGEGG G GG G    GG  GGGGGGG G  G     G GGG    GG GG  
    17   17 L Q    <   -     0   0   97  206   52     G G    SE GEGQQEQEQ Q QQ Q    GQ  QGEGTSE H  S     E GGE    SA GG  
    18   18 L R        -     0   0  152  206   62     T T    TT TTTSSTTTT N TT T    TS  TTTTSST T  T     T TTT    SS TT  
    19   19 L A  E     - R   0  79G   2  206   44     V V    VV VLVVVVAVA G AA V    VI  VVVVVVV A  V     L VVV    VA VV  
    20   20 L T  E     - R   0  78G  66  207   59     T T    TK TTKTTTRKR Q TT T    TT  SIKSTTR K  T     I TTR    TK TT  
    21   21 L I  E     - R   0  77G   0  207   22     L L    LI LILIILIII I II I    LI  ILIIIII L  L     I LLI    IL LL  
    22   22 L S  E     -QR   7  76G  36  207   50     T T    TT TSTSSTTTT T TT N    TS  DTTTSST S  T     S TTS    ST TT  
    23   23 L a  E     -QR   6  75G   0  207    0     C C    CC CCCCCCCCC C CC C    CC  CCCCCCC C  C     C CCC    CC CC  
    24   24 L R  E     -QR   5  74G 153  207   75     G Q    KS EKETTRGSS S KK Q    QT  KRSSAAS T  R     K EQT    AT GG  
    25   25 L A  E     -Q    4   0G   6  207   68     S G    TG GTGGGSGGG G AA T    GG  ASGGGGG I  T     T GGL    GL SS  
    26   26 L S  S    S+     0   0   63  207   52     T N    SD DSDTTSDGD N SS S    NT  NSSDSSS S  S     S DNS    SS SS  
    27   27 L E  S    S-     0   0  105  207   72     T N    QR NQDSSTNSK S SS R    DS  PTSLSSS G  Q     Q DNG    SS SS  
    28   27AL S        -     0   0   29  207   74     G I    DS FPISSGISL I SS g    IS  kGYLNNY S  A     P IIA    NE GG  
    29   27BL V        +     0   0    0   57   77     P .    V. .I....... . .. g    ..  a...... .  V     I ...    .H ..  
    30   27CL D  E     +Z   35   0I  45   79   82     V .    Y. .S.DDA... . .. r    ..  HA..... .  Y     S ...    .S SS  
    31   27DL S  E >  S+Z   34   0I  15  116   82     T .    T. ...VVV.Y. . .. T    .D  YV..DD. T  R     . ..S    DD VV  
    32   28 L Y  T 3  S-     0   0  173  119   89     S .    D. .D.GGT.Y. . .. H    .V  ST..II. I  W     . ..I    IY TX  
    33   29 L G  T 3  S+     0   0   81  200   60     G G    s. SCGGGTGGD E II g    Gg  gT.Dgg. S  s     g GGG    gT SX  
    34   30 L K  E <  S-Z   31   0I 112  170   77     . G    g. SNSYYSNNQ N SS r    Sy  qS.Kyt. N  g     s SSD    t. TX  
    35   31 L S  E     -Z   30   0I   7  186   77     H K    G. KDMNNNKYE R NN K    NN  YN.KNS. H  D     E KKL    S. NX  
    36   32 L F        +     0   0    5  198   68     Y Y    RY YCAAYYYYY Y YY C    LH  YYSYLGS R  A     C ANH    G. YY  
    37   33 L M  E     -U   94   0H   0  205   51     P V    MY VVVVVASYI V LL L    VV  LAYTVVY I  M     V VVM    VI PP  
    38   34 L H  E     -U   93   0H   0  207   81     Y H    SG YSHSSNHGS Q SS S    QS  ANGSSSG Y  Y     S QYC    SD GG  
    39   35 L W  E     -UV  92  52H   0  207    0     W W    WW WWWWWWWWW W WW W    WW  WWWWWWW W  W     W WWW    WW WW  
    40   36 L Y  E     -UV  91  50H   0  207   13     F Y    YY YYYYYVYYY Y YY Y    YY  YVYHYYY L  Y     Y YYY    YY FF  
    41   37 L Q  E     -UV  90  49H   4  207   25     Q Q    QQ QQQQQQQQQ Q QQ L    QR  QQQQQQQ Q  Q     Q QQQ    QQ QQ  
    42   38 L Q  E     -U   89   0H  16  207   13     Q Q    QQ QQQQQEKQQ Q QQ Q    QH  QEQQQQQ H  H     Q QQQ    QQ QQ  
    43   39 L K    >   -     0   0   47  207   59     K I    KK MKMHHKPKK K KK K    IH  KKKKRRK R  K     K MIK    RH TT  
    44   40 L P  T 3  S+     0   0   81  207   39     P L    Sa LPLPPPGsA P AA P    LP  TPsPPPv p  S     P LLa    PP PP  
    45   41 L G  T 3  S+     0   0   58  206   20     G P    Gg PGPGGD.gG G GG G    PG  GDgGGGg n  G     G PPn    GG GG  
    46   42 L Q  S <  S-     0   0  103  207   70     Q S    QS SESSSHLSQ K EE E    SK  EHSQRTS P  Q     E SSR    TK KK  
    47   43 L P        -     0   0   34  207   58     V A    PA ATAAALDAS A RR A    AA  ALAAAAA P  T     A AVP    AA AA  
    48   44 L P        -     0   0    5  207   20     P P    PP PPPPPFPPP P PP P    PP  PFPPPPP R  P     P PPR    PP PP  
    49   45 L K  E     -V   41   0H  96  207   71     R R    KV RKRKKTVVV V KK K    RE  ETVVKKV Y  K     K RRY    KR QQ  
    50   46 L V  E     +V   40   0H  10  207   43     T L    LT LLLLLGLTL L LL L    LL  LGTALLT L  L     L LLL    LY MM  
    51   47 L L  E     +     0   0H   2  207   26     L I    LL ILIMMLIVV I LL L    II  LLVVLLV L  L     L IIL    LL LL  
    52   48 L I  E     -VW  39  58H   0  207   24     I I    II IIIIIIIII I II I    II  MIIIIII Y  I     I IIR    IL II  
    53   49 L Y  E  >  + W   0  57H  54  207   35     Y Y    KY YYYYYGYYY Y YY Y    YY  YGYYYYY Y  K     Y YYF    YY YY  
    54   50 L I  T >4 S-     0   0   10  207   91     D E    LD EYSDDGRSR Q RR Y    YE  LGAKDSY k  Y     G VDy    Sl SS  
    55   51 L A  T 34 S+     0   0    2  207   75     T N    VN DIDVVTDND D AA I    NV  TTNDVVN e  V     I DDs    Vg TT  
    56   52 L S  T 34 S+     0   0   73  207   57     S S    NT RSDSSNSTS R TT R    ST  TSTSTSD K  K     N SSK    Ss NN  
    57   53 L N  E <<  -W   53   0H  77  205   73     A Q    TN KSNSSNNNE R TT S    EK  TNNEKSK H  T     S NKH    Se NN  
    58   54 L L  E     -W   52   0H  63  207   64     K R    RR RPRRRRQRR R LL L    RR  RRRRRRR Q  L     R RRQ    RK RR  
    59   55 L E    >   -     0   0   49  207   82     H P    EP PYPPPVPPP P YY Q    PP  FAPPPPP G  E     Y PPG    PG PP  
    60   56 L S  T 3  S+     0   0  107  207   43     S A    SS TSDSSSSSS S TT S    DS  SPSSSSS S  S     L DDD    ST SS  
    61   57 L G  T 3  S+     0   0   67  207   15     W G    GN GNGGGGGNG G GG E    GG  GGNGGGD G  G     N GGG    GG GG  
    62   58 L V    <   -     0   0   17  207   42     T I    TI ITIVVVIII I TT T    IV  IVIIIII V  T     T IIV    IV VV  
    63   59 L P    >   -     0   0   62  207   24     P P    PP PPPSSPPPP P PP P    PS  APPPPPP P  P     P RPP    PP PP  
    64   60 L A  T 3  S+     0   0   99  207   57     A E    GS ESENNADSE D AA A    ED  SVSDEES A  S     S EED    ED EE  
    65   61 L R  T 3  S+     0   0   30  207    7     R R    RR RRRRRRQRR R RQ R    RR  RRRRRRR R  R     R RRR    RR RR  
    66   62 L F  E <   -S   79   0G   7  207    2     F F    FF FFFFFFFFF F FF F    FL  FFFFFFF F  F     F FFF    FF FF  
    67   63 L S  E     -S   78   0G  59  207   17     S S    IS SSSSSSSSS S SS S    SS  SSSSSSS S  S     S SSS    SS SS  
    68   64 L G  E     +S   77   0G  17  207    7     G G    GG GgGGGGGGG G GG g    GG  gGGGGGG g  G     g GGg    GG GG  
    69   65 L S  E     +S   76   0G  48  207   40     S T    SS TsKSSSTSS T HH a    TS  aSSSSSS d  S     a TTd    SS SS  
    70   66 L G  E     -S   75   0G  35  207   76     L N    GK NDNKKLNTS N QQ D    NK  ALKSKKK N  G     S NNS    KS II  
    71   67 L S  E >   +S   74   0G  68  206   22     L S    SS SYSSSILSS S SS Y    SS  NISSSSS P  S     I SSP    SS SS  
    72   68 L R  T 3  S-     0   0  163  206   33     G G    SG GGGGGGGGG G SS G    DG  GGGGGGG S  S     G GGN    GG EE  
    73   69 L T  T 3  S+     0   0   51  206   59     D N    SS NSNNNDNSN D TT T    NN  VDSKNNS N  S     K NNN    NA NN  
    74   70 L D  E <   +RS  24  71G  77  206   64     K T    DT TDTTTKTTT T TT D    TT  DKTTTTT T  D     D TTV    TD KK  
    75   71 L F  E     -RS  23  70G   0  206   82     A A    FA AFAAAAASA A FF F    AA  FAGNAAA G  F     F AAG    AH AA  
    76   72 L T  E     -RS  22  69G  33  206   58     V S    TT STSSSATTT T TT T    SS  TATTTTT I  S     T SSY    TN AA  
    77   73 L L  E     -RS  21  68G   0  206    3     L L    LL LLLLLLLLL L MM L    LL  LLLLLLL L  M     L LLL    LL LL  
    78   74 L T  E     -RS  20  67G  28  206   44     T T    TT ESETTTTTT N TS T    TT  TTTTTTT T  T     T EKT    TI TT  
    79   75 L I  E     -RS  19  66G   0  206    3     L I    II IIIIIIIII I II I    II  IIIIIII I  I     I III    II II  
    80   76 L D  S    S+     0   0   68  206   39     S S    ST SSSSSTSTS T TT S    SS  STTSSST S  S     S SSK    SS TT  
    81   77 L P  S    S-     0   0   51  206   60     A G    GG GGGGGGGGG Q GG G    GG  GGGGGGG S  G     G GGG    GS GG  
    82   78 L V        +     0   0    0  206   50     A A    VV AVALLAAVA A VV V    AL  VAVVLLV V  V     V AAA    LI AA  
    83   79 L E    >   -     0   0   93  206   33     Q Q    QQ QQQQQQRQQ Q QQ Q    QQ  QQQLQQQ E  Q     Q QQL    QQ QQ  
    84   80 L A  G >  S+     0   0   22  206   52     P A    TA ATAAATAAA E PP T    AA  ATAAAAA A  A     T TGL    AA PP  
    85   81 L D  G 3  S+     0   0   58  206   27     E E    ED GEGEEEEEG E EE E    EE  EEEEEEE E  E     E GEE    EE EE  
    86   82 L D  G <   +     0   0    1  206    0     D D    DD DDDDDDDDD D DD D    DD  DDDDDDD D  D     D DDD    DN DD  
    87   83 L A    <   +     0   0   12  206   78     E E    AE EAEEEEEEE E FF A    EE  ADEEEEE E  A     A EED    EE EE  
    88   84 L A  E    S- X   0 108H   8  206   19     A A    AA AGAVAAVAA A AA G    AA  AAAAAAA A  A     G AAA    AA GG  
    89   85 L T  E     -UX  42 107H  35  207   69     D D    VV DDDDGIDVD D DD H    DD  LMVDDDV D  E     D DDD    DD DD  
    90   86 L Y  E     -UX  41 106H   0  207    5     Y Y    YY YYYYCYYYY Y YY Y    YY  YYYYYYY Y  V     Y YYY    YY YY  
    91   87 L Y  E     -U   40   0H   9  207    7     Y Y    YY YYYYYFYFY Y YY Y    YF  YFYYYHF Y  F     Y YYY    HI YY  
    92   88 L a  E     -U   39   0H   0  207    4     C C    CC CCCCCCCCC C CC C    CC  CCCCCCC C  V     C CCC    SC CC  
    93   89 L Q  E     -UY  38 102H   1  207   79     M Q    QG QLQSSAAGT Q MM M    RC  QAGQCCG L  R     Q QQA    AG CC  
    94   90 L Q  E     +UY  37 101H   0  207   84     l V    Ss VSMSSlIsr a GG s    VS  SlSSSSS E  p     s VVT    Vv ll  
    95   91 L N        +     0   0    0  185   59     y W    Y. WYYYYyY.. . YY w    WY  YyYWYYY W  f     y WWW    .f yy  
    96   92 L N  S    S+     0   0    1  190   79     G d    h. dhtaksH.. . qq i    dv  hsdDrad d  V     i ddh    gt ss  
    97   93 L E  S    S-     0   0   48  189   80     G a    ns alqta.Ega c gn n    kt  q.gSccs h  S     s aas    cc px  
    98   94 L D  S    S+     0   0   42  192   76     V Y    Vs IWWVF.fIV V VT W    LY  Y.IiFFi t  L     W VIF    FY YV  
    99   95 L P  S    S-     0   0   26  108   72     . .    .a .....hc.. . .. V    ..  .h.c..r v  W     V ...    .. T.  
   100   96 L P        -     0   0    4  141   88     R .    WA .YY..WW.. Y .. F    H.  .W.F..S Y  Y     F ...    .. Y.  
   101   97 L T  E     -Y   94   0H  26  181   65     V I    TR .TIV.VV.. V A. T    II  VV.VVVQ V  T     T Y.I    VV V.  
   102   98 L F  E     -Y   93   0H  26  205    9     F F    FF FFFFHFFFF F FF F    FF  FFFFFFP F  F     F FFF    FF FF  
   103   99 L G        -     0   0    3  207   13     G G    GG GGGGSGGGG G GG G    GG  GGGGGGS G  G     G GGG    GG GG  
   104  100 L A        -     0   0   81  207   63     T G    GA GGGTVGGSS G KK S    GT  GGSGGGS K  G     G GGG    GG SS  
   105  101 L G        -     0   0   12  207   10     G G    GG GGGESGGGG G GG G    GG  GGGGGGG G  G     G GGG    GG GG  
   106  102 L T  E     - X   0  90H   0  207   10     T T    TT TTTTKTTTT T TT T    TT  TTTTTTS T  T     T ITT    TT TT  
   107  103 L K  E     -tX  10  89H  74  207   54     Q Q    KT QKQKEKQTR S EE K    QS  RKTQQQT K  K     K QQQ    QQ HH  
   108  104 L L  E     +tX  11  88H   2  206   19     V L    VL LLLTLLLLL L LL L    LV  LLLLLLV L  L     L VLL    LL LL  
   109  105 L E  E     -t   12   0H  14  207   67     T T    VT TLTASTTTT L VV D    TT  DTTTTTT N  I     L TTT    TT SS  
   110  106 L M  E     -t   13   0H   0  207   27     V V    VV VIVLLVVVV V LL V    VV  VVVVVVI V  V     I VVV    VV VV  
   111  107 L R  E     +t   14   0H 126  207   85     L L    DL LSLGPLLLL L NN G    LL  GLLLLLS Q  G     S LLL    LT LL  
   112  108 L R        -     0   0   64  207   79     G t    LG tttSGGGGG G RR T    tR  SGGGGGG K  S     t ttt    GG GG  
   113  109 L A        -     0   0   71  198   67     Q d    GQ dsd.QQQQQ Q DD .    dQ  DQQQQQQ E  G     s ddd    QQ QQ  
   114  110 L D        -     0   0   58  203   71     p V    Vp VPV.ppppp p VV V    Vp  Vpppppp s  V     P VVV    pp pp  
   115  111 L A  B     -A  144   0J  19  204   57     a K    Vv KVKRassva v AA S    Ka  .svsssv s  V     V KKK    sv ss  
   116  112 L A        -     0   0   40  206   62     N A    RA SKSATSAAT H KK P    AN  RSAAAAA V  R     K SAA    AT AA  
   117  113 L P        -     0   0    9  206    1     P P    PP PPPPPPPPP P PP P    PP  PPPPPPP P  P     P PPP    PP PP  
   118  114 L T  E     -B  141   0K  85  206   55     T S    TT SSSASSSTT S VV Q    ST  TSTSSST L  T     S SSS    SS TS  
   119  115 L V  E     -B  140   0K   8  206   18     V V    LI VVVMVVVIV V LL V    VV  LVIVVVV V  L     V VVV    VV VV  
   120  116 L S  E     -B  139   0K  17  206   69     T S    ST SSSKTTTTG S TT S    ST  TTTSSSH S  T     S SSS    SI TT  
   121  117 L I  E     -B  138   0K  22  207   30     L I    VL ILIMVLLLL V LL V    IL  VLLLLLL L  V     L III    LL LL  
   122  118 L F  E     -B  137   0K   4  207    7     F F    LF FLFFFFFFF F LL L    FF  LFFFFFF L  L     L FFF    FF FF  
   123  119 L P        -     0   0    5  207   23     P P    PP PGPPPPPPA P PP P    PP  PPPPPPA P  P     G PPA    PP PP  
   124  120 L P        -     0   0    1  207    4     P P    PP PSPPPPPPP P PP P    PP  PPPPPPP P  P     S PPP    PP PP  
   125  121 L S    >>  -     0   0    8  207    4     S S    SS SSSSSSSSS S SS S    SS  SSSSSSS S  S     S SSS    SS SS  
   126  122 L S  H 3> S+     0   0   78  207   65     S V    RK ESESSSSKP Q TT S    VS  RSKAAAS L  K     S EVE    AS TT  
   127  123 L E  H 3> S+     0   0   76  207   23     E E    EE ELEEEEEED E EE A    EE  EEEEEEE A  D     L EEE    EE EE  
   128  124 L Q  H <4>S+     0   0    8  207   27     E E    EE EQEEEEEEQ E EE E    EE  DEEEEEE E  E     Q EEE    EE EE  
   129  125 L L  H ><5S+     0   0   29  207   22     L I    LL ISILLLLLL I II I    IL  LLLLLLL L  D     S III    LL LL  
   130  126 L T  H 3<5S+     0   0  111  207   71     Q A    QN ASAQQEGDK K SS S    AQ  QEDNNNS T  K     S AAA    NK SS  
   131  127 L S  T 3<5S-     0   0   83  207   67     A T    QE TGTASTAQD S KK S    TA  QTQNNNQ D  Q     G TTT    ND NN  
   132  128 L G  T < 5S+     0   0   34  207   53     N K    Da KDKNNNNNN k GG k    KN  GNNNNNG k  S     D KKK    NN NN  
   133  129 L G  E   < - C   0 186K  21  205   60     K K    Sk KSKKKKKKK k TT a    KK  KKKKKKK r  S     S KKK    KK KK  
   134  130 L A  E     - C   0 185K   0  207   13     A A    AA AAAAAAAAV A AA A    AA  AAAAAAA A  A     A AAA    AA AA  
   135  131 L S  E     - C   0 184K   2  207   38     T T    TT TATTTTTTT T TT T    TT  TTTTTTT T  T     A TTT    TT TT  
   136  132 L V  E     - C   0 183K   0  207   28     L V    LL LLLLLLLLL L LL L    VL  LLLLLLV L  L     L LVV    LL LL  
   137  133 L V  E     -BC 122 182K   0  207   12     V V    VV VLVVVVVVV V LL L    VV  MVVVVVV V  V     F VVV    VV VV  
   138  134 L b  E     -BC 121 181K   0  207    3     C C    CC CCCCCCCCC C CC C    CC  CCCCCCC C  C     C CCC    CC CC  
   139  135 L F  E     -BC 120 180K   0  207   31     L S    VL SLSLLTLLL L LL V    SL  LTLLLLL L  L     L SSS    LL LL  
   140  136 L L  E     -BC 119 179K   0  206   48     I L    AI LLLIIIVII M AA A    LI  AIIMMMI V  A     L LLL    MI MM  
   141  137 L N  E     -B  118   0K   2  207   48     S S    SN SSSSSTSSN D NN N    SS  NTSSSSE N  T     S SSS    SN SS  
   142  138 L N  E    S+     0   0K  49  207   47     D D    GD DSDDDDDDG G HH K    DD  KDDDDDN N  G     S DDD    DD DD  
   143  139 L F  E     - C   0 177K   0  207   30     F F    GF FYFFFFFFF F FF G    FF  GFFFFFF F  G     Y FFF    FF FF  
   144  140 L Y  B    S+A  115   0J   9  206   40     Y T    FY TSTYYYYYY Y FF F    TY  FYYYYYY S  F     S TTT    YY YY  
   145  141 L P  S    S-     0   0   18  207    7     P P    PP PPPPPPPPL P PP P    PP  PPPPPPP P  P     P PPP    PP PP  
   146  142 L K  S    S+     0   0   83  206   75     G R    SS RPRGGGGSP R NN S    RG  SGSGGGR G  S     P RRR    GR GG  
   147  143 L D        +     0   0  116  207   72     A G    AP GGGAAVAPT A TT D    GA  DVPSSSD S  N     G GGG    ST AA  
   148  144 L I        -     0   0   19  206   60     V A    WV AAAVVVVVV I LL W    AV  WVVVVVV V  W     A AAA    VV VV  
   149  145 L N  E     -E  201   0L  82  207   67     T T    RT TKTTTTTTS Q QQ R    TT  STTTTTS E  N     K TTT    TK TT  
   150  146 L V  E     -E  200   0L  27  207   11     V V    LV VVVVVVVVM V LL L    VV  LVVVVVV V  L     V VVV    VV VV  
   151  147 L K  E     -E  199   0L  53  207   75     A K    GD KSKAEDAEA E VV V    KA  ADEAAAE T  G     T KKK    AN AA  
   152  148 L W  E     +E  198   0L   3  207    2     W W    WW WWWWWWWWW W WW W    WW  WWWWWWW W  W     W WWW    WW WW  
   153  149 L K  E     +EF 197 158L  76  207   39     K L    KV QTQKKKKLK K QQ K    LK  KKLKKKV T  K     T QLL    KK KK  
   154  150 L I  E    S-E  196   0L   0  207   67     A V    VI VRVAAVAVA A KK V    VA  VVVAAAA V  V     R VVV    AA EE  
   155  151 L D  S    S-     0   0   71  207   19     D D    GD DDDDDDDDD N DD L    DD  DDDNNND D  G     D DDD    ND NN  
   156  152 L G  S    S+     0   0   63  207   35     G G    GG GGGGGGGGG D MM K    GG  GGGGGGG G  G     G GGG    GG GG  
   157  153 L S  S    S-     0   0   33  206   68     S K    SS KSKNNTSSS G VV P    KS  STSTTTK V  T     S KKK    TN SS  
   158  154 L E  B     -F  153   0L  85  206   78     P D    ST EEESSPTTP T TT D    DP  SPTPPPT A  S     E EDE    PS PP  
   159  155 L R        -     0   0   69  207   77     V Q    SR KLKVVVIRA I VV G    QV  SVRVVVI Q  T     L KQK    VV VV  
   160  156 L Q        +     0   0  133  207   73     K T    SS TSTRRTTKT S TT S    TK  STKTTTT R  S     S TTT    TT SS  
   161  157 L N  S    S+     0   0  117  207   69     A D    SG DEDDDQQGQ A DD S    DA  SQGQQQS S  S     E DDD    QQ QQ  
   162  158 L G  S    S+     0   0   29  207   34     G S    GE GGGGGGGEG G GG s    SG  sGEGGGG G  G     G GSS    GG GG  
   163  159 L V  E     -D  183   0K  46   65   74     . .    .. .F....... . .. g    ..  s...... .  .     F ...    .. ..  
   164  160 L L  E     -D  182   0K  16  192   49     V V    V. V.VVVMV.V V VV q    VV  eM.VVVV I  V     . VVV    VV VV  
   165  161 L N  E     +D  181   0K  52  196   54     E Q    S. V.VEEEE.G E KK E    QE  EE.EEEE Q  S     . VQQ    ED EE  
   166  162 L S  E     -D  180   0K  12  204   50     T S    HT SLSTTTTTT T TT S    ST  STTTTTT T  T     L SSS    TT TT  
   167  163 L W  E     -D  179   0K  99  204   72     T S    ST STSTTTTTT S SS S    ST  RTTTTTS S  S     T SSS    TT TT  
   168  164 L T        -     0   0   24  204   69     K G    LA GSGKKQKPQ T GG S    GK  SQPKKKH L  L     S GGG    KQ KK  
   169  165 L D        -     0   0   99  204   75     P L    EP LALPPPPAP P SS A    LP  PPAPPPN A  E     A LLL    PP PP  
   170  166 L Q        -     0   0   18  206   75     S S    VQ SESSSSSQS V VV G    SS  GSQSSSA Q  V     E SSS    SS SS  
   171  167 L D     >  -     0   0   48  206   62     K K    LR KSKKKKKRK K TT L    KK  VKRKKKQ K  L     S KKK    KK KK  
   172  168 L S  T  4 S+     0   0   54  206   61     Q Q    GQ QQQQQQQQQ Q GG L    QQ  LQQQQQQ Q  G     Q QQQ    QQ QQ  
   173  169 L K  T  4 S+     0   0  180  206   55     S S    RS SQSSSSSSS G SS E    SS  ESSSSSQ N  T     Q SSS    SS SS  
   174  170 L D  T  4 S-     0   0   57  206   36     N D    DN DDDNNNNNK D DD K    DN  KNNNNNS E  D     D DDD    NN NN  
   175  171 L S     <  +     0   0    4  206   54     N N    GS SGSNNNNSG K HH D    NN  DNSNNNS N  G     G SNN    NN NN  
   176  172 L T        -     0   0    5  206   71     K L    HQ LRLKKKKQK Y SS g    LK  gKQKKKt T  R     R LLL    KK KK  
   177  173 L Y  E     -C  143   0K   7  204    1     Y Y    YY YYYYYYYYY . YY y    YY  yYYYYYy Y  Y     Y YYY    YY YY  
   178  174 L S  E     -     0   0K   1  205   68     A M    SM MSMAAMAMT V SS S    MA  SMMAAAL S  S     S MMM    AA VV  
   179  175 L M  E     -CD 140 167K   0  206   80     A E    WA ECEAAAAAA A VV W    EA  WAAAAAA V  W     C EEE    AA AA  
   180  176 L S  E     -CD 139 166K   3  206    3     S S    SS STSSSSSSS S SS S    SS  SSSSSSS S  S     T SSS    SS SS  
   181  177 L S  E     -CD 138 165K   0  206    0     S S    SS SSSSSSSSS S SS S    SS  SSSSSSS S  S     S SSS    SS SS  
   182  178 L T  E     -CD 137 164K   2  206   71     Y Y    TY YVYYYYYYY Y TT S    YY  TYYYYYY F  T     V YYY    YF YY  
   183  179 L L  E     -CD 136 163K   0  206    0     L L    LL LLLLLLLLM L LL L    LL  LLLLLLL L  L     L LLL    LL LL  
   184  180 L T  E     +C  135   0K  36  206   53     S S    SS SKSSSTSSS A TT T    SS  RTSSSSS T  S     K SSS    SS SS  
   185  181 L L  E     -C  134   0K  16  206    9     L L    LL LLLLLLLLL L LL L    LL  LLLVVVL L  L     L LLL    VL MM  
   186  182 L T  E  >  -C  133   0K  81  205   54     T T    PS TKTTTTSTT T PP T    TT  PTTSSST P  S     K TTT    SS SS  
   187  183 L K  H >> S+     0   0   66  204   67     P A    AA SRSPPAPA. R AA E    AP  AAASSSP V  A     R SAA    SA AA  
   188  184 L D  H 3> S+     0   0  109  205   63     E D    DS DEDQQRDSD S QQ Q    DE  DRSQQQT L  D     E DDD    QN SS  
   189  185 L E  H >4 S+     0   0   53  205   48     Q Q    QD EEEQQAKDE E VV Q    QQ  QADDDDE E  Q     E EQQ    DQ KK  
   190  186 L Y  H X< S+     0   0    6  205   12     W W    WW WWWWWWWWW W WW W    WW  WWWWWWW W  W     W WWW    WW WW  
   191  187 L E  H 3< S+     0   0   90  205   71     K L    RS LELKKEKSR E AA M    LK  GESKKKQ N  R     E LLL    KK KK  
   192  188 L R  T << S+     0   0  160  205   58     S R    KS KKKSSRSSS A SS E    RS  KRSSSSS S  K     K KRK    SS SS  
   193  189 L H    <   -     0   0   24  203   55     H H    AH HRHRRHHHG N DD S    HH  VHHAAAY K  A     R HHH    AY AA  
   194  190 L N  S    S+     0   0   97  203   71     R E    GE DEDSSSSEN K AA A    ER  GSESSSN N  G     E DEE    SQ SS  
   195  191 L S  E     + G   0 214L  37  203   71     S T    ST LRLSSSSTT D RR S    TS  SSTAAAS I  S     R LTT    AS QQ  
   196  192 L Y  E     +EG 154 213L   0  203   15     Y Y    VY YYYYYYFYF Y FF V    YY  VYYYYYV Y  V     Y YYY    YV YY  
   197  193 L T  E     -EG 153 212L   3  203   48     S S    ST SASSSSSTS T SS S    SS  TSTSSSS T  S     V SSS    ST SS  
   198  194 L b  E     -EG 152 211L   1  203    0     C C    CC CCCCCCCCC C CC C    CC  CCCCCCC C  C     C CCC    CC CC  
   199  195 L E  E     -EG 151 210L  34  203   61     Q K    ER KRKHHQLRQ K VV E    KQ  EQRQQQK E  E     R KKK    QQ HH  
   200  196 L A  E     -EG 150 209L   1  203   23     V V    AV VVVVVVVVV V VV A    VV  AVVVVVV V  A     V VVV    VV VV  
   201  197 L T  E     +E  149   0L  36  203   31     T S    ST TTTTTTTTT T TT T    ST  TTTTTTR K  S     T TSS    TT TT  
   202  198 L H  E >   - G   0 205L  18  203   19     H H    LH HHHHHHHHH H HH R    HH  QHHHHHH H  L     H HHH    HH HH  
   203  199 L K  T 3  S+     0   0  145  202   55     E Q    NN QAQEEEEDK E EE S    QE  GEDDDD  Q  S     A QQQ    DE DD  
   204  200 L T  T 3  S+     0   0   55  202   40     G G    GG GGGGGGGGG S SS G    GG  SGGGGG  N  G     G GGG    GG GV  
   205  201 L S  E <   -G  202   0L  45  180   82     S      QT  G KKHST  K LL Q     S  QHTKKK     Q     G        KH NS  
   206  202 L T  E    S+     0   0L 140  180   32     T      SS  D TTTTA  T TT P     T  TTATTT     S     D        TT TT  
   207  203 L S  E    S-     0   0L  82   83   48            P   Q          GG A        P          P     Q               
   208  204 L P  E     -     0   0L  43   67   33                E          PP                           E               
   209  205 L I  E     -G  200   0L  46   67   29                I          LL                           I               
   210  206 L V  E     +G  199   0L  70   63   53                           TT                                           
   211  207 L K  E     +G  198   0L  85   63   26                           QQ                                           
   212  208 L S  E     -G  197   0L  67   63   28                           TT                                           
   213  209 L F  E     -G  196   0L  30   63   18                           II                                           
   214  210 L N  E      G  195   0L  99   63   62                           RR                                           
   215  211 L R              0   0   82   54   19                                                                        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  192   30  QQQ D QEEQ  E         Q E  E EQEQ  QE            QQQQE     QEEQ     QQ
   218    2 H V        +     0   0   30  194   40  VDV V AVVI  V         I V  V VVVV  VV            VVIVI     IIVV     VV
   219    3 H K  E     -A  241   0A 143  197   48  TQT Q QKQQ  T         K Q  Q QHKQ  QQ            QQQQQ     SQQQ     TQ
   220    4 H L  E     -A  240   0A  11  217    3  LLL L LLLL  V         M L  L LLLL  LL       L LL LLLLL L   LLLL  L  VL
   221    5 H Q  E     -A  239   0A 120  217   73  KQK D LEVV  S         D V  L QQLQ  QV       T TT VQQQH T   TQQL  T  SQ
   222    6 H E  E     -A  238   0A   2  218   33  EQE Q QEEQ  L         Q E  Q QQEQ  QE       Q SS QQQQQ S   QQQQ  S  LQ
   223    7 H S  E     +A  237   0A  48  218   13  SSS S SASS  S         S S  S SSSP  PS       S SS SPPSS S   PSSS  S  SS
   224    8 H G        -     0   0   35  218   20  GGG E GGGG  V         P G  G GGGG  GG       E DG GGGGG D   GGGG  G  VG
   225    9 H P        -     0   0   50  218   49  PAP S PGGP  P         N G  A PAGA  TG       P SS ASAPP S   TPPP  S  PA
   226   10 H A  S    S+     0   0   30  218   51  GEG V EGGE  E         V D  E EEGE  EG       V VE EVEEE V   VEEE  E  EE
   227   11 H V  E     -d  334   0B  33  218   25  MRI V VLLL  L         V L  V LLLL  LL       V VV LLLLL V   TLLL  V  LL
   228   12 H I  E     -d  335   0B   9  218   54  LVL I KVVK  V         K V  K VVVV  VV       K KK RVVVV K   VVVV  K  VA
   229   13 H K        -     0   0  104  218   50  QKQ K LQKK  K         R K  K KRQR  KK       R RK KRKRK R   KRKK  K  KS
   230   14 H P  S    S+     0   0   56  218    9  PPP P PPPP  P         P P  P PPPP  PP       P PP PPPPP P   PPPP  P  PP
   231   15 H S  S    S+     0   0   90  218   20  SGS G GGGG  S         G G  G GGGG  GG       G GR GGGGG G   SGGG  R  SG
   232   16 H Q  S    S-     0   0   76  218   59  KAQ G AGGE  E         E G  A ATGV  AG       E EE AAAVT E   ETAA  E  EA
   233   17 H S        -     0   0   51  217   20  TST S SSST  K         T S  S SSSS  SS       S SS SSASS S   VSSS  S  TS
   234   18 H L  E     - B   0 300A   1  217   43  LVL H VMLV  L         V L  V VVLV  VL       H VV VVVVV V   LVVV  V  LV
   235   19 H S  E     - B   0 299A  64  218   51  SKS K KKKK  K         K R  K KKKK  KK       T TT KKNKK T   QKKK  T  RK
   236   20 H L  E     - B   0 298A   1  218   13  LIL L VLLI  L         M L  V VMLL  LV       L LL ILLIM L   LVLI  L  LF
   237   21 H T  E     -AB 223 297A  29  218   33  TST S SSSS  V         S S  S SSSS  SS       T SS SSSSS S   TSSS  S  AS
   238   22 H c  E     -AB 222 296A   0  219    1  CCC C CCCC  C         C C  C CCCC  CC       C CC CCCCC C   CCCC  C  CC
   239   23 H I  E     -AB 221 295A  54  217   75  SKT T NAAK  K         V V  K KKAK  KA       S TV KKKKK T   KKKK  V  KK
   240   24 H V  E     -A  220   0A   4  217   51  FAF A PAAA  V         C A  A AAAA  AA       A VV AAAGA V   VAAA  V  VA
   241   25 H S  E     +A  219   0A  60  218    9  SSS S TSSS  S         S S  S SVSS  SS       S SS PSSSS S   TSSS  S  SS
   242   26 H G  S    S+     0   0   54  218    3  GGG G DGGG  g         G G  G GGGG  GG       G GG GGGGG G   gGGG  G  gG
   243   27 H F  S    S-     0   0   37  199   23  FYF . YFFY  i         . .  Y YYFY  YL       F .. YYFYY .   lYYY  .  iY
   244   28 H S    >   -     0   0   44  200   45  SAS . KTTT  T         . .  T PTDT  TT       T .. TTSTT .   TSTT  .  TT
   245   29 H I  T 3  S+     0   0    2   56   45  L.L F ....  D         F F  . ....  ..       . I. ..... I   D...  .  D.
   246   30 H T  T 3   +     0   0   59   61   59  S.S T ....  G         S T  . ....  ..       . S. ..... S   S...  .  G.
   247   31 H R  S X  S-     0   0  145  218   53  TFT F FFFF  S         M F  F FFFF  FF       F ML FFFFF M   SFIF  L  SF
   248   32 H T  T 3  S+     0   0   72  204   59  SSY S GSST  K         T S  T TTST  TS       S SS TTTTT S   KITT  S  KT
   249   33 H N  T 3  S+     0   0   16  204   62  GGG S SNSD  I         S S  S DNKN  SN       D SL RSSDN R   IDDS  L  IS
   250   34 H Y  E <   -E  317   0C  23  220   46  MPM T YYYY  H         F N  Y YYDY  YY       Y YA YYQYY Y   YYYY  A  HY
   251   35 H d  E     -EF 316 270C   0  218   89  VWG W DWAS  A         Y Y  Y FWWW  WA       G WW WWWAY W   SNYY  W  AW
   252   35AH W  E     -EF 315 269C   1  218   43  VMV M IMMM  V         I M  I MIMM  MM       M ML MMFLM M   VIVI  L  VM
   253   35BH H  E     -EF 314 268C   0  219   73  SNG S SNSH  N         H S  H NGSN  HS       H HH HHHHH H   EYNH  H  DQ
   254   36 H W  E     +EF 313 267C   1  221    2  WWW W WWWW  Y         W W  W WWWW  WW       W WW WWWWW W   WWWW  W  FW
   255   37 H I  E     -EF 312 265C   0  221   15  IVI V VVVV  I         I I  V VVVV  VV       V II VVVVV I   VVVV  I  IV
   256   38 H R  E     -EF 311 264C  10  221   15  RKR R RRRK  R         R R  R KKRK  KR       R RR RKKKR R   RKKK  R  RK
   257   39 H Q  E     -EF 310 263C  22  220    2  QQQ Q QQQQ  Q         Q Q  Q QQQQ  QQ       Q QQ QQRQQ Q   DQQQ  Q  QQ
   258   40 H A    >   -     0   0   14  220   61  PRP A ASTA  F         K A  A SRAR  RS       V KK ARRSS K   PSSR  K  FR
   259   41 H P  T 3  S+     0   0   99  221   19  SPS P PPPP  S         P P  P HPPP  PP       P PP PPPHH P   AHHP  P  SP
   260   42 H G  T 3  S+     0   0   94  221   12  GGG G GEEG  G         G G  E GGGG  GE       G GG GGGGG G   GGGG  G  GG
   261   43 H K  S <  S-     0   0  140  221   34  KKK K QKKK  S         R K  Q KHKQ  RK       K KK QQQKK K   KKKQ  K  SQ
   262   44 H G        -     0   0   20  221   24  SGG G GGRG  T         A G  G SGGG  GR       G GG GGGSS G   GSSG  G  RG
   263   45 H L  E     -F  257   0C  10  221    9  LLL L LLLL  F         L L  L LLLL  LL       L LL LLLLL L   LLLL  L  FL
   264   46 H E  E     -F  256   0C  79  221    9  EEE Q EEEK  E         E Q  E EEEE  EE       E EE EEEEE E   EEEV  E  EE
   265   47 H W  E     +F  255   0C  13  221    9  WWW W WWWW  F         W W  W WWWW  WW       W WW WWWWW W   WWWW  W  FW
   266   48 H M  E     -     0   0C   3  221   31  LIL V MVVM  L         I V  M IIII  IV       I II VIIII I   LIII  I  LI
   267   49 H G  E     -FG 254 277C   0  221   42  AGA S GAAG  A         G S  G GGGG  GA       A GG GGGGG G   GGGG  G  AG
   268   50 H R  E     -FG 253 276C  10  221   93  ARN V WETW  H         F Q  K NDEM  RA       Y YR TEVIY Y   RYDW  R  HA
   269   51 H I  E     -FG 252 275C   3  221   16  III I IIIV  I         I I  I IIII  II       I II VIIII I   IIII  I  II
   270   52 H d  E >   -F  251   0C   0  221   83  DYW S GRSN  N         S S  F NYNH  DN       Y DD NYNSY D   IDNY  D  NY
   271   53 H Y  T 3  S+     0   0   47  221   84  WpW S llDI  Y         g S  p pPPp  PS       S ts apptP t   hppp  s  yp
   272   54 H E  T 3  S-     0   0   63  207   63  DdD d dnge  E         s d  d ngdd  nn       s .. nssyn .   dnnd  .  qd
   273   55 H G  S <  S+     0   0   25  200   53  GGD g Gysg  A         . s  S SgsS  gg       s tt GGGGg t   .GGG  t  .G
   274   56 H S        -     0   0   42  217   74  DED S NAYE  G         S S  D DFTE  DN       S TG KRRNA T   .GGN  G  GE
   275   57 H I  E     -G  269   0C  71  220   53  KTK T ATTS  T         I T  T VTIS  TT       Q AT TTTTT A   TSTT  T  TT
   276   58 H Y  E     -G  268   0C  70  221   79  YHY Y RHYV  A         S S  K ITNR  KY       Y YI INNSS Y   YSSK  I  AR
   277   59 H Y  E     -G  267   0C  41  221   17  YYY Y PYYY  L         Y Y  Y YYYL  FY       Y YF DYYYY Y   YYYY  F  LY
   278   60 H S    >>  -     0   0   11  221   61  NSN A TAPA  N         S A  A NNAD  NS       S AA ADNNN A   ANNN  A  NS
   279   61 H P  T 34 S+     0   0   76  221   51  PGP D QEDD  P         E D  Q QEPQ  ED       E QQ QEEQQ Q   QQQE  Q  SQ
   280   62 H S  T 34 S+     0   0   79  221   52  SQS S NSND  D         S A  K KKSK  KT       S SS KKKKK S   SKKK  S  AK
   281   63 H I  T X4 S+     0   0    4  221   40  LFL V FVVF  L         V V  F FFLF  FM       V LL FFFFF L   LFFF  L  LV
   282   64 H K  G >< S+     0   0  133  221   28  KKK K KKKK  K         K K  Q KKKK  RK       K QQ QKKKK Q   KKKK  Q  KK
   283   65 H S  G 3  S+     0   0  116  221   27  SGN G DGGG  S         N G  G DGDD  TG       G GG DGNGG G   GGGG  G  SG
   284   66 H R  G <  S+     0   0   51  221   18  RKR R RRRR  R         R R  R KKKK  KR       R QQ RKKKK Q   RKKK  Q  RK
   285   67 H S  E <   -C  300   0A  11  221   54  LAL F IFFF  L         F F  V AAFA  AF       F FF AAAAA F   IAAT  F  LA
   286   68 H T  E     -C  299   0A  67  221   23  TTT I NTTA  T         T T  A TTIT  TT       I TT TTTTT T   TTTT  T  TT
   287   69 H I  E     +C  298   0A   3  221   29  VLI I IIIF  W         I I  M LLIL  LI       I II MLLML I   VLLL  I  LL
   288   70 H S  E     -C  297   0A  56  221   37  STS S ISSS  S         S S  I TTST  TS       S TT TTTTT T   STTT  T  ST
   289   71 H R  E     -C  296   0A  71  221   60  KAK R KRRL  R         R R  V VARV  VR       R KK AVVVV K   RVVA  K  RA
   290   72 H D  E >>> -C  295   0A  55  221   10  NDD D DDDE  D         D D  D DDED  DD       D DD DDDDD D   DDDD  D  DD
   291   73 H T  T 345S+     0   0   78  220   57  TKT N TDNT  T         N N  K KANK  KN       N TT KTKKK T   TKKK  T  TK
   292   74 H S  T 345S+     0   0  105  220   44  SSS N SSAS  A         S A  S SSAS  PA       N SS SSSSS S   NSSS  S  AS
   293   75 H L  T <45S-     0   0  103  217   69  NSN N TKKA  K         R K  T SSKS  SK       R KK TSSSS K   KSSS  K  RS
   294   76 H N  T  <5 +     0   0   29  218   47  TSN N NSNS  N         K N  N SSNS  SS       A NN NSTST N   GNSS  N  NS
   295   77 H K  E   < -BC 239 290A  51  221   70  QTQ K ISNT  E         Q T  T TTTT  TT       Q MM TTTTT M   ETIT  M  ET
   296   78 H F  E     -BC 238 289A   1  221   60  VAA L VVLI  A         V L  A AALA  VL       L LV AAAAA L   VAAA  V  AA
   297   79 H F  E     -BC 237 288A  50  221   32  FYF Y YYYH  Y         Y Y  Y YYYY  YY       N YY YYYYY Y   YFYY  Y  YY
   298   80 H I  E     -BC 236 287A   4  221    5  LML L MLLL  L         L L  M MMLM  ML       L LL MVMMM L   LMMM  L  LM
   299   81 H Q  E     -BC 235 286A  73  221   35  KQK Q EQQQ  E         Q Q  E QQQQ  HQ       Q EE EDQEE E   KYQF  E  EQ
   300   82 H L  E     -BC 234 285A   3  221   19  ILI M MMMI  I         M M  L LLML  LM       M VI LFLLL V   LLLL  I  FL
   301   82AH I        +     0   0   70  221   58  TNT N RNSN  S         N N  S NSSS  RS       N KK TSTAR K   TNNS  K  RS
   302   82BH S  S    S-     0   0   59  221   33  SGN N GNHN  G         S S  S SSKS  SS       S SS SSSRS S   GNNS  S  GS
   303   82CH V        -     0   0    0  221   13  VLV L LLLL  M         L L  L LLVP  LL       L LL LLLLL L   MLLL  L  ML
   304   83 H T    >   -     0   0   65  221   63  DTD Q TRKK  T         R R  R TTRT  TR       K KK RTTTT K   KTTT  K  TA
   305   84 H N  G >  S+     0   0  120  221   62  IST T PASN  A         A D  A SSSS  SS       T SA ASSSS S   PSSS  A  AS
   306   85 H E  G 3  S+     0   0  160  221   21  AEA E DEEE  G         E E  E EEEE  EE       E EE EEEED E   VEDE  E  EE
   307   86 H D  G <  S+     0   0    0  221    1  DDD D DDDD  D         D D  D DDDD  DD       D DD DDDDD D   EDDD  D  DD
   308   87 H T    <   +     0   0   30  221   36  TST T TTTT  T         S T  T SSTS  ST       S TT TSSSS T   TSSS  T  TS
   309   88 H A  E    S- H   0 333C   3  221    5  AAA A AGAA  A         A A  A AAAA  AA       A AA AAAAA A   AAAA  A  AA
   310   89 H M  E     -EH 257 332C  43  221   61  TVT V TIMT  M         V V  V VILV  VF       V VV IVVIV V   VFVV  V  MV
   311   90 H Y  E     -EH 256 331C   2  221    0  YYY Y YYYY  Y         Y Y  Y YYYY  YY       Y YY YYYYY Y   YYYY  Y  YY
   312   91 H Y  E     -E  255   0C   1  221    3  YFY Y FYYF  Y         Y Y  Y YYYY  YY       Y YY YYHYY Y   YYYF  Y  YY
   313   92 H c  E     +E  254   0C   0  221    1  CCC C CCCC  C         C C  C CCCC  CC       C CC CCCCC C   CCCC  W  CC
   314   93 H S  E     -EI 253 327C   0  221   30  AAA T VTAA  A         A A  G AAAA  TV       A AA ATSAA A   AAAT  T  AA
   315   94 H R  E     -EI 252 326C  20  220   39  RRR R RRRR  S         R R  S RRRR  RR       R RK SRIRR R   TRRR  S  KR
   316   95 H E  E     -EI 251 324C   0  220   75  YGI D GRDS  G         D D  D WSFW  RG       C TE DERGG T   DEGG  H  DT
   317   96 H N  E  >> -E  250   0C   6  220   89  RNA G TGMD  Y         L T  S DGLR  GG       F SY PGGED A   GWPG  C  TF
   318   97 H H  T  45S+     0   0    0  220   93  DWT T AYGY  F         S N  G YGAD  LY       T HN VKNAL Y   GYVG  D  VY
   319   98 H M  T  45S+     0   0   73  221   94  SPT Y VGGD  A         R H  L TWYY  FF       G CY REWYR Y   GGYW  Y  HF
   320   99 H Y  T  45S+     0   0  159  221   92  YYG N LDSY  Y         S N  P YLWN  YD       V DY TFEGT F   GAYA  Y  CD
   321  100 H E  T  <5 -     0   0   54  221   92  AWY A DPPD  W         D C  G YLGN  SV       K YF VDGGG D   LWSF  F  DS
   322  100AH T      < +     0   0    0  221   92  PYY F PNYI  G         V F  F GRQL  DW       L YD HYFFL Y   YFYD  D  YW
   323  100BH Y  S    S-     0   0   10  221   92  FLW D WWGY  Q         S D  G YDGN  YG       G FY FWGSF W   FAFY  Y  FG
   324  100CH F  E     +I  316   0C   0  221   93  FDy Y Gyga  G         i Y  F aYTw  vA       w DW yGYYD G   DFsW  W  DQ
   325  101 H D  E     +     0   0C  42  133   50  D.d . .ddd  .         d .  N d..d  d.       d .. d.... .   ..d.  .  ..
   326  102 H V  E     -I  315   0C  35  153   74  YVF . .VYY  .         Y .  Y Y..V  Y.       V Y. H...Y .   Y.Y.  .  Y.
   327  103 H W  E     -I  314   0C  28  177   14  WWW W .WWW  .         W W  W WW.W  W.       W W. W.WWW .   WWW.  .  W.
   328  104 H G        -     0   0    3  204   16  GGG G .GGG  .         G G  G GGSG  GG       G GG G.GGG .   GGGG  G  GG
   329  105 H Q        -     0   0  100  183   48  QAP A QAQQ  .         K Q  Q QQ.A  Q.       N KK QQQQQ K   QQQQ  K  P.
   330  106 H G        -     0   0    3  191    7  GGG G GGGG  .         G G  G GG.G  G.       G GG GGGGG G   GGGG  G  G.
   331  107 H T  E     -H  311   0C  27  202   47  VTT T TTTT  T         T T  T TT.T  TT       T TT TTTTT T   TTTT  T  TT
   332  108 H T  E     -H  310   0C  48  208   81  MTM M LTTS  M         T L  L LT.T  SA       K KK LTLLT K   MLLT  K  MT
   333  109 H V  E     -H  309   0C   0  214   25  VVV V VVIV  V         V V  V VLVV  VV       V VV VLVVL V   VVVL  V  VL
   334  110 H T  E     -d  227   0B  16  217   44  TTT T TTTT  T         T T  T TTTT  TT       T TT TITTT T   TTTT  T  TT
   335  111 H V  E     +d  228   0B   2  218   17  VVV V VVVV  V         V V  V VVVV  VV       V VV VVVVV V   VVVV  V  VV
   336  112 H S        -     0   0   18  219   35  SSS T SSSS  T         S S  S SSSS  SS       S SS SSSSS S   TSSS  S  TS
   337  113 H S  S    S+     0   0   99  220   31  SSS S SSSS  S         S S  S ASSS  SS       S SS SSAAS S   SAAS  S  SS
   338  114 H A  S    S-     0   0   31  221   51  EEE A AEEE  V         d E  I EEEE  EE       G aa VEEEE a   AEEE  a  AE
   339  115 H K        -     0   0  143  209   69  SPS T SPSS  .         p S  D PPPP  PP       S pp DPPPP p   TSPP  p  VP
   340  116 H T        -     0   0   44  210   73  QAQ S PAAA  .         T P  P AAAA  AA       T SS PAAAA S   SAAA  S  TA
   341  117 H T  B     -J  370   0D  35  217   71  SRS K TRRR  T         Q S  N RRRR  RR       K AA NRRRR A   KRRR  A  SR
   342  118 H P        -     0   0   60  218   66  SES S SENN  a         A P  S EEEE  EE       S PP SEEEE P   SNEE  P  PE
   343  119 H P        -     0   0   13  218   31  PPP P PPPP  p         P P  L PPPP  PP       P QQ LPPPP Q   PPPP  Q  PP
   344  120 H S  E     -K  367   0E  51  218   62  TTT S KTTT  S         N N  R TTTT  TT       T SS RTTTT S   STTT  S  ST
   345  121 H V  E     -K  366   0E   6  219   45  VIV L VIII  V         V L  S IIII  II       L VV SIIII V   LIII  V  LI
   346  122 H Y  E     -K  365   0E  27  220   34  FYF F FYYY  F         F F  F YYYY  YY       F FF FYYYY F   FYYY  F  FY
   347  123 H P  E     -K  364   0E  15  220   29  PPP P PPPP  P         P P  P PPPP  PP       P GG PPPPP G   PPPP  G  PP
   348  124 H L  E     +K  363   0E   4  221    3  LLL L LLLL  L         L L  L LLLL  LL       L LL LLLLL L   LLLL  L  LL
   349  125 H A        -     0   0   10  221   68  VtV I Sttt  I         M I  S tttt  tt       V SS stttt S   Ittt  S  It
   350  126 H P        -     0   0   24  216   47  SpS S Lppp  P         P T  L pppp  pp       Q QQ qpppp Q   Sppp  Q  Sp
   351  127 H G  S    S-     0   0   16  219   75  CQC C CQRP  C         C C  Q QQQQ  QQ       C CC SQQQQ C   CPQQ  C  CQ
   352  128 H S  S    S+     0   0   99  219   60  EAE G SAAA  C         G E  S AAAA  AA       N SS TAAAA S   GAAA  S  GA
   353  129 H A        +     0   0   52  220   92  sLs E TLLL  d         P n  T LLLL  LL       P SS DLLLL S   ELLL  S  EL
   354  130 H A        +     0   0   70  136   83  l.l . ....  v         . l  . ....  ..       D .. ..... .   ....  .  ..
   355  133 H Q        +     0   0  178  159   73  S.S . Q...  D         Q S  D ....  ..       R GG ..... G   ....  G  ..
   356  134 H T    >   -     0   0   64  220   50  DSD S PSSS  F         S D  S SSSS  SS       S SS SSSSS S   SSSS  S  SS
   357  135 H N  T 3  S-     0   0  146  221   56  ESE M DSSS  N         R E  D SSSS  SS       A DD DSSSS D   MSSS  D  MS
   358  136 H S  T 3  S+     0   0   63  221   63  NDN D GDDD  D         D T  G DDDD  DD       S GG GDDDD G   DDDD  G  DD
   359  137 H M  E <   - L   0 408E  83  221   79  LPL P NPPP  S         T L  H PPPP  PP       Q SS HPPPP S   PPPP  S  PP
   360  138 H V  E     - L   0 407E  15  221   34  VVV V VVVV  V         V V  V VVVV  VV       I II VVVVV I   VVVV  I  VV
   361  139 H T  E     + L   0 406E  15  221   70  AIA T VIII  T         T A  V IIII  II       A TT VIIII T   TIII  T  TI
   362  140 H L  E     + L   0 405E   0  221   27  MIM I IIII  M         L M  I IIII  II       V LL IIIII L   IIII  L  LI
   363  141 H G  E     -KL 348 404E   0  221   30  GGG G AGGG  G         G G  G GGGG  GG       G GG GGGGG G   GGGG  G  GG
   364  142 H e  E     -KL 347 403E   1  221    0  CCC C CCCC  C         C C  C CCCC  CC       C CC CCCCC C   CCCC  C  CC
   365  143 H L  E     -KL 346 402E   2  221   33  LLL L LLLL  L         L L  M LLLL  LL       L LL MLLLL L   LLLL  L  LL
   366  144 H V  E     -KL 345 401E   1  221   49  AIA A VIII  V         A A  V IIII  II       A AA VIIII A   AIII  A  AI
   367  145 H K  E     -KL 344 400E  38  220   74  RHR K QHHH  T         V R  Q HHHH  HH       L KK QHHHH K   KHHH  K  KH
   368  146 H G  E    S+     0   0E  19  221   50  DDD D GDDD  G         D D  D DDDD  DD       D GG DDDDD G   DDDD  G  GD
   369  147 H Y  E     - L   0 399E   0  221   18  FYF F FYYY  Y         F F  F YYYY  YY       F FF FYYYY F   FYYY  F  FY
   370  148 H F  B     +J  341   0D   3  221   42  LFL L FFFF  M         T L  F FFFF  FF       F SS FFFFF S   LFFF  S  LF
   371  149 H P  S    S-     0   0    0  221   37  PpP P pppp  A         P P  p pppp  pp       P pp ppppp p   Pppp  p  Pp
   372  150 H E  S    S+     0   0   53  211   46  SgS E eggg  D         S G  e gggg  gg       E dd egggg d   Eggg  d  Dg
   373  151 H P        +     0   0   59  219   54  STS T PTTT  P         S S  S TTTT  TT       S SS STTTT S   TTTT  S  ST
   374  152 H V        -     0   0   20  221   53  IMI I LMMM  L         L I  V MMMM  MM       L LL VMMMM L   IMMM  L  IM
   375  153 H T  E     +N  422   0F  83  220   71  SNS S SNNN  D         T T  N NNNN  NN       T NN NNNNN N   SNNN  N  SN
   376  154 H V  E     +N  421   0F  23  221   43  FVF F VVVV  I         F F  V VVVV  VV       Y FF VVVVV F   FVVV  F  FV
   377  156 H T  E     -N  420   0F  48  221   56  STS T TTTT  Q         S S  T TTTT  TT       Q KK TTTTT K   TTTT  K  ST
   378  157 H W  E > >S-NO 419 383F   2  221    0  WWW W WWWW  W         W W  W WWWW  WW       W WW WWWWW W   WWWW  W  WW
   379  162 H N  G > 5S-     0   0   38  221   69  nGn g sGGG  N         t k  D GGGG  GG       S kk DGGGG k   gGGG  k  eG
   380  163 H S  G 3 5S-     0   0   91  218   63  nKn n sKKK  D         s l  H KKKK  KK       . pp HKKKK a   nKKK  p  nK
   381  164 H G  G < 5S+     0   0   39  218   55  TST A GSSS  G         N S  K SSSS  SS       . AA KSSSS G   ASSS  A  TS
   382  165 H S  T < 5 +     0   0   93  221   60  EGE S QGGG  S         N A  G GGGG  GG       N GG GGGGG K   SGGG  G  SG
   383  166 H L  B   < +O  378   0F  43  221   87  VKV Y GKKK  I         L I  K KKKK  KK       Q KK KKKKK D   YKKK  K  IK
   384  167 H S        +     0   0   88  221   69  MDM S VDDD  T         E N  G DDDD  DD       G DD GDDDD L   SDDD  D  SD
   385  168 H S  S    S+     0   0  101  221   77  QIQ T TIII  T         N n  T IIII  II       S ll TIIII S   TIII  l  NI
   386  169 H G  S    S+     0   0   32  218   43  GTG G ATTT  G         . d  S TTTT  TT       Q dd STTTT D   GTTT  d  GT
   387  171 H V        +     0   0   48  219   62  VTV L RTTT  I         I I  V TTTT  TT       S FF VTTTT F   LTTT  F  VT
   388  172 H H  E     -M  404   0E  17  220   80  RVR K NVVV  K         T K  M VVVV  VV       E VV MVVVV V   KVVV  V  KV
   389  173 H T  E     -M  403   0E  69  220   82  TNT S FNNN  T         Q T  N NNNN  NN       Q QQ NNNNN Q   SNNN  Q  SN
   390  174 H F  E     -M  402   0E   1  219   43  FFF Y PFFF  M         Y F  F FFFF  FF       Y YY FFFFF Y   YFFF  Y  YF
   391  175 H P  E     -     0   0E  65  219   32  PPP K PPPP  R         P P  P PPPP  PP       P PP PPPPP P   KPPP  P  RP
   392  176 H A  E     -     0   0E  19  215   65  TPT P SPPP  P         S S  P PPPP  PP       V AA PPPPP A   PPPP  A  PP
   393  177 H V  E     -M  400   0E  42  214   63  LAL V QAAA  V         I V  V AAAA  AA       I FF VAAAA F   VAAA  F  VA
   394  178 H L  E     -M  399   0E  77  214   65  RLR M DLLL  L         L L  H LLLL  LL       A GG HLLLL G   MLLL  G  ML
   395  179 H Q  S    S-     0   0   83  214   70  TAT Q AAAA  s         K R  V AAAA  AA       K KK VAAAA K   QAAA  K  QA
   396  180 H S  S    S-     0   0  116  214   49  GsG s ssss  v         N E  a ssss  ss       D EE assss E   ssss  E  as
   397  183 H D  S    S+     0   0   90  206   25  DgD g dggg  g         D G  g gggg  gg       G GG ggggg G   gggg  G  gg
   398  184 H L        -     0   0   53  199   75  KRK T LRGR  L         K K  L RRRR  RR       S DD LRRRR D   TRRR  D  TR
   399  185 H Y  E     -LM 369 394E  36  205    2  YYY Y YYYY  Y         Y Y  Y YYYY  YY       F YY YYYYY Y   YYYY  Y  YY
   400  186 H T  E     +LM 367 393E   5  195   48  TTT S TTTT  T         L V  T TTTT  TT       S TT TTTTT T   STTT  T  ST
   401  187 H L  E     -L  366   0E  11  190   56  AMA A TMMM  L         G A  M MMMM  MM       R KK MMMMM K   AMMM  K  AM
   402  188 H S  E     -LM 365 390E   5  191   26  TST S SSSS  S         I T  S SSSS  SS       V II SSSSS I   SSSS  I  SS
   403  189 H S  E     -LM 364 389E   2  191    0  SSS S SSSS  S         S S  S SSSS  SS       S SS SSSSS S   SSSS  S  SS
   404  190 H S  E     -LM 363 388E   0  191   77  QQQ Q QQQQ  Q         Q Q  Q QQQQ  QQ       L HH QQQQQ H   QQQQ  H  QQ
   405  191 H V  E     -L  362   0E   0  190   27  VLV V LLLL  L         V V  L LLLL  LL       I II LLLLL I   VLLL  I  IL
   406  192 H T  E     +L  361   0E  48  189   37  LTL N TTTT  T         E F  T TTTT  TT       R RR TTTTT R   NTTT  R  NT
   407  193 H V  E     -L  360   0E  14  188   30  LLL V LLLL  I         F L  L LLLL  LL       V VV LLLLL V   VLLL  V  IL
   408  194 H P  E  >  -L  359   0E  56  188   40  SPS A PPPP  L         Y P  P PPPP  PP       S KK PPPPP R   APPP  K  TP
   409  195 H S  T  4 S+     0   0   49  187   50  AAA S AAAA  A         S S  A AAAA  AA       K KK AAAAA K   SAAA  K  LA
   410  196 H S  T  4 S+     0   0   66  187   69  KVK A TVVV  S         K V  D VVVV  VV       T SS DVVVV S   AVVV  S  EV
   411  198 H P  T  > S+     0   0   31  187   72  nEn V qEEE  E         d d  Q EEEE  EE       D DD QEEEE D   VEEE  D  QE
   412  199 H R  T  < S+     0   0   16  187  102  eCe W lCCC  W         k q  C CCCC  CC       W WW CCCCC W   WCCC  W  WC
   413  200 H P  T  4 S+     0   0   80  188   68  GPG D APPP  K         K G  P PPPP  PP       D II PPPPP D   DPPP  I  EP
   414  202 H S  T  4 S+     0   0  111  188   69  SES N GEEE  N         V S  A EEEE  EE       A DD AEEEE A   NEEE  D  SE
   415  203 H E  S  < S-     0   0  128  188   76  DGD I KGGG  S         K D  K GGGG  GG       G TT KGGGG K   IGGG  T  TG
   416  204 H T        -     0   0   83  188   70  eee e Seee  T         k e  g eeee  ee       k kk geeee k   eeee  k  te
   417  205 H V        +     0   0    4  184   61  lvl f Vvvv  Y         r i  q vvvv  vv       y yy qvvvv y   fvvv  y  lv
   418  206 H T  E     - P   0 433F  23  183   70  VKV Y TKKK  K         I T  K KKKK  KK       N TT KKKKK T   YKKK  T  SK
   419  208 H e  E     -NP 378 432F   0  187    0  CCC C CCCC  C         C C  C CCCC  CC       C CC CCCCC C   CCCC  C  CC
   420  209 H N  E     -NP 377 431F   4  187   60  KSK N HSSS  K         E N  H SSSS  SS       S EE HSSSS E   NSSS  E  VS
   421  210 H V  E     -NP 376 430F   1  187   16  IVI A VVVV  V         V V  V VVVV  VV       V AA VVVVV A   AVVV  A  AV
   422  211 H A  E     -NP 375 429F  14  187   74  HQH K KQQQ  V         Q K  Q QQQQ  QQ       S SS QQQQQ S   KQQQ  S  TQ
   423  212 H H  E > > - P   0 428F   1  187    7  HHH H HHHH  H         G H  H HHHH  HH       H NN HHHHH N   HHHH  N  KH
   424  213 H P  G > 5S+     0   0   77  177   83  GDG L YDDD  N         P S  N DDDD  DD       K SS NDDDD S   LDDD  S  YD
   425  214 H A  G 3 5S+     0   0   40  177   67  NSN D TSSS  Y         G N  S SSSS  SS       G VV SSSSS V   DSSS  V  CS
   426  215 H S  G < 5S-     0   0   32  176   64  KNK T NNNN  T           G  S NNNN  NN       Q GG SNNNN G   TNNN  G  TN
   427  216 H S  T < 5 +     0   0  111  176   72  NPN I PPAP  N           D  P PPPP  PP       S AA PPPPP A   IPPP  A  SP
   428  217 H T  E   < +P  423   0F  35  176   66  KVK K SVVV  T           K  S VVVV  VV       K PP SVVVV P   KVVV  P  TV
   429  218 H K  E     +P  422   0F 135  176   53  DQD S QQQQ  K           S  Q QQQQ  QQ       H KK QQQQQ K   SQQQ  K  DQ
   430  219 H V  E     -P  421   0F  38  125   32  L L V       Q           V                   V TT       T   V     T  T 
   431  220 H D  E     -P  420   0F  97  125   35  H H E       E           N                   T AA       A   E     A  E 
   432  221 H K  E     -P  419   0F  51  113   47  V V L       K           V                   L              L        K 
   433  222 H K  E     -P  418   0F 121  113   52  P P K       S           P                   K              K        T 
   434  223 H I        -     0   0    4  109   32  I I K       L           I                                  K        I 
   435  224 H V        -     0   0   79  101   61  P P D                   T                                  D          
   436  225 H P              0   0   73   92   66  A A P                                                      P          
   437  226 H R              0   0  167   78   25                                                                        
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    1 L D              0   0  100   71   31                                            Q                           
     2    2 L I        -     0   0    0   77   33                                       II   I     I                 I   
     3    3 L V        -     0   0   88   83   53                        V       V      VV   T     V       V      V  VV  
     4    4 L M  E     -Q   25   0G  12   86   20                        L       L      LL   V    ML       L   M  V  LL  
     5    5 L T  E     -Q   24   0G  80   86   17                        T       N      TT   T    LT       T   L  T  TT  
     6    6 L Q  E     -Q   23   0G  19   86    6                        Q       Q      QQ   Q    DQ       Q   N  Q  QQ  
     7    7 L S  E    S+Q   22   0G  57   86   54                        K       T      TT   S    QT       K   Q  K  TK  
     8    8 L P        -     0   0   47  128    7   P          P  P   P  P   PP  P   P  PP   P    PP       P   P  P  PP  
     9    9 L A  S    S-     0   0   79  136   69   V          A  P   A  P   PP  I  AP  AA   S    PA       P   P  P  AP  
    10   10 L S  E     -t  107   0H  78  142   56   S          V  S   V  V   SS  S  SS  VV   S    SV       G   F  V  VV  
    11   11 L L  E     -t  108   0H  34  176   45   E     VL   I  V   I  L   LL  DV VM  HH   K   VVH       L   V VV  HL  
    12   12 L V  E     +t  109   0H  86  187   34   SS    SS   T  A   T  ST  SS  PS SS  SS   S   SSS       S   S ST  PS  
    13   13 L V  E     -t  110   0H  17  189   58   VV    GG   S  S   S  VV VAA  VV VS  VV   V   VSV       V   S VL  VV  
    14   14 L S  E >   -t  111   0H  46  199   61   KK    TS   T  F   T  RS SSS  SL SS  PS   L   LPP       R   P LR  PS  
    15   15 L L  T 3  S+     0   0   79  198   66   LL    PP   P  L   P  KP PPP  AP VL  TT   P   PLT       K   L PK  TK  
    16   16 L G  T 3  S+     0   0   39  206    7   RG    GG   G  G  GG  GG GGG  GG GG  GG   G   GGG       G   G GG  GG  
    17   17 L Q    <   -     0   0   97  206   52   EE    QA   S  A  TS  EG GAA  EG GT  QQ   E   GTQ       E   T GE  QD  
    18   18 L R        -     0   0  152  206   62   TT    SS   T  T  AT  TT TTT  TS TT  EE   S   STE       T   T ST  ET  
    19   19 L A  E     - R   0  79G   2  206   44   VV    VA   V  V  VV  AV VAA  SV VI  VV   I   VVV       A   I VA  VA  
    20   20 L T  E     - R   0  78G  66  207   59   RR    TR K A  R  RA  TT TRR  EG TR  VV   T   GRV       T   R GT  VT  
    21   21 L I  E     - R   0  77G   0  207   22   II    IL L L  L  LL  ML LLL  LL LL  LL   I   LLL       M   L LM  LM  
    22   22 L S  E     -QR   7  76G  36  207   50   SS    ST T T  A  TT  DT TTT  KS TP  NN   T   SAN       D   A SD  ND  
    23   23 L a  E     -QR   6  75G   0  207    0   CC    CC C C  C  CC  CC CCC  CC CC  CC   C   CCC       C   C CC  CC  
    24   24 L R  E     -QR   5  74G 153  207   75   TT    TT T K  T  TK  NG GTT  AS ET  NN   R   STN       N   T SN  NN  
    25   25 L A  E     -Q    4   0G   6  207   68   LL    GL L T  L  LT  LH HLL  MW GL  II   T   WLI       L   L LL  IL  
    26   26 L S  S    S+     0   0   63  207   52   SS    TR S N  S  RN  GN NNN  QT DS  QQ   S   TSQ       G   S TG  QG  
    27   27 L E  S    S-     0   0  105  207   72   GG    SS S P  S  SP  TT TSS  NG NR  RR   S   GRR       T   R GT  RT  
    28   27AL S        -     0   0   29  207   74   AY    SD A a  D  Da  VG Ggg  GG ID  YD   S   GDY       V   D GV  DV  
    29   27BL V        +     0   0    0   57   77   ..    .I . h  .  .h  .A Avv  KS ..  ..   V   SH.       T   Y ST  ..  
    30   27CL D  E     +Z   35   0I  45   79   82   S.    D. . r  H  Hr  D. ...  M. .H  DD   S   .dD       .   d ..  DN  
    31   27DL S  E >  S+Z   34   0I  15  116   82   IS    VS H g  D  Ng  NV VVV  .V .D  ..   .   Vi.       .   i V.  ..  
    32   28 L Y  T 3  S-     0   0  173  119   89   SI    GV K Q  V  IQ  TT TEE  .T .V  ..   .   TY.       .   Y T.  .I  
    33   29 L G  T 3  S+     0   0   81  200   60   GS    GG T s  N  Gs  VS SGG  GG AG  GG   .   GS.       G   N GG  GS  
    34   30 L K  E <  S-Z   31   0I 112  170   77   .D    YS . s  L  Fs  .E D..  ST SI  ..   .   G.S       .   . D.  ..  
    35   31 L S  E     -Z   30   0I   7  186   77   YR    NK Y H  H  YH  .H HYY  YN KY  NY   N   N.N       S   . NS  H.  
    36   32 L F        +     0   0    5  198   68   HA    AT Y C  S  SC  .Y YHH  YH YN  YS   Y   Y.Y       Y   . YG  YN  
    37   33 L M  E     -U   94   0H   0  205   51   VV    VI I M  I  IM  .P PII  MP VI  VV   M   PIV       C   I PV  VA  
    38   34 L H  E     -U   93   0H   0  207   81   NH    SF E S  Y  FS  RS SNN  SN HY  HS   S   AYS       R   Y NR  SR  
    39   35 L W  E     -UV  92  52H   0  207    0   WW    WW W W  W  WW  WW WWW  WW WW  WW   F   WWW       W   W WW  WW  
    40   36 L Y  E     -UV  91  50H   0  207   13   YF    YY Y Y  Y  YY  YF FFF  YI YY  YY   Y   VYY       Y   Y IY  YY  
    41   37 L Q  E     -UV  90  49H   4  207   25   QQ    QQ Q Q  Q  QQ  KQ QQQ  RH QQ  KK   Q   YQK       K   Q HK  KK  
    42   38 L Q  E     -U   89   0H  16  207   13   QQ    QQ Q Q  Q  QQ  QQ QKK  QQ QQ  QQ   Q   QQQ       Q   Q QQ  QQ  
    43   39 L K    >   -     0   0   47  207   59   KK    HK Q K  R  RK  IK KKK  RT MR  VV   K   TRV       I   R TI  VI  
    44   40 L P  T 3  S+     0   0   81  207   39   sa    PS Q P  p  PP  PS SPP  PP LP  pp   P   TPp       p   P TP  pp  
    45   41 L G  T 3  S+     0   0   58  206   20   nn    GE G G  h  GG  GG GGG  GG PG  ee   G   GGe       g   G GG  eg  
    46   42 L Q  S <  S-     0   0  103  207   70   RR    SS E Q  R  QQ  GR RSS  ES SH  AA   Q   SHA       V   H SG  AS  
    47   43 L P        -     0   0   34  207   58   PP    AA A P  P  PP  VA APP  AI AP  PP   A   IPP       P   P IV  PP  
    48   44 L P        -     0   0    5  207   20   RR    PP P P  R  PP  PP PPP  PP PP  QQ   P   PPQ       Q   P PP  QQ  
    49   45 L K  E     -V   41   0H  96  207   71   YY    KR R Q  F  RQ  QT TRR  VK RR  YY   K   KRY       F   R KQ  YF  
    50   46 L V  E     +V   40   0H  10  207   43   LL    LY Y L  L  FL  YT TFF  WL LF  VV   L   LFV       V   F LF  VV  
    51   47 L L  E     +     0   0H   2  207   26   LL    ML L L  L  LL  VL LLL  VA IL  LL   L   VLL       L   L VV  LL  
    52   48 L I  E     -VW  39  58H   0  207   24   RW    IL M V  R  LV  LI ILL  LV IL  SS   L   ILR       Y   L Vl  rR  
    53   49 L Y  E  >  + W   0  57H  54  207   35   FF    YY Q R  Y  RR  SY YRR  AG YR  FF   Y   GRF       F   R Gf  yF  
    54   50 L I  T >4 S-     0   0   10  207   91   yn    Dy l H  f  yH  wD Dff  hs Ry  dy   A   syh       y   y si  hy  
    55   51 L A  T 34 S+     0   0    2  207   75   ns    Vs g V  d  lV  sI Iss  gg Ds  ss   V   gsn       s   s gs  sg  
    56   52 L S  T 34 S+     0   0   73  207   57   KK    Sd s R  K  dR  PD Ddd  sn SD  as   T   nDa       s   d ns  ps  
    57   53 L N  E <<  -W   53   0H  77  205   73   HH    Sh t I  R  hI  T. .yd  yn NN  vd   S   nKe       t   s nn  st  
    58   54 L L  E     -W   52   0H  63  207   64   QQ    RQ K N  Q  QN  YK KQQ  RY RN  FF   R   YRF       Y   Q YY  RY  
    59   55 L E    >   -     0   0   49  207   82   GG    PG G H  G  GH  GK KGG  GR PQ  GG   Q   RQG       G   G RG  GG  
    60   56 L S  T 3  S+     0   0  107  207   43   DD    SS T S  H  PS  SS SSS  TP TG  SS   S   PGS       S   F PS  SS  
    61   57 L G  T 3  S+     0   0   67  207   15   GG    GG G G  K  KG  gg gGG  Gs Gs  gg   G   spg       g   K sg  gg  
    62   58 L V    <   -     0   0   17  207   42   VV    VV V T  V  VT  st tVV  Ft Ii  ss   V   tvs       s   I ts  ss  
    63   59 L P    >   -     0   0   62  207   24   PP    SP P A  P  PA  SP PPP  TP PP  SS   S   SPS       S   P PS  SA  
    64   60 L A  T 3  S+     0   0   99  207   57   DD    NS D A  P  PA  SA ASN  DE EP  DD   D   EPD       P   P EP  DP  
    65   61 L R  T 3  S+     0   0   30  207    7   RR    RR R R  R  RR  KR RRR  RR RR  RR   R   RRR       K   R RK  RK  
    66   62 L F  E <   -S   79   0G   7  207    2   FF    FF F F  F  FF  FF FFF  FF FF  FF   F   FFF       F   F FF  FF  
    67   63 L S  E     -S   78   0G  59  207   17   SS    SS S S  S  SS  TS SSS  KT SS  NN   S   TSN       T   S TT  NT  
    68   64 L G  E     +S   77   0G  17  207    7   gg    Gg G G  g  gG  sG Ggg  pG Gg  ss   G   Ggs       s   g Gs  ss  
    69   65 L S  E     +S   76   0G  48  207   40   dd    Sd S S  d  dS  hS Sdd  dA Td  ss   R   Ads       h   d Ah  sh  
    70   66 L G  E     -S   75   0G  35  207   76   SS    KA S G  L  VG  QI ISS  TI NL  SS   G   IVS       Q   V IQ  SQ  
    71   67 L S  E >   +S   74   0G  68  206   22   PP    SS S S  A  SS  SV VSS  ST SA  SS   S   TAS       S   A TS  SS  
    72   68 L R  T 3  S-     0   0  163  206   33   NN    GA G S  K  RS  TG GAA  SG GK  DD   G   GES       T   K GT  DT  
    73   69 L T  T 3  S+     0   0   51  206   59   NN    NN A T  N  NT  TG GNN  NG NN  TT   T   GNT       T   N GS  TT  
    74   70 L D  E <   +RS  24  71G  77  206   64   IV    TA D D  T  QD  DK KAA  SK TT  EE   D   KTE       D   T KD  ED  
    75   71 L F  E     -RS  23  70G   0  206   82   GG    AG R F  G  GF  YG GGG  HA AG  YY   F   AGY       Y   G AY  YY  
    76   72 L T  E     -RS  22  69G  33  206   58   YY    SL Y T  Y  YT  CA ALL  IV SY  QQ   S   VYQ       R   Y VR  QR  
    77   73 L L  E     -RS  21  68G   0  206    3   LL    LL L L  L  LL  LL LLL  LL LL  FF   F   LLF       L   L LL  FL  
    78   74 L T  E     -RS  20  67G  28  206   44   TT    TL I T  S  ST  IT TTT  TS QS  II   T   SSI       I   S SI  II  
    79   75 L I  E     -RS  19  66G   0  206    3   II    II I I  I  II  IL LII  II II  II   I   III       I   I II  II  
    80   76 L D  S    S+     0   0   68  206   39   KK    SS S S  A  SS  NS SSS  GS SS  KK   S   SSK       S   S SN  KK  
    81   77 L P  S    S-     0   0   51  206   60   GG    GG S G  E  EG  NG GGG  SR GE  RR   N   RGR       N   G RN  RN  
    82   78 L V        +     0   0    0  206   50   AA    LL V V  L  LV  VA ALL  LA AL  LS   V   ALS       V   L AV  SV  
    83   79 L E    >   -     0   0   93  206   33   LL    QQ Q Q  Q  QQ  EQ QQQ  EQ QQ  EE   Q   QQE       E   Q QE  EE  
    84   80 L A  G >  S+     0   0   22  206   52   LL    AP A T  A  PT  EP PPP  PA AP  TT   T   APT       E   P AE  TE  
    85   81 L D  G 3  S+     0   0   58  206   27   EE    EE E Q  E  EQ  RE EEE  GE GE  GG   E   EEG       G   E EG  GG  
    86   82 L D  G <   +     0   0    1  206    0   DD    DD D D  D  DD  DD DDD  DD DD  DD   D   DDD       D   D DD  DD  
    87   83 L A    <   +     0   0   12  206   78   DD    EE E E  E  EE  SE EEE  SD EE  YS   A   DES       S   E DS  SS  
    88   84 L A  E    S- X   0 108H   8  206   19   AA    VA A A  A  AA  AA AAA  AG AA  AA   G   GAA       A   A GA  AA  
    89   85 L T  E     -UX  42 107H  35  207   69   DD    DD D V  V  IV  VD EDD  VV DV  QQ   D   TMQ       V   M VV  QV  
    90   86 L Y  E     -UX  41 106H   0  207    5   YY    YY Y Y  Y  YY  YY YYY  YY YY  YY   Y   YYY       Y   Y YY  YY  
    91   87 L Y  E     -U   40   0H   9  207    7   YY    YY I Y  F  YY  YY YYY  YY YF  YY   Y   YYY       Y   Y YY  YY  
    92   88 L a  E     -U   39   0H   0  207    4   CC    CC C C  C  CC  CC CCC  CC CC  CC   C   CCC       C   C CC  CC  
    93   89 L Q  E     -UY  38 102H   1  207   79   NA    SE G L  A  AL  QW WGG  AA QA  QQ   Q   AAQ       K   S VN  QK  
    94   90 L Q  E     +UY  37 101H   0  207   84   Ti    SA v G  v  LG  Tl vAT  AL Vv  TT   Q   LvT       T   l LT  TT  
    95   91 L N        +     0   0    0  185   59   Wy    YW . Y  t  WY  Wy yWW  WW W.  WW   .   W.W       W   f WW  WH  
    96   92 L N  S    S+     0   0    1  190   79   hs    ad . n  p  gn  ds shh  dt d.  dd   .   t.d       d   q td  dd  
    97   93 L E  S    S-     0   0   48  189   80   ss    tt c t  p  pt  v. .ta  t. ga  at   .   ase       s   s ae  ee  
    98   94 L D  S    S+     0   0   42  192   76   YL    VV Y F  W  MF  I. .FV  F. lW  LV   .   FlV       V   L LY  VY  
    99   95 L P  S    S-     0   0   26  108   72   ..    .. . T  .  ..  Ta a..  .a w.  ..   .   .g.       A   . ..  ..  
   100   96 L P        -     0   0    4  141   88   .H    .. . Q  F  F.  VR R..  .W GF  W.   .   .T.       V   H ..  ..  
   101   97 L T  E     -Y   94   0H  26  181   65   II    VV V T  T  VT  VV VV.  TI WV  VV   .   IA.       V   T IV  VV  
   102   98 L F  E     -Y   93   0H  26  205    9   FF    FS F F  F  FH  FF FFF  FF WF  FF   .   FLF       F   Y FF  FS  
   103   99 L G        -     0   0    3  207   13   GG    WG G N  G  GS  GG GGG  GG AS  GG   G   GGG       G   T GG  GQ  
   104  100 L A        -     0   0   81  207   63   GG    GG G L  S  SG  QG GGG  PG VE  QQ   Y   GGQ       Q   E GQ  QQ  
   105  101 L G        -     0   0   12  207   10   GG    TG G S  G  GC  GG GGG  GG AG  GG   S   GGG       G   G GG  GG  
   106  102 L T  E     - X   0  90H   0  207   10   TT    ET T T  T  TS  TT TTT  TT ST  TT   T   TPT       T   T TT  TT  
   107  103 L K  E     -tX  10  89H  74  207   54   QQ    TR Q Q  K  QK  KQ QQQ  AQ MQ  KK   P   QAK       K   Q QK  KK  
   108  104 L L  E     +tX  11  88H   2  206   19   LL    KL L X  V  LI  LL LVL  LL LL  LL   L   LLL       L   L LL  LL  
   109  105 L E  E     -t   12   0H  14  207   67   TT    TP T L  T  TT  IT TTT  ST QT  IT   T   TNI       I   T TI  TI  
   110  106 L M  E     -t   13   0H   0  207   27   VV    CF V I  I  VT  VV VVV  LV KV  VV   V   VVV       V   V VV  VV  
   111  107 L R  E     +t   14   0H 126  207   85   LL    PQ T V  P  LG  TL LLL  RI HL  TT   I   LLT       T   L IT  TT  
   112  108 L R        -     0   0   64  207   79   tt    gr G d  D  GV  SS GGG  st WG  SS   Q   tGS       G   G tS  SS  
   113  109 L A        -     0   0   71  198   67   dd    sq Q g  Q  Q.  SQ QQQ  ed .Q  SS   .   dQS       S   Q dS  SS  
   114  110 L D        -     0   0   58  203   71   VV    Gp p V  p  p.  sp ppp  DV .p  ss   .   Vps       s   p Vs  ss  
   115  111 L A  B     -A  144   0J  19  204   57   KK    Sa v V  f  aV  ps sss  RK .s  rr   .   Ksr       p   s Kp  rp  
   116  112 L A        -     0   0   40  206   62   AA    LA T R  P  SR  PA AAA  KA GA  PP   .   AAP       P   A AS  PP  
   117  113 L P        -     0   0    9  206    1   PP    SP P P  P  PP  PP PPP  PP GP  PP   .   PPP       P   P PP  PP  
   118  114 L T  E     -B  141   0K  85  206   55   SS    AS S T  S  ST  VT TTT  SS PS  VV   .   SSV       V   L SV  VV  
   119  115 L V  E     -B  140   0K   8  206   18   VV    MV V L  V  VL  LV VVV  VV WV  LL   .   VVL       L   V VL  LL  
   120  116 L S  E     -B  139   0K  17  206   69   SS    KT I T  T  TT  TT TTT  LS IT  TT   .   STT       T   M ST  TT  
   121  117 L I  E     -B  138   0K  22  207   30   II    ML L V  L  LV  VL LLL  LI SL  VV   T   ILV       V   L IV  VV  
   122  118 L F  E     -B  137   0K   4  207    7   FF    FF F L  F  FL  FF FFF  LF IF  FF   N   FFF       F   F FF  FF  
   123  119 L P        -     0   0    5  207   23   PP    PP P P  P  PP  PP PPP  PA PL  PP   T   APP       P   L AP  PP  
   124  120 L P        -     0   0    1  207    4   PP    PP P P  P  PP  PP PPP  PP KP  PP   K   PPP       P   P PP  PP  
   125  121 L S    >>  -     0   0    8  207    4   SS    SS S S  S  SS  SS SSS  SS NF  SS   T   SSS       S   F SS  SS  
   126  122 L S  H 3> S+     0   0   78  207   65   VV    SS S P  T  SP  ST TTT  SE KS  SS   N   EAS       S   S ES  SS  
   127  123 L E  H 3> S+     0   0   76  207   23   EE    EE E E  E  EE  AE EEE  EE GE  AA   C   EEA       A   E EA  AA  
   128  124 L Q  H <4>S+     0   0    8  207   27   EE    EE E E  E  EE  EE EEE  EE IE  EE   T   EEE       E   E EQ  EE  
   129  125 L L  H ><5S+     0   0   29  207   22   II    LL L L  L  LL  LL LLL  II LL  LL   L   ILL       L   L IL  LL  
   130  126 L T  H 3<5S+     0   0  111  207   71   AA    QQ K Q  S  KQ  QS SSS  DA QG  QQ   N   AHQ       Q   R AQ  QQ  
   131  127 L S  T 3<5S-     0   0   83  207   67   TT    AA D Q  T  AQ  SN NNN  ST TA  SS   A   TTS       S   A TS  SA  
   132  128 L G  T < 5S+     0   0   34  207   53   KK    NN N G  Y  NG  NN NNN  GK PN  NN   D   KNN       N   N KN  NN  
   133  129 L G  E   < - C   0 186K  21  205   60   KK    KK K S  T  KS  TK KKK  WK HK  KK   K   KKK       T   K KK  ..  
   134  130 L A  E     - C   0 185K   0  207   13   AA    AA A A  A  AA  AA AAA  AA LA  AA   I   AAA       A   A AA  KT  
   135  131 L S  E     - C   0 184K   2  207   38   TT    TT T T  T  TT  ST TTT  TT ST  SS   I   TTS       S   I TS  AA  
   136  132 L V  E     - C   0 183K   0  207   28   VV    LL L L  L  LL  LL LLL  LV LL  LL   L   VLL       L   L VL  SS  
   137  133 L V  E     -BC 122 182K   0  207   12   VV    VV V V  V  VV  VV VVV  SV VV  VV   A   VVV       V   V VI  LL  
   138  134 L b  E     -BC 121 181K   0  207    3   CC    CC C C  C  CC  CC CCC  CC CC  CC   N   CCC       C   C CC  VV  
   139  135 L F  E     -BC 120 180K   0  207   31   SS    LL L L  L  LL  LL LLL  LS SL  LL   I   SLL       L   L SI  CC  
   140  136 L L  E     -BC 119 179K   0  206   48   LL    II I A  I  IA  SM MMM  VL LI  S.   T   LIS       S   I Ls  LL  
   141  137 L N  E     -B  118   0K   2  207   48   SS    SS N S  S  NS  SS SSS  SS SS  SS   I   SSS       S   S Sp  SS  
   142  138 L N  E    S+     0   0K  49  207   47   DD    DD D G  D  DG  QD DDD  RD DD  QS   H   DDQ       Q   D DS  SS  
   143  139 L F  E     - C   0 177K   0  207   30   FF    FF F G  F  FG  SF FFF  FF FF  SQ   V   FFS       S   F FE  QQ  
   144  140 L Y  B    S+A  115   0J   9  206   40   TT    YY Y S  Y  YS  VY YYY  KT TY  GS   S   TY.       V   Y TS  SS  
   145  141 L P  S    S-     0   0   18  207    7   PP    PP P P  P  PP  PP PPP  PP PP  PG   R   PPG       P   P PK  GV  
   146  142 L K  S    S+     0   0   83  206   75   RR    GG R S  G  AS  .G GGG  GR RG  FP   G   RGP       F   G RG  PS  
   147  143 L D        +     0   0  116  207   72   GG    AA T Q  N  TQ  FA AAA  FG GS  AF   Q   GSF       A   N GF  FF  
   148  144 L I        -     0   0   19  206   60   AA    VV V W  V  IW  AV VVV  VA AL  .A   I   AVA       D   L AA  AA  
   149  145 L N  E     -E  201   0L  82  207   67   TT    TT K K  T  VK  DT TTT  RT TK  DD   T   TTD       V   T TD  DD  
   150  146 L V  E     -E  200   0L  27  207   11   VV    VV V L  V  VL  VV VVV  VV VV  VV   V   VVV       S   V VV  VV  
   151  147 L K  E     -E  199   0L  53  207   75   KK    AA N S  A  AS  SA AAA  LK KA  TT   T   KAT       W   T KS  TS  
   152  148 L W  E     +E  198   0L   3  207    2   WW    WW W W  W  WW  WW WWW  WW WW  WW   Q   WWW       L   W WW  WW  
   153  149 L K  E     +EF 197 158L  76  207   39   LL    KK K K  K  KK  LK KKK  RL QK  MM   S   LKM       A   K LL  ML  
   154  150 L I  E    S-E  196   0L   0  207   67   VV    AA A V  A  AV  AE EEE  VV VA  SS   P   VAS       G   A VL  SA  
   155  151 L D  S    S-     0   0   71  207   19   DD    DD D G  D  NG  AN NNN  DD DD  GG   S   DNG       G   D DG  GG  
   156  152 L G  S    S+     0   0   63  207   35   GG    GG G G  G  GG  GG GGG  DG GG  GG   S   GGG       S   G GG  GG  
   157  153 L S  S    S-     0   0   33  206   68   KK    NN N G  S  TG  SS SSS  KK KS  SS   K   KNS       P   T KS  SS  
   158  154 L E  B     -F  153   0L  85  206   78   DD    SS S S  P  LS  PP PPP  EE EP  PP   S   EPP       V   P EP  PP  
   159  155 L R        -     0   0   69  207   77   QQ    VV V S  V  IS  VV VVV  TQ KI  VV   V   KVV       S   V QV  VV  
   160  156 L Q        +     0   0  133  207   73   TT    RR T T  T  TT  SS SSS  DT TT  VV   L   TSV       S   T TS  VS  
   161  157 L N  S    S+     0   0  117  207   69   DD    DD Q T  R  QT  SQ QQQ  SD DQ  TT   P   DQT       T   Q DS  TS  
   162  158 L G  S    S+     0   0   29  207   34   SS    GG G S  G  GS  GG GGG  GS GG  GG   G   SGG       A   G SG  GG  
   163  159 L V  E     -D  183   0K  46   65   74   ..    .. . A  .  .A  .. ...  .. ..  ..   .   ...       .   . ..  ..  
   164  160 L L  E     -D  182   0K  16  192   49   VV    VV V .  V  V.  IV VVV  VV VV  II   .   VVI       .   V VI  II  
   165  161 L N  E     +D  181   0K  52  196   54   QQ    EE D S  V  ES  SE EEE  TQ VE  SS   E   QES       .   E QS  SS  
   166  162 L S  E     -D  180   0K  12  204   50   SS    TT T H  T  TH  TT TTT  TS ST  TT   S   STT       .   T ST  TT  
   167  163 L W  E     -D  179   0K  99  204   72   SS    TT T S  S  TS  ST TTT  GS ST  SS   I   STS       .   T SS  SS  
   168  164 L T        -     0   0   24  204   69   GG    KK Q L  Q  QL  TK KKK  TG GK  TT   T   GKT       .   K GT  TT  
   169  165 L D        -     0   0   99  204   75   LL    PP P E  A  LE  AP PPP  VL LP  AA   I   LPA       .   P LA  AA  
   170  166 L Q        -     0   0   18  206   75   SS    SS S V  S  SV  VS SSS  SS SS  VV   T   SWV       V   F SV  VV  
   171  167 L D     >  -     0   0   48  206   62   KK    KK K L  Q  KL  QK KKK  TK KK  KK   C   KRK       Q   K KQ  KQ  
   172  168 L S  T  4 S+     0   0   54  206   61   QQ    QQ Q G  Q  QG  RQ QQQ  DQ QQ  QQ   R   QQQ       R   Q QQ  QR  
   173  169 L K  T  4 S+     0   0  180  206   55   SS    SS S S  S  SS  PS SSS  SS SI  PP   T   SSP       P   S SA  PP  
   174  170 L D  T  4 S-     0   0   57  206   36   DD    NN N D  S  ND  DN NNN  DD DN  DD   S   DND       D   N DD  DD  
   175  171 L S     <  +     0   0    4  206   54   NN    NN N G  S  NG  QN NNN  QN SN  QQ   S   NNQ       Q   N NQ  QQ  
   176  172 L T        -     0   0    5  206   71   LL    KK K R  K  KR  TK KKK  SL LK  TT   S   LKT       T   K LT  TT  
   177  173 L Y  E     -C  143   0K   7  204    1   YY    YY Y F  Y  YF  YY YYY  YY YY  FF   .   YYF       Y   Y YF  FY  
   178  174 L S  E     -     0   0K   1  205   68   MM    AA A S  V  RS  QV VVV  SM MV  HH   .   MAH       Q   V MQ  HQ  
   179  175 L M  E     -CD 140 167K   0  206   80   EE    AA A W  A  AW  IA AAA  LE EA  II   V   EAI       I   A EI  II  
   180  176 L S  E     -CD 139 166K   3  206    3   SS    SS S S  S  SS  SS SSS  SS SS  SS   S   SSS       S   S SS  SS  
   181  177 L S  E     -CD 138 165K   0  206    0   SS    SS S S  S  SS  SS SSS  SS SS  SS   N   SSS       S   S SS  SS  
   182  178 L T  E     -CD 137 164K   2  206   71   YY    YY F T  Y  YT  SY YYY  YY YY  YY   Y   YYY       S   Y YY  YS  
   183  179 L L  E     -CD 136 163K   0  206    0   LL    LL L L  L  LL  LL LLL  LL LL  LL   M   LLL       L   L LL  LL  
   184  180 L T  E     +C  135   0K  36  206   53   SS    SS S N  T  IN  TS SSS  RS SN  AA   H   SSA       T   S SA  AT  
   185  181 L L  E     -C  134   0K  16  206    9   LL    LL L L  L  LL  IM MMM  VL LL  II   F   LLI       I   L LV  II  
   186  182 L T  E  >  -C  133   0K  81  205   54   TT    TT S P  T  MP  QS SSS  PT TS  QQ       TTQ       Q   S TQ  QQ  
   187  183 L K  H >> S+     0   0   66  204   67   AA    PP A A  G  PA  TA AAA  AA SP  AA       APA       T   P AT  AT  
   188  184 L D  H 3> S+     0   0  109  205   63   DD    QQ N D  S  ND  SS SSS  TD DE  SS       DDS       S   D DS  SS  
   189  185 L E  H >4 S+     0   0   53  205   48   QQ    QQ Q Q  E  QQ  DK KKK  AQ EK  DD       QKD       D   K QD  DD  
   190  186 L Y  H X< S+     0   0    6  205   12   WW    WW W W  W  WW  WW WWW  WW WW  WW       WWW       W   W WW  WW  
   191  187 L E  H 3< S+     0   0   90  205   71   LL    KK K K  K  RK  NK KKK  NL LK  NN       LKN       N   K LN  NN  
   192  188 L R  T << S+     0   0  160  205   58   RR    SS S K  P  SK  MS SSS  KR KS  MM       RSM       M   S RM  MM  
   193  189 L H    <   -     0   0   24  203   55   HH    RR Y V  K  HV  DA AAA  GH HH  DD       HGD       D   H HD  DD  
   194  190 L N  S    S+     0   0   97  203   71   EE    SS Q D  S  KD  KS SSS  SE DS  KK       EGK       K   S EK  KK  
   195  191 L S  E     + G   0 214L  37  203   71   TT    SS S S  S  RS  VQ QQQ  ST LS  VV       TSV       V   N TV  VV  
   196  192 L Y  E     +EG 154 213L   0  203   15   YY    YY V V  Y  YV  YY YYY  YY YF  YY       YYY       Y   F YY  YY  
   197  193 L T  E     -EG 153 212L   3  203   48   SS    SS T A  S  SA  TS SSS  TS SS  TT       SST       T   T ST  TT  
   198  194 L b  E     -EG 152 211L   1  203    0   CC    CC C C  C  CC  CC CCC  CC CC  CC       CCC       C   C CC  CC  
   199  195 L E  E     -EG 151 210L  34  203   61   KK    HH Q E  E  QE  KH HHH  SK KL  KK       KQK       K   Q KK  KK  
   200  196 L A  E     -EG 150 209L   1  203   23   VV    VV V A  V  VA  VV VVV  VV VV  VV       VVV       V   V VV  VV  
   201  197 L T  E     +E  149   0L  36  203   31   SS    TT T S  T  TS  ST TTT  DS TT  SS       STS       S   T SS  SS  
   202  198 L H  E >   - G   0 205L  18  203   19   HH    HH H L  H  HL  LH HHH  HH HH  LL       HHL       L   H HL  LL  
   203  199 L K  T 3  S+     0   0  145  202   55   QQ    EE E S  E  ES  GD DED  GQ QE  GG       QEG       G   E QG  GG  
   204  200 L T  T 3  S+     0   0   55  202   40   GG    GG G G  G  GG  SG GVG  SG GG  SS       GGS       S   G GS  SS  
   205  201 L S  E <   -G  202   0L  45  180   82         KK H Q  S  SQ  QN NSN  L   S  QQ        GQ       Q   S  Q  QQ  
   206  202 L T  E    S+     0   0L 140  180   32         TT T S  T  TS  TT TTT  S   T  TT        TT       T   T  T  TT  
   207  203 L S  E    S-     0   0L  82   83   48              S      S  S       S      AA         A       S      A  AS  
   208  204 L P  E     -     0   0L  43   67   33                                P                                       
   209  205 L I  E     -G  200   0L  46   67   29                                L                                       
   210  206 L V  E     +G  199   0L  70   63   53                                L                                       
   211  207 L K  E     +G  198   0L  85   63   26                                K                                       
   212  208 L S  E     -G  197   0L  67   63   28                                T                                       
   213  209 L F  E     -G  196   0L  30   63   18                                I                                       
   214  210 L N  E      G  195   0L  99   63   62                                S                                       
   215  211 L R              0   0   82   54   19                                                                        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  192   30  Q  EQKQ  E    Q DE  E   Q   EE  Q  EE    Q  QE   D   Q    Q     EE   Q
   218    2 H V        +     0   0   30  194   40  V  VVVV  V    V VV  V   V   VI  V  EV    I  VI   V   V I  VV    EE   V
   219    3 H K  E     -A  241   0A 143  197   48  Q  KQQQ  Q T TK QQ  Q   Q   QL  Q  QQ    I TQR   Q   N Q  LQ    QQ   Q
   220    4 H L  E     -A  240   0A  11  217    3  L  LLLL  L L LL LL  LL  L   LL  L  LL  LLL LLL   LLLLL L LLL    LL  LL
   221    5 H Q  E     -A  239   0A 120  217   73  Q  DQQQ  V T TQ VV  VT  V   QS  H  VV  TTT TVS   VTTTT E IVV    VV  TV
   222    6 H E  E     -A  238   0A   2  218   33  Q  EQQQ  E Q EQ EE  ES  Q   QQ  E  EE  QQE EEQ   EEQQE E QEE    EE  EE
   223    7 H S  E     +A  237   0A  48  218   13  S  TSSP  S S SS SS  SS  S   SK  S  SS  SSS SSK   SSSSS S SSS    SS  SS
   224    8 H G        -     0   0   35  218   20  G  GGGG  G E EG GG  GD  G   GA  G  GG  EEG EGA   GEEEG G EGG    GG  EG
   225    9 H P        -     0   0   50  218   49  A  GPAA  G A PP GG  GS  A   AS  A  GG  PPG PGS   GSPPG G SGG    GG  PG
   226   10 H A  S    S+     0   0   30  218   51  E  GEEE  G V AE DG  GV  E   EE  E  GG  VVD ADE   GVVVD D VDD    GG  AD
   227   11 H V  E     -d  334   0B  33  218   25  L  LLLI  L I VL VL  LV  L   LI  V  LL  VVV VVI   LVVVV T IVV    LL  VV
   228   12 H I  E     -d  335   0B   9  218   54  A  VVVV  V K KK RV  VK  R   VA  A  VV  KKK KKA   VKKKK K KKR    VV  KK
   229   13 H K        -     0   0  104  218   50  K  QKKR  Q R RK QQ  QR  K   KN  K  QP  RRK RKN   QRRRK K RKK    QQ  RK
   230   14 H P  S    S+     0   0   56  218    9  P  PPPP  P P PP PP  PP  P   PV  P  PP  PPL PPV   PPPPP P PPP    PP  PP
   231   15 H S  S    S+     0   0   90  218   20  G  GGGG  G E GG GG  GG  G   GG  G  GG  GGG GGG   GGGGG G GGG    GG  GG
   232   16 H Q  S    S-     0   0   76  218   59  S  RAAA  G E EE GG  GE  A   AT  A  GG  EEE EDA   GEEEE E EDD    GG  ED
   233   17 H S        -     0   0   51  217   20  S  PLSS  S S ST SS  SS  S   SS  S  SS  SSS SSS   SSSSS S SSS    SS  SS
   234   18 H L  E     - B   0 300A   1  217   43  V  MVVV  L H HV LL  LV  V   VI  V  LL  HHL HLI   LHHHL V HLL    LL  HL
   235   19 H S  E     - B   0 299A  64  218   51  K  KKKK  R R RK SR  RT  E   KL  K  RR  TTK RRL   RRTTR R RRR    RR  RR
   236   20 H L  E     - B   0 298A   1  218   13  I  LILL  L L LI LL  LL  V   IL  M  LL  LLL LLL   LLLLL L LLL    LL  LL
   237   21 H T  E     -AB 223 297A  29  218   33  S  SSSS  S T TS SS  SS  S   SQ  S  SS  TTS TSE   STTTS S TSS    SS  TS
   238   22 H c  E     -AB 222 296A   0  219    1  C  CCCC  C C CC CC  CC  C   CC  C  CC  CCC CCC   CCCCC C CCC C  CC  CC
   239   23 H I  E     -AB 221 295A  54  217   75  K  VKKK  A T TK KT  AT  R   KE  K  AA  SSK TKE   ASSSK E TKK S  AA  TK
   240   24 H V  E     -A  220   0A   4  217   51  A  AAAT  A T TA AG  AG  A   AV  A  AA  AAA TAV   AAAAA G YAA V  AA  AA
   241   25 H S  E     +A  219   0A  60  218    9  S  SSSS  S S SS SS  SS  S   SS  S  SS  SSS SSS   SSSSS S SSS N  SS  SS
   242   26 H G  S    S+     0   0   54  218    3  G  GGGG  G G GG GG  GG  G   GG  G  GG  GGG GGG   GGGGG G GGG G  GG  GG
   243   27 H F  S    S-     0   0   37  199   23  .  FYYY  F F FY F.  F.  .   ..  Y  FF  FFF FF.   FFFFF F FFF .  FF  FF
   244   28 H S    >   -     0   0   44  200   45  .  TTTT  T T TT T.  T.  .   ..  T  TT  TTT TT.   TTTTT T STT .  TT  TT
   245   29 H I  T 3  S+     0   0    2   56   45  Y  ....  F F FF .F  .F  Y   YY  .  FF  ..F F.Y   F..F. . ... F  .F  ..
   246   30 H T  T 3   +     0   0   59   61   59  T  ....  S S ST .T  .S  I   TN  .  SS  ..S S.N   S..S. . ... D  .S  ..
   247   31 H R  S X  S-     0   0  145  218   53  F  FFFF  S S SD FF  FV  F   FI  F  SS  FFS SFI   SFFSF F .FF K  FS  FF
   248   32 H T  T 3  S+     0   0   72  204   59  T  GTST  . . .. SS  SG  T   NN  T  ..  SS. .SN   .SS.S S SSS A  S.  SS
   249   33 H N  T 3  S+     0   0   16  204   62  S  DSDD  . . .. SS  SD  S   DD  T  ..  SS. .SD   .SS.S S DSS N  S.  SS
   250   34 H Y  E <   -E  317   0C  23  220   46  Y  YFYY  Y Y YY YY  YY  Y   YH  Y  YY  YYY YYH   YYYYY Y YYH E  YY  YY
   251   35 H d  E     -EF 316 270C   0  218   89  D  WDFW  E Y AG CY  SW  A   NH  W  YG  DGG AWH   GGDWW W ENW F  GW  YW
   252   35AH W  E     -EF 315 269C   1  218   43  I  MIIM  M M MM MM  MM  L   MM  M  MM  MMM MMM   MMMMM M TMM V  MM  MM
   253   35BH H  E     -EF 314 268C   0  219   73  S  NSHN  N H DN YY  NH  L   DH  H  SS  AAH DQY   SNAHA S ANG H  SH  AL
   254   36 H W  E     +EF 313 267C   1  221    2  W  WWWW  W W WW WW  WW  W   WW  W  WW  WWW WWW   WWWWWWW WWW W  WW  WW
   255   37 H I  E     -EF 312 265C   0  221   15  I  VMIV  V I VV IV  VI  V   VV  I  VV  VVV VVV   VVVFIFV IVV T  VV  VV
   256   38 H R  E     -EF 311 264C  10  221   15  K  RKKK  R R RK CR  RR  R   KR  K  RR  RRR RRR   RRRRRHR RRR R  RR  RR
   257   39 H Q  E     -EF 310 263C  22  220    2  Q  QQQQ  Q Q QQ QQ  QQ  Q   QQ  Q  QQ  QQQ QQQ   QQQQQQQ QQQ Q  QQ  QQ
   258   40 H A    >   -     0   0   14  220   61  T  SRRR  A A AA AA  AK  S   SA  R  AA  AAP AAA   AAAAPLA AAA K  AA  AA
   259   41 H P  T 3  S+     0   0   99  221   19  T  PPSP  P P PP PP  PP  P   HP  P  PP  PPT PPP   PPPPPPP APP T  PP  PP
   260   42 H G  T 3  S+     0   0   94  221   12  G  EGGG  G G GG GG  GG  A   GG  G  GG  GGG GGG   GGGGGGG GAG G  GG  GG
   261   43 H K  S <  S-     0   0  140  221   34  Q  KQQQ  K K KK KK  KK  G   RP  Q  KK  KKK KKA   KKKKKQK KKK K  KK  KK
   262   44 H G        -     0   0   20  221   24  G  GGGG  G G GG GG  GG  A   Sg  G  GG  GGG GGg   GGGGGEG GGG T  GG  AG
   263   45 H L  E     -F  257   0C  10  221    9  L  LPLL  L L LL LL  LL  L   Li  L  LL  LLL LLl   LLLLLTL LLL L  LL  LP
   264   46 H E  E     -F  256   0C  79  221    9  E  EEEE  E E EK EE  EE  Q   EE  E  EE  EEE EEE   EEEEEKE EEE E  EE  EE
   265   47 H W  E     +F  255   0C  13  221    9  Y  WWWW  W W WW WW  WW  Y   WW  W  WW  WWW WWW   WWWWWMW WWW W  WW  WW
   266   48 H M  E     -     0   0C   3  221   31  I  VIII  V I IM IV  VI  L   IL  I  VV  IIV IIL   VIIIILV IVV I  VV  IV
   267   49 H G  E     -FG 254 277C   0  221   42  G  SGGG  A A AG AS  SG  G   GA  G  SA  ASG AGA   SAASAVA AAA G  AA  AA
   268   50 H R  E     -FG 253 276C  10  221   93  Y  QWWA  Y V FW YA  YY  W   NA  Y  RR  YAV FEA   YYYAYQY YHY R  LY  RA
   269   51 H I  E     -FG 252 275C   3  221   16  I  IIFI  I I II II  II  I   IY  I  II  III IIF   IIIIILI III Q  II  II
   270   52 H d  E >   -F  251   0C   0  221   83  N  RSND  N G HN SN  RD  N   NR  N  NS  YSW HHR   SCYSNMH SKR S  SS  TE
   271   53 H Y  T 3  S+     0   0   47  221   84  T  npPp  S T Tt ST  Ys  T   pS  p  ts  SSY Tpt   STSTTPp SsY l  sS  NY
   272   54 H E  T 3  S-     0   0   63  207   63  g  ydgd  g s gt sg  d.  d   dD  t  .s  sgd gs.   sssddDs gpd q  sd  sd
   273   55 H G  S <  S+     0   0   25  200   53  g  yGgS  g s sG sg  gt  g   ..  G  gr  sss sTy   ssssgNA g.g .  gs  sd
   274   56 H S        -     0   0   42  217   74  G  ESSY  S P HE SS  SG  K   ST  Y  YS  SYR HTT   YPSSSKS S.S .  SS  SR
   275   57 H I  E     -G  269   0C  71  220   53  T  TSIT  T I IP TT  TT  P   TT  T  TT  QKT IIT   IIQQTIT ITT .  TT  TI
   276   58 H Y  E     -G  268   0C  70  221   79  Y  YEKS  Y Y YT SW  YI  T   IY  D  YY  YYE YNY   YYYYGVY YYY E  YY  WF
   277   59 H Y  E     -G  267   0C  41  221   17  Y  YYFY  Y Y YY YY  YF  Y   YI  Y  YY  YYY YYI   YYYYYRY YYY Y  YY  YY
   278   60 H S    >>  -     0   0   11  221   61  N  SNNN  S S SA AT  AA  A   NS  N  AA  SSS SAA   ASSSLGP SAL S  AA  SL
   279   61 H P  T 34 S+     0   0   76  221   51  E  DEEQ  N P QD DD  DQ  Q   QE  Q  DN  EEQ QQE   DQEEQPD EDD S  DN  QD
   280   62 H S  T 34 S+     0   0   79  221   52  K  SKKK  S S SD SS  SS  G   KS  N  AS  SSN SPG   SSSSSNV SSA S  SS  SA
   281   63 H I  T X4 S+     0   0    4  221   40  F  VFFF  V V VF VV  VL  F   FF  F  VV  VVV VFF   VVVVVIV FVV F  VV  VV
   282   64 H K  G >< S+     0   0  133  221   28  K  KKKK  K K QK KK  KQ  S   KK  K  KK  KKK QKK   KQKKQTK RKK Q  KK  QK
   283   65 H S  G 3  S+     0   0  116  221   27  G  GGDG  G G GG GG  GG  E   GE  D  GG  GGG GGD   GGGGGTG GGG S  GG  GG
   284   66 H R  G <  S+     0   0   51  221   18  K  RKKT  R R RR RR  RQ  R   KR  K  RR  RRR RRR   RRRRRRR RRR R  RR  RR
   285   67 H S  E <   -C  300   0A  11  221   54  A  FAAT  F F FF FF  FF  F   AL  A  FF  FFF FFV   FFFFFFF FFF F  FF  FF
   286   68 H T  E     -C  299   0A  67  221   23  T  TTTL  T T TA TT  TT  V   TT  T  TT  IIT TTT   TSIITVT TTT T  TT  TT
   287   69 H I  E     +C  298   0A   3  221   29  L  ILLT  I I IF II  II  F   LP  L  II  III IIP   IIIIIPI TII L  II  II
   288   70 H S  E     -C  297   0A  56  221   37  T  STTV  S S SS SS  ST  S   TS  T  SS  SSS SSS   SSSSSSS TSS S  SS  SS
   289   71 H R  E     -C  296   0A  71  221   60  V  RAAD  R R RL RK  RK  M   VT  A  RR  RRR RRT   RRRRRRR RRR Y  RR  RR
   290   72 H D  E >>> -C  295   0A  55  221   10  D  DDDT  D D DE DE  DD  D   ES  D  DD  DDD DDS   DDDDEDD DDD D  DD  DD
   291   73 H T  T 345S+     0   0   78  220   57  K  DKKS  N D DT NN  NT  T   KG  K  NN  NNN DNG   NDNNNVN NNN V  NN  NN
   292   74 H S  T 345S+     0   0  105  220   44  S  SSSS  A S SS SA  AS  S   SS  S  AT  NNS SPS   ASNNSsS SPP S  TA  NP
   293   75 H L  T <45S-     0   0  103  217   69  S  KSS.  K S SA NK  KK  V   S.  S  KK  RKN SN.   KSRRNsN RNN S  KK  RN
   294   76 H N  T  <5 +     0   0   29  218   47  S  SNTS  N S SS SN  NN  S   S.  R  NN  AAS SN.   NSAANNN KNN S  NN  QN
   295   77 H K  E   < -BC 239 290A  51  221   70  T  GTTS  K K KT LT  SM  T   TT  T  SA  QQF KLT   SKQQMSM QLL S  ST  QL
   296   78 H F  E     -BC 238 289A   1  221   60  A  VAVA  L L LA VL  LV  G   AA  A  LL  LLL LLA   LLLLLYL VLL A  LL  LL
   297   79 H F  E     -BC 237 288A  50  221   32  F  YYYY  Y Y YY NY  YY  F   YQ  Y  YY  NNY YYQ   YYNNYFY YHH D  YY  YS
   298   80 H I  E     -BC 236 287A   4  221    5  M  LMMM  L L LL LL  LL  L   ML  M  LL  LLL LLL   LLLLLLL LLL L  LL  LL
   299   81 H Q  E     -BC 235 286A  73  221   35  Q  QHDL  Q Q QQ QQ  QE  Q   ER  Q  QQ  QQQ QQR   QQQQQTQ QQQ S  QQ  QQ
   300   82 H L  E     -BC 234 285A   3  221   19  L  MLLL  M M MI MM  MI  I   LI  L  MM  MMM MMI   MMMMMIM MMM I  MM  MM
   301   82AH I        +     0   0   70  221   58  S  NSSS  N N NN ND  NK  N   RS  S  NS  NNN NTN   NNNNNSN NTT R  SS  NT
   302   82BH S  S    S-     0   0   59  221   33  S  NSRS  S S SN SS  SS  G   SK  S  SS  SSS SGR   SSSSSDS SGG K  SS  SG
   303   82CH V        -     0   0    0  221   13  L  LLLL  L L LL LL  LL  L   LL  L  LL  LLL LLL   LLLLLVL LLL R  LL  LL
   304   83 H T    >   -     0   0   65  221   63  T  RTTT  K K KK KR  RK  K   TS  T  RR  KKR KKS   RRKKRAK TKK S  RR  KK
   305   84 H N  G >  S+     0   0  120  221   62  P  PSSS  A T TN TA  AA  S   SS  S  AA  TTV TSS   AMTTVEP TPP V  AA  TP
   306   85 H E  G 3  S+     0   0  160  221   21  E  EEEE  E E EE EE  EE  E   DS  E  EE  EEE EES   EEEEEEE EEE A  EE  EE
   307   86 H D  G <  S+     0   0    0  221    1  D  DNDD  D D DD DD  DD  D   DD  D  DD  DDD DDD   DDDDDDD DDD D  DD  DD
   308   87 H T    <   +     0   0   30  221   36  T  MSSS  T S TT TT  TT  T   ST  S  ST  SST TTT   TTSSTST STT M  TT  ST
   309   88 H A  E    S- H   0 333C   3  221    5  A  GAAA  A A AA AA  AA  G   AA  T  AA  AAA AAA   AAAAASA AAA A  AA  AA
   310   89 H M  E     -EH 257 332C  43  221   61  V  IVVV  V V VT LV  VV  V   VT  V  VV  VVM VRT   VVVVMKT VRR V  VV  VR
   311   90 H Y  E     -EH 256 331C   2  221    0  Y  YYYY  Y Y YY YY  YY  Y   YY  Y  YY  YYY YYY   YYYYYYY YYY Y  YY  YY
   312   91 H Y  E     -E  255   0C   1  221    3  Y  YFFF  Y Y YF YY  YY  F   YY  Y  YY  YYY YYY   YYYYYYY YYY H  YY  YY
   313   92 H c  E     +E  254   0C   0  221    1  C  CCCC  C C CC CC  CC  C   CC  C  CC  CCC CCC   CCCCCCC CCC C  CC  CC
   314   93 H S  E     -EI 253 327C   0  221   30  A  TAAA  A A AA AA  AA  A   AT  T  AA  AAT AAA   AAAAASA AAA G  AA  AA
   315   94 H R  E     -EI 252 326C  20  220   39  N  VRRR  R R RR RK  RK  R   RR  R  RR  RRR RRR   RRRRRMR RRR G  RR  RR
   316   95 H E  E     -EI 251 324C   0  220   75  N  ESHG  D Y HK DD  HT  D   TG  R  DD  WED HHS   DRWDDWD EDH Q  DD  EG
   317   96 H N  E  >> -E  250   0C   6  220   89  Y  GKEP  T P ND TT  SD  I   EY  G  TT  SSP NTR   TDSAPLT PIT E  TT  LR
   318   97 H H  T  45S+     0   0    0  220   93  S  MLDR  L H TL YQ  EY  G   TG  P  RS  QQQ TVG   VTQHQPD HTA A  VR  PP
   319   98 H M  T  45S+     0   0   73  221   94  S  DGRD  R F LL YQ  GY  A   YG  S  DL  ILY LFS   SVFKFGY WGT M  RP  AR
   320   99 H Y  T  45S+     0   0  159  221   92  Y  YGGS  G N CR SG  KF  L   YG  Y  VF  QLS VSY   FRFTPKR TLR P  AV  FF
   321  100 H E  T  <5 -     0   0   54  221   92  W  WFNS  K I YY YL  KD  Y   SD  G  QN  LDF TGF   FDQIFLD TNN H  PM  MS
   322  100AH T      < +     0   0    0  221   92  F  GAYG  D T CF IS  CY  Y   YF  N  AG  FFA IAD   VIVLWGF TYL C  YE  TY
   323  100BH Y  S    S-     0   0   10  221   92  A  RYDY  M M FD WT  KW  C   DD  H  SS  PFT TIY   FLFKNIW ARL D  WG  FT
   324  100CH F  E     +I  316   0C   0  221   93  Y  GWgY  W F GY hL  WG  d   gY  g  YM  Flv QrW   VggwfIr wtt a  EL  gg
   325  101 H D  E     +     0   0C  42  133   50  .  ..v.  A . .. dP  ..  e   a.  p  ..  Qss .q.   .qkqe.l lpk d  ..  sc
   326  102 H V  E     -I  315   0C  35  153   74  .  ..Y.  V . .. QF  ..  Y   Y.  Y  ..  SHL .T.   .KDLK.L ELP Y  ..  TC
   327  103 H W  E     -I  314   0C  28  177   14  W  ..WW  M . .W WW  ..  W   WW  W  W.  LRQ .H.   .KWTRWL WKR W  ..  WH
   328  104 H G        -     0   0    3  204   16  G  .GGG  G S GG PG  ..  G   GG  G  G.  GVg .GG   TDISVGG ITL G  .g  AG
   329  105 H Q        -     0   0  100  183   48  Q  .QQQ  . . SQ QQ  .K  Q   RQ  Q  P.  ..q ..P   RQ...N. ..H E  Ng  ..
   330  106 H G        -     0   0    3  191    7  G  .GGG  T . GG PG  .G  G   GG  G  G.  ..N ..G   GM.GCG. .GG G  DH  ..
   331  107 H T  E     -H  311   0C  27  202   47  T  ITTT  L I ST AA  TT  T   TT  T  G.  .IS ..T   NS.NST. .RS T  GL  ..
   332  108 H T  E     -H  310   0C  48  208   81  L  SLLT  L A LT TL  LK  L   LM  L  P.  QTT ..M   ICSLQW. AVL R  DC  ..
   333  109 H V  E     -H  309   0C   0  214   25  V  VVVL  T L LV YV  IV  V   VV  V  SM  TLY .KV   LCLSTL. LVF V  DF  ..
   334  110 H T  E     -d  227   0B  16  217   44  T  TTTT  T L LT AT  VT  T   TT  T  CS  VTC PTT   TQSSDH. ITP T  DC  ..
   335  111 H V  E     +d  228   0B   2  218   17  V  VVVV  Y L LV LV  IV  V   VV  V  VV  IVR GLV   SPLLAVI YQG V  II  ..
   336  112 H S        -     0   0   18  219   35  S  SSSS  S L LS KS  SS  S   ST  S  SN  SPY SST   TSNPSLC SFA T  DH  .G
   337  113 H S  S    S+     0   0   99  220   31  S  SAAS  S L AS IS  SS  S   AS  A  TS  SST DDS   ERSKCAS GTR S  NP  .S
   338  114 H A  S    S-     0   0   31  221   51  E  EEEE  g A Ag gg  ia  V   EA  v  gt  atg RaA   asaGtKa ggS v  da  gG
   339  115 H K        -     0   0  143  209   69  S  SSPP  m A Gg ge  gp  .   ST  g  ge  csf LlV   ssiFqPg hn. p  dl  n.
   340  116 H T        -     0   0   44  210   73  Q  AAAA  G G SG NP  SS  .   AS  G  HG  FSN QAT   ASFKWPT AS. S  DS  VS
   341  117 H T  B     -J  370   0D  35  217   71  S  RRRR  R S SG RS  CA  D   RK  S  GG  TTK ARS   GSTNSTR SS. V  GI  SG
   342  118 H P        -     0   0   60  218   66  S  NNEE  V G GG Av  AP  p   NS  g  VV  GGV GAP   VCGGVAI AA. P  VL  LL
   343  119 H P        -     0   0   13  218   31  P  PPPP  H F VS Rs  HQ  l   PP  t  LQ  VVQ VRP   QVVPHPP GR. P  HE  FR
   344  120 H S  E     -K  367   0E  51  218   62  T  TTTT  S K QD AP  SS  R   TS  N  SC  KKS QSS   CKKWSSS DS. V  SV  KA
   345  121 H V  E     -K  366   0E   6  219   45  V  IIII  Q C CI EN  QV  S   IL  I  QE  GSA CQL   ECGGAVE NQQ L  QQ  SQ
   346  122 H Y  E     -K  365   0E  27  220   34  F  YYYY  V E EE IA  VF  F   YF  V  VV  EEI EVF   VEEEIAA YIV V  VV  II
   347  123 H P  E     -K  364   0E  15  220   29  P  PPPP  Q Q QL TP  QG  P   PP  M  QQ  QQV QVP   QQQQELQ QSQ P  QQ  IQ
   348  124 H L  E     +K  363   0E   4  221    3  L  LLLL  L L LT LL  LL  L   LL  T  LL  LLL LLL   LLLLLYL LLL M  LL  LL
   349  125 H A        -     0   0   10  221   68  V  tttt  v t tq tD  vS  s   tI  q  qv  ttt ttI   vttttAv tvv V  vq  tv
   350  126 H P        -     0   0   24  216   47  S  pppp  s p pp k.  sQ  q   pS  p  ss  pps psS   spppsPs pss W  ss  ps
   351  127 H G  S    S-     0   0   16  219   75  C  PPQQ  G A AS P.  GC  S   RC  R  GG  AAG AGC   GDAADLG PGG F  GG  AG
   352  128 H S  S    S+     0   0   99  219   60  E  AAAA  A S YS T.  PS  T   AG  S  PG  SSA YPG   GSSSPEG SGG S  AP  SA
   353  129 H A        +     0   0   52  220   92  s  LLLL  e v vl e.  eS  D   LE  m  gg  vve vaE   gvvvqEg vdd P  eg  me
   354  130 H A        +     0   0   70  136   83  l  ....  r v ka i.  k.  .   ..  m  vv  vvk kk.   vlvvgEr vkk .  rv  vk
   355  133 H Q        +     0   0  178  159   73  S  ....  K Q QS K.  QG  .   ..  S  KQ  QQK QK.   KQQQKLR QKK A  KK  QK
   356  134 H T    >   -     0   0   64  220   50  D  SSSS  P P PL P.  PS  S   SS  V  PP  PPP PPS   PPPPPSP PPP S  PP  PP
   357  135 H N  T 3  S-     0   0  146  221   56  E  SSSS  E G GG GT  GD  D   SM  G  SG  GGG GGM   GGGGGAG GGG G  GS  GG
   358  136 H S  T 3  S+     0   0   63  221   63  N  DDDD  A Q QG AN  AG  G   DD  E  QG  QQE QED   GQQQEGE QDD D  AQ  QE
   359  137 H M  E <   - L   0 408E  83  221   79  L  PPPP  S R RK SE  SS  H   PP  R  TS  RCS RSP   SRRRSSS RSS K  ST  RA
   360  138 H V  E     - L   0 407E  15  221   34  V  VVVV  V L LV VV  VI  V   VV  V  LL  LLV LQV   LLLLLGL LLL V  VL  LV
   361  139 H T  E     + L   0 406E  15  221   70  A  IIII  K T ST VA  KT  V   IT  T  SR  TTK SKT   RTTTKTQ TRR T  KS  TK
   362  140 H L  E     + L   0 405E   0  221   27  M  IIII  I I II LV  VL  I   II  L  LL  IVL ILL   LIIILIL ILL L  VL  IM
   363  141 H G  E     -KL 348 404E   0  221   30  G  GGGG  S T TT EV  SG  G   GG  S  TS  TTS TQG   STTTKSS TSS S  ST  TS
   364  142 H e  E     -KL 347 403E   1  221    0  C  CCCC  C C CC CC  CC  C   CC  C  CC  CCC CCC   CCCSCCC CCC C  CC  CC
   365  143 H L  E     -KL 346 402E   2  221   33  L  LLLL  K Q QK TL  KL  M   LL  K  TA  QQT QAL   AQQQALL QKK L  KS  QK
   366  144 H V  E     -KL 345 401E   1  221   49  A  IIII  A V VA VA  AA  V   IA  A  VG  VVP VAA   AVVVVAA VAT A  AV  VG
   367  145 H K  E     -KL 344 400E  38  220   74  R  HHHH  S S .S SQ  SK  Q   HK  S  SS  SSS SSK   SSSSVRS SSS L  SS  SS
   368  146 H G  E    S+     0   0E  19  221   50  D  DDDD  G Y SQ GD  GG  D   DD  E  GG  YYG YGG   GYYYGGG YGG D  GG  YG
   369  147 H Y  E     - L   0 399E   0  221   18  F  YYYY  Y S YD YF  YF  F   YF  N  GF  SSY SFF   FSSSFFI SFF F  YF  SY
   370  148 H F  B     +J  341   0D   3  221   42  L  FFFF  T L SI NL  TS  F   FL  V  ST  VVS VTL   TVVLNYT VTT Y  TS  LT
   371  149 H P  S    S-     0   0    0  221   37  P  pppp  F S VN IP  Fp  p   lP  D  vF  SSY GLP   FSSSVPF SFF P  Fi  SF
   372  150 H E  S    S+     0   0   53  211   46  S  gggg  T . G. ND  Td  e   gE  .  sS  ..T SSD   S...NES .SS Q  Tt  .T
   373  151 H P        +     0   0   59  219   54  S  TTTT  S S S. DS  SS  S   TT  .  SS  SSS YSS   SSSSSSS GSS S  SS  TS
   374  152 H V        -     0   0   20  221   53  I  MMMM  Y Y YK HI  YL  V   MI  T  YY  YHY FTI   YYYYYIY DYY L  YG  YY
   375  153 H T  E     +N  422   0F  83  220   71  S  NNNN  N W FY HT  AN  N   NS  Y  YS  WHN .WS   WWWWWTG WNR S  WY  YS
   376  154 H V  E     +N  421   0F  23  221   43  F  VVVV  M T TI LF  IF  V   VF  V  RM  TTL TMF   MTTTMVM TMM F  MW  TI
   377  156 H T  E     -N  420   0F  48  221   56  S  TTTT  D A AA SS  HK  T   TT  S  ND  GHQ AGS   SGGGALN GNN E  HS  AH
   378  157 H W  E > >S-NO 419 383F   2  221    0  W  WWWW  W W WW WW  WW  W   WW  W  WW  WWW WWW   WWWWWWW WWW W  WW  WW
   379  162 H N  G > 5S-     0   0   38  221   69  n  GGGG  V I IY Ik  Vk  D   Gg  y  IV  III IIe   VIIIIsV IVV s  VI  II
   380  163 H S  G 3 5S-     0   0   91  218   63  n  KKKK  R R KQ Rn  Rp  H   Kn  k  RR  RRR KRn   RRRRRgR RRR g  RR  RR
   381  164 H G  G < 5S+     0   0   39  218   55  T  SSSS  Q Q QH QS  QA  K   SA  P  QQ  QQQ QQT   QQQQQSQ QQQ A  QQ  QQ
   382  165 H S  T < 5 +     0   0   93  221   60  E  GGGG  A P PK AD  AG  G   GS  E  PA  PPV PES   APPPAFA PAA P  AP  PA
   383  166 H L  B   < +O  378   0F  43  221   87  V  KKKK  P A AP PI  PK  K   KY  Q  PP  AAS API   PAAAATP APP L  PP  AP
   384  167 H S        +     0   0   88  221   69  M  DDDD  G G GG GS  GD  G   DS  S  GG  GGG GGS   GGGGGSA GGG D  GG  GG
   385  168 H S  S    S+     0   0  101  221   77  Q  IIII  Q K KK NK  Ql  T   IT  P  KK  KKK KQN   KKKKKRK KQK S  QK  KK
   386  169 H G  S    S+     0   0   32  218   43  G  TTTT  G G GG GG  Gd  S   TG  K  GG  GGG GGG   GGGGGGG TGG .  GG  VG
   387  171 H V        +     0   0   48  219   62  V  TTTT  L L LP LV  LF  V   TL  L  LL  LLL LLV   LLLLLVL LLL .  LL  LL
   388  172 H H  E     -M  404   0E  17  220   80  R  VVVV  E E ER VW  EV  M   VK  L  QE  EEE EEK   EEEEESE EEE L  EE  EV
   389  173 H T  E     -M  403   0E  69  220   82  T  NNNN  W W WS WG  WQ  N   NS  I  WW  LWY WWS   WWLWWTW WWW R  WW  WY
   390  174 H F  E     -M  402   0E   1  219   43  F  FFFF  M I I  IF  MY  F   FY  Y  MV  III ILY   VIIILGV IIV Y  MM  MI
   391  175 H P  E     -     0   0E  65  219   32  P  PPPP  G G G  VP  GP  P   PK  G  GA  GGG GAR   SGGGVPA GSA P  GG  SG
   392  176 H A  E     -     0   0E  19  215   65  T  PPPP  W W S  AS  WA  P   PP  A      YA  SDP   VSYWYAY MRY A  WH   W
   393  177 H V  E     -M  400   0E  42  214   63  L  AAAA  V K K  FV  IF  V   AV         HH  KYV   IEHKYLI KII V  VI   I
   394  178 H L  E     -M  399   0E  77  214   65  R  LLLL  Y Y Y  RL  NG  H   LM         RR  YYM   SRRYHSS YYS E  DW   N
   395  179 H Q  S    S-     0   0   83  214   70  T  AAAA  P T T  SR  TK  V   AQ         VV  TSQ   SVVTSQP TTN T  PY   T
   396  180 H S  S    S-     0   0  116  214   49  G  ssss  g g g  GG  dE  a   ss         GG  gea   SGGgsaS gDG N  gd   d
   397  183 H D  S    S+     0   0   90  206   25  D  gggg  g s s  .G  gG  g   gg         ..  ssg   G..ssk. sGG N  gs   g
   398  184 H L        -     0   0   53  199   75  K  RRRR    Y Y  .K   D  L   GT         ..  YKT    ..YNM. Y I R   T    
   399  185 H Y  E     -LM 369 394E  36  205    2  Y  YYYY    Y Y  YY   Y  Y   YY         YY  YYY    YYYYF. Y T F   Y    
   400  186 H T  E     +LM 367 393E   5  195   48  T  TTTT         TA   T  T   TS         T    YS    AT  S.   I T        
   401  187 H L  E     -L  366   0E  11  190   56  A  MMMM          A   K  M   MA              AA        V.   L E        
   402  188 H S  E     -LM 365 390E   5  191   26  T  SSSS          T   I  S   SS              SS        AS     V        
   403  189 H S  E     -LM 364 389E   2  191    0  S  SSSS          S   S  S   SS              SS        SG     S        
   404  190 H S  E     -LM 363 388E   0  191   77  Q  QQQQ          Q   H  Q   QQ              VQ        YT     L        
   405  191 H V  E     -L  362   0E   0  190   27  V  LLLL          V   I  L   LV               I        LI     V        
   406  192 H T  E     +L  361   0E  48  189   37  L  TTTT          L   R  T   TN               N        H      Q        
   407  193 H V  E     -L  360   0E  14  188   30  L  LLLL          L   V  L   LV               V        V      M        
   408  194 H P  E  >  -L  359   0E  56  188   40  S  PPPP          A   K  P   PA               D        T      S        
   409  195 H S  T  4 S+     0   0   49  187   50  A  AAAA          S   K  A   AS               S        A      R        
   410  196 H S  T  4 S+     0   0   66  187   69  K  VVVV          K   S  D   VA               A        N      S        
   411  198 H P  T  > S+     0   0   31  187   72  n  EEEE          d   D  Q   EV               T        E      E        
   412  199 H R  T  < S+     0   0   16  187  102  e  CCCC          q   W  C   CW               W        W      .        
   413  200 H P  T  4 S+     0   0   80  188   68  G  PPPP          G   I  P   PD               D        S      A        
   414  202 H S  T  4 S+     0   0  111  188   69  S  EEEE          T   D  A   EN               K        S      N        
   415  203 H E  S  < S-     0   0  128  188   76  D  GGGG          D   T  K   GI               S        G      L        
   416  204 H T        -     0   0   83  188   70  e  eeee          e   k  g   ee               k        s      k        
   417  205 H V        +     0   0    4  184   61  l  vvvv          v   y  q   vf               f        y      y        
   418  206 H T  E     - P   0 433F  23  183   70  V  KKKK          V   T  K   KY               Y        S      R        
   419  208 H e  E     -NP 378 432F   0  187    0  C  CCCC          C   C  C   CC               C        C      C        
   420  209 H N  E     -NP 377 431F   4  187   60  K  SSSS          K   E  H   SN               N        L      S        
   421  210 H V  E     -NP 376 430F   1  187   16  I  VVVV          V   A  V   VA               A        V      V        
   422  211 H A  E     -NP 375 429F  14  187   74  H  QQQQ          Q   S  Q   QK               K        Q      T        
   423  212 H H  E > > - P   0 428F   1  187    7  H  HHHH          H   N  H   HH               H        H      H        
   424  213 H P  G > 5S+     0   0   77  177   83  G  DDDD          P   S  N   DL               L        H      P        
   425  214 H A  G 3 5S+     0   0   40  177   67  N  SSSS          N   V  S   SD               E        S      G        
   426  215 H S  G < 5S-     0   0   32  176   64  K  NNNN          G   G  S   NT               V        T      G        
   427  216 H S  T < 5 +     0   0  111  176   72  N  PPPP          N   A  P   AI               T        D      T        
   428  217 H T  E   < +P  423   0F  35  176   66  K  VVVV          K   P  S   VK               K        T      K        
   429  218 H K  E     +P  422   0F 135  176   53  D  QQQQ          E   K  Q   QS               R        I      T        
   430  219 H V  E     -P  421   0F  38  125   32  L                Q   T       V               V        I      V        
   431  220 H D  E     -P  420   0F  97  125   35  H                N   A       E               E        Q      D        
   432  221 H K  E     -P  419   0F  51  113   47  V                V           L                        K      A        
   433  222 H K  E     -P  418   0F 121  113   52  P                P           K                        P      K        
   434  223 H I        -     0   0    4  109   32  I                L           K                        I               
   435  224 H V        -     0   0   79  101   61  P                            D                        S               
   436  225 H P              0   0   73   92   66  A                            P                        A               
   437  226 H R              0   0  167   78   25                                                        R               
## ALIGNMENTS  421 -  426
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    1 L D              0   0  100   71   31        
     2    2 L I        -     0   0    0   77   33        
     3    3 L V        -     0   0   88   83   53        
     4    4 L M  E     -Q   25   0G  12   86   20        
     5    5 L T  E     -Q   24   0G  80   86   17        
     6    6 L Q  E     -Q   23   0G  19   86    6        
     7    7 L S  E    S+Q   22   0G  57   86   54        
     8    8 L P        -     0   0   47  128    7        
     9    9 L A  S    S-     0   0   79  136   69        
    10   10 L S  E     -t  107   0H  78  142   56        
    11   11 L L  E     -t  108   0H  34  176   45        
    12   12 L V  E     +t  109   0H  86  187   34        
    13   13 L V  E     -t  110   0H  17  189   58        
    14   14 L S  E >   -t  111   0H  46  199   61        
    15   15 L L  T 3  S+     0   0   79  198   66        
    16   16 L G  T 3  S+     0   0   39  206    7        
    17   17 L Q    <   -     0   0   97  206   52        
    18   18 L R        -     0   0  152  206   62        
    19   19 L A  E     - R   0  79G   2  206   44        
    20   20 L T  E     - R   0  78G  66  207   59        
    21   21 L I  E     - R   0  77G   0  207   22        
    22   22 L S  E     -QR   7  76G  36  207   50        
    23   23 L a  E     -QR   6  75G   0  207    0        
    24   24 L R  E     -QR   5  74G 153  207   75        
    25   25 L A  E     -Q    4   0G   6  207   68        
    26   26 L S  S    S+     0   0   63  207   52        
    27   27 L E  S    S-     0   0  105  207   72        
    28   27AL S        -     0   0   29  207   74        
    29   27BL V        +     0   0    0   57   77        
    30   27CL D  E     +Z   35   0I  45   79   82        
    31   27DL S  E >  S+Z   34   0I  15  116   82        
    32   28 L Y  T 3  S-     0   0  173  119   89        
    33   29 L G  T 3  S+     0   0   81  200   60        
    34   30 L K  E <  S-Z   31   0I 112  170   77        
    35   31 L S  E     -Z   30   0I   7  186   77        
    36   32 L F        +     0   0    5  198   68        
    37   33 L M  E     -U   94   0H   0  205   51        
    38   34 L H  E     -U   93   0H   0  207   81        
    39   35 L W  E     -UV  92  52H   0  207    0        
    40   36 L Y  E     -UV  91  50H   0  207   13        
    41   37 L Q  E     -UV  90  49H   4  207   25        
    42   38 L Q  E     -U   89   0H  16  207   13        
    43   39 L K    >   -     0   0   47  207   59        
    44   40 L P  T 3  S+     0   0   81  207   39        
    45   41 L G  T 3  S+     0   0   58  206   20        
    46   42 L Q  S <  S-     0   0  103  207   70        
    47   43 L P        -     0   0   34  207   58        
    48   44 L P        -     0   0    5  207   20        
    49   45 L K  E     -V   41   0H  96  207   71        
    50   46 L V  E     +V   40   0H  10  207   43        
    51   47 L L  E     +     0   0H   2  207   26        
    52   48 L I  E     -VW  39  58H   0  207   24        
    53   49 L Y  E  >  + W   0  57H  54  207   35        
    54   50 L I  T >4 S-     0   0   10  207   91        
    55   51 L A  T 34 S+     0   0    2  207   75        
    56   52 L S  T 34 S+     0   0   73  207   57        
    57   53 L N  E <<  -W   53   0H  77  205   73        
    58   54 L L  E     -W   52   0H  63  207   64        
    59   55 L E    >   -     0   0   49  207   82        
    60   56 L S  T 3  S+     0   0  107  207   43        
    61   57 L G  T 3  S+     0   0   67  207   15        
    62   58 L V    <   -     0   0   17  207   42        
    63   59 L P    >   -     0   0   62  207   24        
    64   60 L A  T 3  S+     0   0   99  207   57        
    65   61 L R  T 3  S+     0   0   30  207    7        
    66   62 L F  E <   -S   79   0G   7  207    2        
    67   63 L S  E     -S   78   0G  59  207   17        
    68   64 L G  E     +S   77   0G  17  207    7        
    69   65 L S  E     +S   76   0G  48  207   40        
    70   66 L G  E     -S   75   0G  35  207   76        
    71   67 L S  E >   +S   74   0G  68  206   22        
    72   68 L R  T 3  S-     0   0  163  206   33        
    73   69 L T  T 3  S+     0   0   51  206   59        
    74   70 L D  E <   +RS  24  71G  77  206   64        
    75   71 L F  E     -RS  23  70G   0  206   82        
    76   72 L T  E     -RS  22  69G  33  206   58        
    77   73 L L  E     -RS  21  68G   0  206    3        
    78   74 L T  E     -RS  20  67G  28  206   44        
    79   75 L I  E     -RS  19  66G   0  206    3        
    80   76 L D  S    S+     0   0   68  206   39        
    81   77 L P  S    S-     0   0   51  206   60        
    82   78 L V        +     0   0    0  206   50        
    83   79 L E    >   -     0   0   93  206   33        
    84   80 L A  G >  S+     0   0   22  206   52        
    85   81 L D  G 3  S+     0   0   58  206   27        
    86   82 L D  G <   +     0   0    1  206    0        
    87   83 L A    <   +     0   0   12  206   78        
    88   84 L A  E    S- X   0 108H   8  206   19        
    89   85 L T  E     -UX  42 107H  35  207   69        
    90   86 L Y  E     -UX  41 106H   0  207    5        
    91   87 L Y  E     -U   40   0H   9  207    7        
    92   88 L a  E     -U   39   0H   0  207    4        
    93   89 L Q  E     -UY  38 102H   1  207   79        
    94   90 L Q  E     +UY  37 101H   0  207   84        
    95   91 L N        +     0   0    0  185   59        
    96   92 L N  S    S+     0   0    1  190   79        
    97   93 L E  S    S-     0   0   48  189   80        
    98   94 L D  S    S+     0   0   42  192   76        
    99   95 L P  S    S-     0   0   26  108   72        
   100   96 L P        -     0   0    4  141   88        
   101   97 L T  E     -Y   94   0H  26  181   65        
   102   98 L F  E     -Y   93   0H  26  205    9        
   103   99 L G        -     0   0    3  207   13        
   104  100 L A        -     0   0   81  207   63        
   105  101 L G        -     0   0   12  207   10        
   106  102 L T  E     - X   0  90H   0  207   10        
   107  103 L K  E     -tX  10  89H  74  207   54        
   108  104 L L  E     +tX  11  88H   2  206   19        
   109  105 L E  E     -t   12   0H  14  207   67        
   110  106 L M  E     -t   13   0H   0  207   27        
   111  107 L R  E     +t   14   0H 126  207   85        
   112  108 L R        -     0   0   64  207   79        
   113  109 L A        -     0   0   71  198   67        
   114  110 L D        -     0   0   58  203   71        
   115  111 L A  B     -A  144   0J  19  204   57        
   116  112 L A        -     0   0   40  206   62        
   117  113 L P        -     0   0    9  206    1        
   118  114 L T  E     -B  141   0K  85  206   55        
   119  115 L V  E     -B  140   0K   8  206   18        
   120  116 L S  E     -B  139   0K  17  206   69        
   121  117 L I  E     -B  138   0K  22  207   30        
   122  118 L F  E     -B  137   0K   4  207    7        
   123  119 L P        -     0   0    5  207   23        
   124  120 L P        -     0   0    1  207    4        
   125  121 L S    >>  -     0   0    8  207    4        
   126  122 L S  H 3> S+     0   0   78  207   65        
   127  123 L E  H 3> S+     0   0   76  207   23        
   128  124 L Q  H <4>S+     0   0    8  207   27        
   129  125 L L  H ><5S+     0   0   29  207   22        
   130  126 L T  H 3<5S+     0   0  111  207   71        
   131  127 L S  T 3<5S-     0   0   83  207   67        
   132  128 L G  T < 5S+     0   0   34  207   53        
   133  129 L G  E   < - C   0 186K  21  205   60        
   134  130 L A  E     - C   0 185K   0  207   13        
   135  131 L S  E     - C   0 184K   2  207   38        
   136  132 L V  E     - C   0 183K   0  207   28        
   137  133 L V  E     -BC 122 182K   0  207   12        
   138  134 L b  E     -BC 121 181K   0  207    3        
   139  135 L F  E     -BC 120 180K   0  207   31        
   140  136 L L  E     -BC 119 179K   0  206   48        
   141  137 L N  E     -B  118   0K   2  207   48        
   142  138 L N  E    S+     0   0K  49  207   47        
   143  139 L F  E     - C   0 177K   0  207   30        
   144  140 L Y  B    S+A  115   0J   9  206   40        
   145  141 L P  S    S-     0   0   18  207    7        
   146  142 L K  S    S+     0   0   83  206   75        
   147  143 L D        +     0   0  116  207   72        
   148  144 L I        -     0   0   19  206   60        
   149  145 L N  E     -E  201   0L  82  207   67        
   150  146 L V  E     -E  200   0L  27  207   11        
   151  147 L K  E     -E  199   0L  53  207   75        
   152  148 L W  E     +E  198   0L   3  207    2        
   153  149 L K  E     +EF 197 158L  76  207   39        
   154  150 L I  E    S-E  196   0L   0  207   67        
   155  151 L D  S    S-     0   0   71  207   19        
   156  152 L G  S    S+     0   0   63  207   35        
   157  153 L S  S    S-     0   0   33  206   68        
   158  154 L E  B     -F  153   0L  85  206   78        
   159  155 L R        -     0   0   69  207   77        
   160  156 L Q        +     0   0  133  207   73        
   161  157 L N  S    S+     0   0  117  207   69        
   162  158 L G  S    S+     0   0   29  207   34        
   163  159 L V  E     -D  183   0K  46   65   74        
   164  160 L L  E     -D  182   0K  16  192   49        
   165  161 L N  E     +D  181   0K  52  196   54        
   166  162 L S  E     -D  180   0K  12  204   50        
   167  163 L W  E     -D  179   0K  99  204   72        
   168  164 L T        -     0   0   24  204   69        
   169  165 L D        -     0   0   99  204   75        
   170  166 L Q        -     0   0   18  206   75        
   171  167 L D     >  -     0   0   48  206   62        
   172  168 L S  T  4 S+     0   0   54  206   61        
   173  169 L K  T  4 S+     0   0  180  206   55        
   174  170 L D  T  4 S-     0   0   57  206   36        
   175  171 L S     <  +     0   0    4  206   54        
   176  172 L T        -     0   0    5  206   71        
   177  173 L Y  E     -C  143   0K   7  204    1        
   178  174 L S  E     -     0   0K   1  205   68        
   179  175 L M  E     -CD 140 167K   0  206   80        
   180  176 L S  E     -CD 139 166K   3  206    3        
   181  177 L S  E     -CD 138 165K   0  206    0        
   182  178 L T  E     -CD 137 164K   2  206   71        
   183  179 L L  E     -CD 136 163K   0  206    0        
   184  180 L T  E     +C  135   0K  36  206   53        
   185  181 L L  E     -C  134   0K  16  206    9        
   186  182 L T  E  >  -C  133   0K  81  205   54        
   187  183 L K  H >> S+     0   0   66  204   67        
   188  184 L D  H 3> S+     0   0  109  205   63        
   189  185 L E  H >4 S+     0   0   53  205   48        
   190  186 L Y  H X< S+     0   0    6  205   12        
   191  187 L E  H 3< S+     0   0   90  205   71        
   192  188 L R  T << S+     0   0  160  205   58        
   193  189 L H    <   -     0   0   24  203   55        
   194  190 L N  S    S+     0   0   97  203   71        
   195  191 L S  E     + G   0 214L  37  203   71        
   196  192 L Y  E     +EG 154 213L   0  203   15        
   197  193 L T  E     -EG 153 212L   3  203   48        
   198  194 L b  E     -EG 152 211L   1  203    0        
   199  195 L E  E     -EG 151 210L  34  203   61        
   200  196 L A  E     -EG 150 209L   1  203   23        
   201  197 L T  E     +E  149   0L  36  203   31        
   202  198 L H  E >   - G   0 205L  18  203   19        
   203  199 L K  T 3  S+     0   0  145  202   55        
   204  200 L T  T 3  S+     0   0   55  202   40        
   205  201 L S  E <   -G  202   0L  45  180   82        
   206  202 L T  E    S+     0   0L 140  180   32        
   207  203 L S  E    S-     0   0L  82   83   48        
   208  204 L P  E     -     0   0L  43   67   33        
   209  205 L I  E     -G  200   0L  46   67   29        
   210  206 L V  E     +G  199   0L  70   63   53        
   211  207 L K  E     +G  198   0L  85   63   26        
   212  208 L S  E     -G  197   0L  67   63   28        
   213  209 L F  E     -G  196   0L  30   63   18        
   214  210 L N  E      G  195   0L  99   63   62        
   215  211 L R              0   0   82   54   19        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  192   30  Q DEQE
   218    2 H V        +     0   0   30  194   40  V VVVI
   219    3 H K  E     -A  241   0A 143  197   48  L QKVL
   220    4 H L  E     -A  240   0A  11  217    3  LLLLLL
   221    5 H Q  E     -A  239   0A 120  217   73  VVVETS
   222    6 H E  E     -A  238   0A   2  218   33  EEEEQQ
   223    7 H S  E     +A  237   0A  48  218   13  SSSSSK
   224    8 H G        -     0   0   35  218   20  GGGGGA
   225    9 H P        -     0   0   50  218   49  GGGGPS
   226   10 H A  S    S+     0   0   30  218   51  DDGGEE
   227   11 H V  E     -d  334   0B  33  218   25  VVLVMI
   228   12 H I  E     -d  335   0B   9  218   54  KKVKKA
   229   13 H K        -     0   0  104  218   50  KKQRKN
   230   14 H P  S    S+     0   0   56  218    9  PPTPPV
   231   15 H S  S    S+     0   0   90  218   20  GGGGGG
   232   16 H Q  S    S-     0   0   76  218   59  DDGDET
   233   17 H S        -     0   0   51  217   20  SSSSSS
   234   18 H L  E     - B   0 300A   1  217   43  LLLLTI
   235   19 H S  E     - B   0 299A  64  218   51  RRRSRL
   236   20 H L  E     - B   0 298A   1  218   13  LLLLLL
   237   21 H T  E     -AB 223 297A  29  218   33  SSSSKE
   238   22 H c  E     -AB 222 296A   0  219    1  CCCCCC
   239   23 H I  E     -AB 221 295A  54  217   75  KKAKAE
   240   24 H V  E     -A  220   0A   4  217   51  AAAGVV
   241   25 H S  E     +A  219   0A  60  218    9  SSSSSS
   242   26 H G  S    S+     0   0   54  218    3  GGGGGG
   243   27 H F  S    S-     0   0   37  199   23  FFFFF.
   244   28 H S    >   -     0   0   44  200   45  TTTTT.
   245   29 H I  T 3  S+     0   0    2   56   45  .....Y
   246   30 H T  T 3   +     0   0   59   61   59  .....N
   247   31 H R  S X  S-     0   0  145  218   53  FFFFII
   248   32 H T  T 3  S+     0   0   72  204   59  SSNRTN
   249   33 H N  T 3  S+     0   0   16  204   62  SSSDSD
   250   34 H Y  E <   -E  317   0C  23  220   46  YYYYYH
   251   35 H d  E     -EF 316 270C   0  218   89  NWWYYH
   252   35AH W  E     -EF 315 269C   1  218   43  MMMMMM
   253   35BH H  E     -EF 314 268C   0  219   73  NSNNAN
   254   36 H W  E     +EF 313 267C   1  221    2  WWWWWW
   255   37 H I  E     -EF 312 265C   0  221   15  VVVVVV
   256   38 H R  E     -EF 311 264C  10  221   15  RRRRRR
   257   39 H Q  E     -EF 310 263C  22  220    2  QQQQQQ
   258   40 H A    >   -     0   0   14  220   61  AAAAEA
   259   41 H P  T 3  S+     0   0   99  221   19  PPPPTP
   260   42 H G  T 3  S+     0   0   94  221   12  AGGGGG
   261   43 H K  S <  S-     0   0  140  221   34  KKKKKA
   262   44 H G        -     0   0   20  221   24  GGGGGg
   263   45 H L  E     -F  257   0C  10  221    9  LLLLLi
   264   46 H E  E     -F  256   0C  79  221    9  EEEEEE
   265   47 H W  E     +F  255   0C  13  221    9  WWWWWW
   266   48 H M  E     -     0   0C   3  221   31  VVVVLL
   267   49 H G  E     -FG 254 277C   0  221   42  AASAVA
   268   50 H R  E     -FG 253 276C  10  221   93  HTTESA
   269   51 H I  E     -FG 252 275C   3  221   16  IIIIYF
   270   52 H d  E >   -F  251   0C   0  221   83  KDTGWR
   271   53 H Y  T 3  S+     0   0   47  221   84  sdhtKt
   272   54 H E  T 3  S-     0   0   63  207   63  p.dsP.
   273   55 H G  S <  S+     0   0   25  200   53  .s.SGy
   274   56 H S        -     0   0   42  217   74  .QSPST
   275   57 H I  E     -G  269   0C  71  220   53  TQTLET
   276   58 H Y  E     -G  268   0C  70  221   79  YFYRYH
   277   59 H Y  E     -G  267   0C  41  221   17  YYYYYI
   278   60 H S    >>  -     0   0   11  221   61  AAPSSS
   279   61 H P  T 34 S+     0   0   76  221   51  DDDNPE
   280   62 H S  T 34 S+     0   0   79  221   52  SSSATS
   281   63 H I  T X4 S+     0   0    4  221   40  VVVVIF
   282   64 H K  G >< S+     0   0  133  221   28  KKKRKK
   283   65 H S  G 3  S+     0   0  116  221   27  GGGGGD
   284   66 H R  G <  S+     0   0   51  221   18  RRRRRR
   285   67 H S  E <   -C  300   0A  11  221   54  FFFFFV
   286   68 H T  E     -C  299   0A  67  221   23  TTTITT
   287   69 H I  E     +C  298   0A   3  221   29  IIIIAP
   288   70 H S  E     -C  297   0A  56  221   37  SSSSSS
   289   71 H R  E     -C  296   0A  71  221   60  RRRRKT
   290   72 H D  E >>> -C  295   0A  55  221   10  DDDDDS
   291   73 H T  T 345S+     0   0   78  220   57  NNND.G
   292   74 H S  T 345S+     0   0  105  220   44  PPAS.S
   293   75 H L  T <45S-     0   0  103  217   69  NNKNS.
   294   76 H N  T  <5 +     0   0   29  218   47  NNNSS.
   295   77 H K  E   < -BC 239 290A  51  221   70  LLMLNT
   296   78 H F  E     -BC 238 289A   1  221   60  LLLLFA
   297   79 H F  E     -BC 237 288A  50  221   32  HHYSYQ
   298   80 H I  E     -BC 236 287A   4  221    5  LLLLLL
   299   81 H Q  E     -BC 235 286A  73  221   35  QQQQQR
   300   82 H L  E     -BC 234 285A   3  221   19  MLMMMI
   301   82AH I        +     0   0   70  221   58  TTNNNN
   302   82BH S  S    S-     0   0   59  221   33  GGSNGK
   303   82CH V        -     0   0    0  221   13  LLLLLL
   304   83 H T    >   -     0   0   65  221   63  KKRKKS
   305   84 H N  G >  S+     0   0  120  221   62  PPATPS
   306   85 H E  G 3  S+     0   0  160  221   21  EEEEES
   307   86 H D  G <  S+     0   0    0  221    1  DDDDDD
   308   87 H T    <   +     0   0   30  221   36  TTTSTI
   309   88 H A  E    S- H   0 333C   3  221    5  AAAAAA
   310   89 H M  E     -EH 257 332C  43  221   61  RRVVLT
   311   90 H Y  E     -EH 256 331C   2  221    0  YYYYYY
   312   91 H Y  E     -E  255   0C   1  221    3  YYYYYY
   313   92 H c  E     +E  254   0C   0  221    1  CCCCCC
   314   93 H S  E     -EI 253 327C   0  221   30  AAVAAA
   315   94 H R  E     -EI 252 326C  20  220   39  RRLRRR
   316   95 H E  E     -EI 251 324C   0  220   75  DHSDDG
   317   96 H N  E  >> -E  250   0C   6  220   89  ITQTTY
   318   97 H H  T  45S+     0   0    0  220   93  TQVVVF
   319   98 H M  T  45S+     0   0   73  221   94  VYQKRD
   320   99 H Y  T  45S+     0   0  159  221   92  TGLEGY
   321  100 H E  T  <5 -     0   0   54  221   92  DCQSSW
   322  100AH T      < +     0   0    0  221   92  GWEERG
   323  100BH Y  S    S-     0   0   10  221   92  WGSYSQ
   324  100CH F  E     +I  316   0C   0  221   93  MQGeGG
   325  101 H D  E     +     0   0C  42  133   50  ...p..
   326  102 H V  E     -I  315   0C  35  153   74  ...FL.
   327  103 H W  E     -I  314   0C  28  177   14  ...SR.
   328  104 H G        -     0   0    3  204   16  .G.GQ.
   329  105 H Q        -     0   0  100  183   48  D.....
   330  106 H G        -     0   0    3  191    7  G..G..
   331  107 H T  E     -H  311   0C  27  202   47  R..S.T
   332  108 H T  E     -H  310   0C  48  208   81  VP.GNM
   333  109 H V  E     -H  309   0C   0  214   25  VL.LLV
   334  110 H T  E     -d  227   0B  16  217   44  AP.DPT
   335  111 H V  E     +d  228   0B   2  218   17  GS.VLV
   336  112 H S        -     0   0   18  219   35  TA.QQT
   337  113 H S  S    S+     0   0   99  220   31  GAPSRS
   338  114 H A  S    S-     0   0   31  221   51  naGEqA
   339  115 H K        -     0   0  143  209   69  ng..pT
   340  116 H T        -     0   0   44  210   73  SP..GS
   341  117 H T  B     -J  370   0D  35  217   71  SA..GK
   342  118 H P        -     0   0   60  218   66  AA..VS
   343  119 H P        -     0   0   13  218   31  RG..RP
   344  120 H S  E     -K  367   0E  51  218   62  SG..SS
   345  121 H V  E     -K  366   0E   6  219   45  QK..HL
   346  122 H Y  E     -K  365   0E  27  220   34  IV.IIF
   347  123 H P  E     -K  364   0E  15  220   29  SQ.KQP
   348  124 H L  E     +K  363   0E   4  221    3  LLLLLL
   349  125 H A        -     0   0   10  221   68  vvVevI
   350  126 H P        -     0   0   24  216   47  ss.spS
   351  127 H G  S    S-     0   0   16  219   75  GG.GGC
   352  128 H S  S    S+     0   0   99  219   60  GG.GGG
   353  129 H A        +     0   0   52  220   92  ddKgdE
   354  130 H A        +     0   0   70  136   83  kk.rk.
   355  133 H Q        +     0   0  178  159   73  KK.RK.
   356  134 H T    >   -     0   0   64  220   50  PPPPPS
   357  135 H N  T 3  S-     0   0  146  221   56  GGSGRM
   358  136 H S  T 3  S+     0   0   63  221   63  DDQEDD
   359  137 H M  E <   - L   0 408E  83  221   79  SSTTTP
   360  138 H V  E     - L   0 407E  15  221   34  LLLVLV
   361  139 H T  E     + L   0 406E  15  221   70  RRSLRT
   362  140 H L  E     + L   0 405E   0  221   27  LLLILI
   363  141 H G  E     -KL 348 404E   0  221   30  SSISSG
   364  142 H e  E     -KL 347 403E   1  221    0  CCCCCC
   365  143 H L  E     -KL 346 402E   2  221   33  KKTKKL
   366  144 H V  E     -KL 345 401E   1  221   49  AAVAAA
   367  145 H K  E     -KL 344 400E  38  220   74  SSSSSK
   368  146 H G  E    S+     0   0E  19  221   50  GGGGGD
   369  147 H Y  E     - L   0 399E   0  221   18  FFYFFF
   370  148 H F  B     +J  341   0D   3  221   42  TTSTTL
   371  149 H P  S    S-     0   0    0  221   37  FFiFFP
   372  150 H E  S    S+     0   0   53  211   46  SSsSTE
   373  151 H P        +     0   0   59  219   54  SSGSDT
   374  152 H V        -     0   0   20  221   53  YNYHYI
   375  153 H T  E     +N  422   0F  83  220   71  NWCYHS
   376  154 H V  E     +N  421   0F  23  221   43  MMWMMF
   377  156 H T  E     -N  420   0F  48  221   56  NSTENT
   378  157 H W  E > >S-NO 419 383F   2  221    0  WWWWWW
   379  162 H N  G > 5S-     0   0   38  221   69  VVIAVg
   380  163 H S  G 3 5S-     0   0   91  218   63  RRRRRn
   381  164 H G  G < 5S+     0   0   39  218   55  QQQQQA
   382  165 H S  T < 5 +     0   0   93  221   60  AAPAAS
   383  166 H L  B   < +O  378   0F  43  221   87  PPQPPY
   384  167 H S        +     0   0   88  221   69  GGGGGS
   385  168 H S  S    S+     0   0  101  221   77  QKKKKT
   386  169 H G  S    S+     0   0   32  218   43  GGGGGG
   387  171 H V        +     0   0   48  219   62  LLLLLL
   388  172 H H  E     -M  404   0E  17  220   80  EEEEEK
   389  173 H T  E     -M  403   0E  69  220   82  WWWWWS
   390  174 H F  E     -M  402   0E   1  219   43  IIMVVY
   391  175 H P  E     -     0   0E  65  219   32  SGGATK
   392  176 H A  E     -     0   0E  19  215   65  RECRHP
   393  177 H V  E     -M  400   0E  42  214   63  IIIIIV
   394  178 H L  E     -M  399   0E  77  214   65  YHGGQM
   395  179 H Q  S    S-     0   0   83  214   70  TPYTVQ
   396  180 H S  S    S-     0   0  116  214   49  DSdSts
   397  183 H D  S    S+     0   0   90  206   25  G.nStg
   398  184 H L        -     0   0   53  199   75   .TSYT
   399  185 H Y  E     -LM 369 394E  36  205    2   .YYYY
   400  186 H T  E     +LM 367 393E   5  195   48   .  AS
   401  187 H L  E     -L  366   0E  11  190   56   .   A
   402  188 H S  E     -LM 365 390E   5  191   26   S   S
   403  189 H S  E     -LM 364 389E   2  191    0   S   S
   404  190 H S  E     -LM 363 388E   0  191   77   S   Q
   405  191 H V  E     -L  362   0E   0  190   27   I   V
   406  192 H T  E     +L  361   0E  48  189   37   N   N
   407  193 H V  E     -L  360   0E  14  188   30       V
   408  194 H P  E  >  -L  359   0E  56  188   40       A
   409  195 H S  T  4 S+     0   0   49  187   50       S
   410  196 H S  T  4 S+     0   0   66  187   69       A
   411  198 H P  T  > S+     0   0   31  187   72       V
   412  199 H R  T  < S+     0   0   16  187  102       W
   413  200 H P  T  4 S+     0   0   80  188   68       D
   414  202 H S  T  4 S+     0   0  111  188   69       N
   415  203 H E  S  < S-     0   0  128  188   76       I
   416  204 H T        -     0   0   83  188   70       e
   417  205 H V        +     0   0    4  184   61       f
   418  206 H T  E     - P   0 433F  23  183   70       Y
   419  208 H e  E     -NP 378 432F   0  187    0       C
   420  209 H N  E     -NP 377 431F   4  187   60       N
   421  210 H V  E     -NP 376 430F   1  187   16       A
   422  211 H A  E     -NP 375 429F  14  187   74       K
   423  212 H H  E > > - P   0 428F   1  187    7       H
   424  213 H P  G > 5S+     0   0   77  177   83       L
   425  214 H A  G 3 5S+     0   0   40  177   67       D
   426  215 H S  G < 5S-     0   0   32  176   64       T
   427  216 H S  T < 5 +     0   0  111  176   72       I
   428  217 H T  E   < +P  423   0F  35  176   66       K
   429  218 H K  E     +P  422   0F 135  176   53       S
   430  219 H V  E     -P  421   0F  38  125   32       V
   431  220 H D  E     -P  420   0F  97  125   35       E
   432  221 H K  E     -P  419   0F  51  113   47       L
   433  222 H K  E     -P  418   0F 121  113   52       K
   434  223 H I        -     0   0    4  109   32       K
   435  224 H V        -     0   0   79  101   61       D
   436  225 H P              0   0   73   92   66       P
   437  226 H R              0   0  167   78   25        
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1    1 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  28  25   0  46    71    0    0   1.061     35  0.68
    2    2 L  16  12  65   0   0   0   0   0   0   1   3   1   0   0   0   0   0   0   3   0    77    0    0   1.123     37  0.66
    3    3 L  64   2   4   0   0   0   0   0   0   0   0   6   0   0   2   4  16   2   0   0    83    0    0   1.255     41  0.46
    4    4 L  13  33   1  53   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    86    0    0   1.015     33  0.80
    5    5 L   0   3   2   0   0   0   0   0   0   0   2  91   0   0   0   0   0   0   1   0    86    0    0   0.432     14  0.82
    6    6 L   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0  97   0   1   1    86    0    0   0.190      6  0.93
    7    7 L   0   0   0   0   0   0   0   0   0   1  55  35   0   1   0   5   3   0   0   0    86    1    0   1.061     35  0.46
    8    8 L   0   2   0   0   0   0   0   0   0  96   1   2   0   0   0   0   0   0   0   0   128    0    0   0.206      6  0.93
    9    9 L   1  12   1   0   0   0   1   4  26  26  26   0   0   0   0   0   0   1   0   2   136    0    0   1.681     56  0.31
   10   10 L  10   1   3   5   1   0   2   1   4   0  67   7   0   0   0   0   0   0   0   0   142    0    0   1.262     42  0.44
   11   11 L  45  40   1   3   1   0   0   0   2   0   0   0   0   2   1   2   1   2   0   1   176    0    0   1.319     44  0.55
   12   12 L   1   1   0   0   1   0   2   0   3   9  79   5   0   1   0   0   0   0   0   0   187    0    0   0.859     28  0.66
   13   13 L  50   5   2   0   1   0   0  19  16   0   6   2   0   0   0   1   0   0   0   0   189    0    0   1.470     49  0.42
   14   14 L   1   3   2   0   1   0   0   0  12   3  52  17   0   0   2   2   1   1   5   0   199    1    0   1.623     54  0.38
   15   15 L  16  22   1   0   0   0   0   0   2  53   1   3   0   0   0   2   3   0   0   0   198    0    0   1.344     44  0.33
   16   16 L   0   0   0   0   0   0   0  97   0   0   0   0   0   0   1   2   0   0   0   0   206    0    0   0.181      6  0.93
   17   17 L   0   0   0   0   0   0   0  12   3   0   4   2   0   0   0   1  43  24   0  10   206    0    0   1.608     53  0.48
   18   18 L   0   0   0   0   0   0   0   0   1   5  15  51   0   0  17   4   2   2   1   0   206    0    0   1.527     50  0.38
   19   19 L  58   1   4   0   0   0   0   0  35   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.935     31  0.55
   20   20 L   2   0   1   0   0   0   0   1   1   0  18  55   0   0  13   6   1   0   0   0   207    0    0   1.431     47  0.41
   21   21 L   1  27  68   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   0.795     26  0.77
   22   22 L   0   0   0   0   0   0   0   0   1   1  40  50   0   0   0   0   0   0   3   2   207    0    0   1.132     37  0.50
   23   23 L   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   207    0    0   0.000      0  1.00
   24   24 L   0   0   0   0   0   0   0   7   3   0  20  20   0   0  21  17   4   3   4   0   207    0    0   1.957     65  0.24
   25   25 L   0  10   2   0   0   1   0  41  26   0   9   7   0   1   1   0   0   0   0   0   207    0    0   1.648     55  0.32
   26   26 L   0   0   0   0   0   0   0   3   0   0  57  13   0   0   1   0   2   0   9  15   207    0    0   1.339     44  0.47
   27   27 L   0   1   0   0   0   0   0   4   2   1  37   5   0   0   6   3  26   2   9   3   207    0    0   1.870     62  0.27
   28   27 L   3   6  12   0   2   0   2  10   4   1  42   2   0   0   0   0   0   0   5  10   207  150   31   1.982     66  0.25
   29   27 L  32  12  14   0   0   0   4   2   7   2   7   7   0   7   0   7   0   0   0   0    57   10    3   2.089     69  0.23
   30   27 L   4   0   0   1   1   0  14   4   3   0  11   0   0  19   4   0   0   4   4  32    79    9    4   2.026     67  0.17
   31   27 L  18   0  15   0   0   1   2   2   0   1  21   9   0   1   2   0   1   1  17  11   116    0    0   2.091     69  0.17
   32   28 L   8   3  24   0   0   1  13  13   0   0   5   8   0   1   0   1   2   2   8  12   119    0    0   2.257     75  0.11
   33   29 L   7   1  12   0   0   0   0  57   1   2  11   3   1   0   0   1   0   0   1   1   200   32   29   1.575     52  0.39
   34   30 L   1   1   1   0   1   0  12   6   2   0  35   4   1   1   4   8   1   1  17   7   170    0    0   2.087     69  0.23
   35   31 L   0   1   0   1   0   0  12   2   2   0  13   9   0   5   1  15   0   2  32   4   186    0    0   2.052     68  0.22
   36   32 L   0   3   0   0   3   3  54   3   7   0   6   2   5   4   5   1   0   0   4   4   198    0    0   1.815     60  0.32
   37   33 L  38  29   9   7   0   0   2   0   8   4   0   1   0   0   0   0   0   0   0   0   205    0    0   1.682     56  0.48
   38   34 L   0   0   0   0   3   0  11   5  14   0  29   0   1  16   3   0   4   1  11   1   207    0    0   2.105     70  0.18
   39   35 L   0   0   0   0   1  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   0.085      2  0.99
   40   36 L   1   2   1   0  10   0  84   0   0   0   0   0   0   1   0   0   0   0   0   0   207    0    0   0.662     22  0.86
   41   37 L   0   6   0   0   0   0   0   0   0   0   0   0   0   1   3   4  86   0   0   0   207    0    0   0.614     20  0.74
   42   38 L   0   1   0   0   0   0   0   0   0   0   0   0   0   3   0   2  91   1   0   0   207    0    0   0.432     14  0.87
   43   39 L   4   3   7   3   2   0   0   0   0   1   0   3   0   9   8  59   0   0   0   0   207    0    0   1.541     51  0.41
   44   40 L   0   5   0   0   0   0   0   0   6  74  10   2   0   0   0   0   1   0   0   1   207    1   17   1.020     34  0.61
   45   41 L   0   0   0   0   0   0   0  86   0   4   1   0   0   0   0   0   0   2   2   2   206    0    0   0.673     22  0.79
   46   42 L   0   2   0   0   0   0   0   2   4   0  18   6   0   2   4  18  34   8   0   0   207    0    0   1.915     63  0.29
   47   43 L   6   1   1   0   0   0   0   2  53  12  16   3   0   0   4   1   0   0   0   0   207    0    0   1.548     51  0.42
   48   44 L   1   2   0   0   1   0   0   0   0  90   0   0   0   0   3   0   3   0   0   0   207    0    0   0.481     16  0.80
   49   45 L  17   1   0   1   1   0   4   0   0   0   0   2   0   0  22  41   7   2   0   0   207    0    0   1.684     56  0.29
   50   46 L   4  71   0   1   4   0   2   2   0   1   1  10   0   0   1   0   0   0   0   0   207    0    0   1.213     40  0.56
   51   47 L  16  63  10   7   0   1   0   0   2   0   0   0   0   0   0   0   0   0   0   0   207    0    0   1.142     38  0.74
   52   48 L   5   6  82   1   0   1   1   0   0   0   1   0   0   0   3   0   0   0   0   0   207    0    2   0.772     25  0.76
   53   49 L   0   0   0   0   5   0  80   3   0   0   1   0   1   1   4   2   0   0   0   0   207    0    0   0.913     30  0.65
   54   50 L   1   4   2   0   2   2  13  12   5   0   9   1   0   3   5   7   4  10   5  14   207    0   27   2.611     87  0.09
   55   51 L  19   1   4   0   0   0   0   4  21   0  11   8   0   0   0   0   0   1  13  18   207    0    0   2.033     67  0.24
   56   52 L   0   0   0   0   0   0   1   0   1   1  53  14   0   0   2   4   0   0  14   9   207    2   18   1.499     50  0.42
   57   53 L   1   0   1   0   0   0   1   0   1   0  18  15   0   3   4  17   3   4  27   3   205    0    0   2.074     69  0.27
   58   54 L   0  18   0   0   1   0   3   0   0   0   0   0   0   0  64   3   6   0   1   0   207    0    0   1.198     40  0.36
   59   55 L   2   0   0   0   5   0   6  11   9  43   0   0   0   4   1   1   8   5   1   1   207    0    0   1.996     66  0.18
   60   56 L   0   0   0   0   0   0   1   1   0   3  70  15   0   0   0   0   0   0   0   7   207    0    0   1.049     35  0.56
   61   57 L   0   0   0   0   0   1   0  91   0   0   2   0   0   0   0   1   0   0   3   0   207    0   15   0.462     15  0.84
   62   58 L  49   0  31   0   1   0   0   0   0   0   4  15   0   0   0   0   0   0   0   0   207    0    0   1.169     39  0.58
   63   59 L   0   0   0   0   0   0   0   0   2  82  14   0   0   0   0   0   0   0   0   0   207    0    0   0.613     20  0.76
   64   60 L   0   0   0   0   0   0   0   0  14   4  18   0   0   0   0   0   0  21   5  37   207    0    0   1.648     55  0.42
   65   61 L   0   0   0   0   0   0   0   0   0   0   0   0   0   1  94   3   2   0   0   0   207    0    0   0.298      9  0.92
   66   62 L   0   0   2   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   0.126      4  0.98
   67   63 L   0   0   0   0   0   0   0   0   0   0  90   7   0   0   0   0   0   0   2   0   207    0    0   0.402     13  0.83
   68   64 L   0   0   0   0   0   0   0  95   0   0   4   0   0   0   0   0   0   0   0   0   207    0   27   0.209      6  0.93
   69   65 L   0   0   0   0   0   0   0   0   3   0  75   6   0   6   0   1   0   0   0   7   207    0    0   0.953     31  0.59
   70   66 L   1   2   4   0   0   0   0  33   1   0  10   1   0   0   2  21   6   0  16   1   207    1    0   1.926     64  0.24
   71   67 L   1   1   1   0   1   0   1   0   2   2  88   1   0   0   0   0   0   0   0   0   206    0    0   0.608     20  0.78
   72   68 L   0   0   0   0   0   0   0  76   1   0   8   2   0   0   1   2   0   3   3   2   206    0    0   1.015     33  0.66
   73   69 L   0   0   0   0   0   0   0   2   2   0   7  42   0   0   0   2   1   0  39   2   206    0    0   1.395     46  0.41
   74   70 L   2   0   1   1   0   0   0   1   1   0   8  42   0   0   0   5   2   2   0  34   206    0    0   1.546     51  0.36
   75   71 L   0   0   0   0  33   0  10   9  44   0   0   0   0   1   0   0   0   0   1   0   206    0    0   1.360     45  0.17
   76   72 L   2   1   1   0   0   0   5   0   3   0  26  56   0   0   1   0   2   0   0   0   206    0    0   1.359     45  0.41
   77   73 L   0  91   0   4   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.357     11  0.97
   78   74 L   0   0   5   0   0   0   0   0   4   0   7  71   0   0   1   6   0   2   1   0   206    0    0   1.182     39  0.56
   79   75 L   1   2  96   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.199      6  0.97
   80   76 L   0   0   0   0   0   0   0   1   2   0  72  14   0   0   1   4   0   0   4   0   206    0    0   1.042     34  0.61
   81   77 L   0   0   0   0   0   0   0  51   1   1  20   0   0   0  18   0   0   2   5   0   206    0    0   1.363     45  0.40
   82   78 L  38  38   1   2   0   0   0   0  17   0   1   2   0   0   0   0   0   0   0   0   206    0    0   1.327     44  0.50
   83   79 L   0   2   0   0   0   0   0   0   0   0   0   0   0   0   2   1  64  30   0   0   206    0    0   0.901     30  0.67
   84   80 L   2   2   0   0   0   0   0   1  53  22   5  11   0   0   0   0   0   3   0   0   206    0    0   1.432     47  0.48
   85   81 L   0   0   0   1   0   0   0  14   0   0   0   0   0   0   0   0   2  75   1   6   206    0    0   0.894     29  0.73
   86   82 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   206    0    0   0.031      1  0.99
   87   83 L   3   3   2   1  13   0   0   0  14   0   4   1   0   0   0   0   0  52   0   5   206    0    0   1.598     53  0.21
   88   84 L   1   0   0   0   0   0   0  18  80   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.574     19  0.80
   89   85 L  24   1   2   1   0   0   0   1   0   0   1   8   0   1   0   0   2   3   0  53   207    0    0   1.515     50  0.31
   90   86 L   0   0   0   0   0   0  97   0   0   0   0   0   1   0   0   0   0   0   0   0   207    0    0   0.176      5  0.95
   91   87 L   0   0   1   0  11   0  85   0   0   0   0   0   0   1   0   0   0   0   0   0   207    0    0   0.566     18  0.92
   92   88 L   0   0   0   0   0   0   0   0   0   0   1   0  97   0   0   0   0   0   0   0   207    0    0   0.167      5  0.95
   93   89 L   1   5   0   6   1   1   3   7  13   0  11   0   3   0   1   1  41   0   2   0   207    0    0   2.051     68  0.21
   94   90 L  12   7   2   0   0   0   0   5   7   0  26   9   0   1   1   0  26   1   1   0   207   22   22   2.061     68  0.15
   95   91 L   2   1   1   0   3  28  45   6   2   0   3   1   0   2   2   1   0   2   1   1   185    0    0   1.732     57  0.40
   96   92 L   2   1   2   0   1   3   3   4   8   2  15   8   0   7   2   4   5   2   5  28   190   16  126   2.403     80  0.20
   97   93 L   3   3   1   0   1   0   1  10  10   2  22  10   6  10   2   1   4   6   8   3   189    0    0   2.513     83  0.20
   98   94 L  20  18   7   1  11  11  10   0   2   1  10   3   2   2   1   0   0   0   2   1   192   97   39   2.307     77  0.24
   99   95 L   8   1   0   0   0   4   0   3   6  49   6   6  11   3   2   0   1   0   2   0   108    0    0   1.838     61  0.27
  100   96 L  10   4   1   0   9  16  18   4   4  10   3   6   0   6   5   0   1   0   2   0   141    0    0   2.446     81  0.12
  101   97 L  36   1  10   1   1   1   2   1   2   0   3  38   1   2   1   0   1   0   1   0   181    0    0   1.641     54  0.35
  102   98 L   0   1   0   0  92   3   0   0   0   0   1   0   0   1   0   0   0   0   0   0   205    0    0   0.439     14  0.90
  103   99 L   0   0   0   0   0   1   0  92   0   0   3   0   0   0   0   0   0   0   1   0   207    0    0   0.437     14  0.86
  104  100 L   1   0   1   0   0   0   0  46   6   2  12   6   0   0   0   6  15   2   0   0   207    0    0   1.759     58  0.36
  105  101 L   0   0   0   0   0   0   0  93   0   0   2   0   0   0   1   0   0   2   0   0   207    0    0   0.384     12  0.89
  106  102 L   0   1   0   0   0   0   0   0   0   1   2  94   0   0   0   0   0   0   0   0   207    0    0   0.356     11  0.89
  107  103 L   0   0   0   1   0   0   0   0   1   0   1   8   0   1  14  48  19   4   1   0   207    0    0   1.593     53  0.45
  108  104 L  20  76   1   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   206    0    0   0.728     24  0.80
  109  105 L   5   3   3   0   0   0   0   0   2   1   2  50   0   0   0   0   0  26   1   3   207    0    0   1.573     52  0.33
  110  106 L  59  10  26   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   1.143     38  0.73
  111  107 L   0  47   2   0   0   0   0   4   0   2   2   6   0   0   2  26   1   0   4   2   207    0    0   1.682     56  0.15
  112  108 L   0   3   0   0   0   0   0  40   0   0   9   9   0   0  33   1   2   0   0   1   207    9   21   1.530     51  0.21
  113  109 L   0   0   0   0   0   0   0   6  17   0  10   5   0   2   1   0  46   1   3  11   198    0    0   1.670     55  0.33
  114  110 L  25   1   0   0   0   0   0   1   0  48   5   0   0   1   0   0   0   0   0  18   203    1  111   1.362     45  0.28
  115  111 L  11   0   0   0   0   0   0   0  59   2  17   1   0   0   3   7   0   0   0   0   204    0    0   1.291     43  0.43
  116  112 L   1   0   1   0   0   0   0   0  50  11  11   4   0   0   3   8   2   2   6   0   206    0    0   1.771     59  0.37
  117  113 L   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   206    0    0   0.061      2  0.98
  118  114 L   9   3   0   0   0   0   0   0   2   0  56  29   0   0   0   0   1   0   0   0   206    0    0   1.148     38  0.44
  119  115 L  82  12   3   1   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.679     22  0.82
  120  116 L   0   0   2   0  17   0   0   0   0   0  25  52   0   1   0   1   0   0   0   0   206    0    0   1.259     42  0.31
  121  117 L  12  56  30   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   1.040     34  0.70
  122  118 L   0  13   0   0  86   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   0.438     14  0.93
  123  119 L   0   1   0   0   0   0   0   1   4  86   0   1   0   0   0   4   2   0   0   0   207    0    0   0.618     20  0.77
  124  120 L   0   0   0   0   0   0   0   0   0  98   1   0   0   0   0   1   0   0   0   0   207    0    0   0.130      4  0.95
  125  121 L   0   0   0   0   1   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   207    0    0   0.115      3  0.96
  126  122 L   2   1   0   1   0   0   0   0   3   3  49  13   0   0   2   4   1  11   0   7   207    0    0   1.763     58  0.34
  127  123 L   0   1   0   0   0   0   0   0   6   0   0   0   0   0   0   0   0  82   0  10   207    0    0   0.695     23  0.77
  128  124 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  29  69   0   0   207    0    0   0.693     23  0.72
  129  125 L   7  77  14   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   207    0    0   0.755     25  0.77
  130  126 L   0   0   0   0   0   0   0   1   9   0  11  10   0   2   0  18  36   2   8   2   207    0    0   1.889     63  0.29
  131  127 L   0   0   0   0   0   0   0   6  29   0  26  18   0   0   0   4   6   2   6   3   207    0    0   1.847     61  0.32
  132  128 L   0   0   0   0   0   0   0  35   0   0   0   0   0   0   0  10   0   0  50   3   207    2    8   1.170     39  0.46
  133  129 L   0   0   0   0   0   0   0  10   1   0   7  19   0   0   1  59   0   1   1   0   205    0    0   1.286     42  0.39
  134  130 L   4   0   0   0   0   0   0   0  92   1   0   0   0   0   0   0   0   0   0   0   207    0    0   0.375     12  0.86
  135  131 L   0   0   1   0   0   0   0   0   2   0  24  72   0   0   0   0   0   0   0   0   207    0    0   0.711     23  0.62
  136  132 L  30  67   0   0   0   0   0   0   1   0   1   0   0   0   0   0   0   0   0   0   207    0    0   0.789     26  0.72
  137  133 L  89   7   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   0.462     15  0.87
  138  134 L   1   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   207    0    0   0.085      2  0.96
  139  135 L   3  76   1   1   9   0   0   0   0   0   7   1   1   0   0   0   0   0   0   0   207    1    0   0.924     30  0.68
  140  136 L   6  32  43   7   0   0   0   0   9   0   2   0   0   0   0   0   0   0   0   0   206    0    1   1.420     47  0.51
  141  137 L   0   0   0   0   0   0   0   0   0   0  56   2   0   0   0   0   0   0  40   0   207    0    0   0.898     29  0.52
  142  138 L   0   0   0   0   0   0   0  11   0   0   5   0   0   4   0   3   2   0  19  56   207    0    0   1.365     45  0.53
  143  139 L   0   0   0   0  89   0   1   5   0   0   2   0   0   0   0   0   1   0   0   0   207    1    0   0.511     17  0.70
  144  140 L   1   0   0   0   9   0  76   0   0   0   6   7   0   0   0   0   0   0   0   0   206    0    0   0.885     29  0.60
  145  141 L   0   0   0   0   0   0   0   1   0  97   0   0   0   0   0   0   0   0   0   0   207    1    0   0.198      6  0.93
  146  142 L   0   0   0   0   1   0   0  45   0   3   9   0   0   0  24  13   0   0   4   0   206    0    0   1.523     50  0.25
  147  143 L   5   0   0   0   3   0   0  10  28   2  11   8   0   0   0   0   1   8   1  23   207    1    0   2.019     67  0.28
  148  144 L  50   7  15   0   0   5   0   0  22   0   0   0   0   0   0   0   0   0   0   0   206    0    0   1.331     44  0.40
  149  145 L   2   0   0   0   0   0   0   0   0   0   4  46   0   0   2  17   5   4  15   3   207    0    0   1.653     55  0.32
  150  146 L  89   9   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   0.420     14  0.89
  151  147 L  10   0   0   0   0   0   0   1  36   0   5   5   0   0   0  29   4   5   1   2   207    0    0   1.788     59  0.24
  152  148 L   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   207    0    0   0.061      2  0.98
  153  149 L   1   7   0   2   0   0   0   0   0   0   0   2   0   0   1  78   7   0   0   0   207    0    0   0.888     29  0.60
  154  150 L  34   0  10   0   0   0   0   0  41   0   2   0   0   0   1   4   0   5   0   0   207    0    0   1.513     50  0.32
  155  151 L   0   0   0   0   0   0   0   6   0   0   1   0   0   0   0   0   0   1   7  84   207    0    0   0.655     21  0.81
  156  152 L   0   0   0   4   0   0   0  73   0   0  11   0   0   0   0   1   0   0   5   6   207    1    0   1.002     33  0.65
  157  153 L  16   0   0   0   0   0   0   1   4   1  50   7   0   0   0  11   1   0   6   0   206    0    0   1.597     53  0.32
  158  154 L   8   6   1   0   0   0   0   0   7  28  10  17   0   0   0   0   0  17   0   4   206    0    0   1.989     66  0.22
  159  155 L  45   1  10   0   0   0   0   1   1   0   3   1   0   0  12   6  18   0   0   0   207    0    0   1.669     55  0.23
  160  156 L   2   0   1   0   0   0   0   0   0   0  25  29   0   0   6  16   9   0   8   1   207    0    0   1.854     61  0.26
  161  157 L   0   0   0   0   0   0   0   9  22   1  10   6   0   0   5   1  14   1   9  21   207    0    0   2.077     69  0.30
  162  158 L   1   0   0   0   0   0   0  70   0   0  11   0   0   0   0   0   0   2  15   0   207  142   18   0.958     31  0.65
  163  159 L  32   0  25   0  12   2   0   2   3   0  20   0   0   0   0   0   0   0   0   5    65    6    2   1.667     55  0.26
  164  160 L  64  12   6   1   0   0   0   0   0   0   1   0   0   0   0   0  16   1   0   0   192    0    0   1.128     37  0.50
  165  161 L   4   0   0   0   0   0   0   1   0   0   6   2   0   0   0   6   9  53  12   8   196    0    0   1.562     52  0.46
  166  162 L   0   1   0   0   0   0   0   0   0   0  35  59   0   2   0   0   0   0   1   0   204    0    0   0.914     30  0.49
  167  163 L   8   0   5   0   2   9   0   0   0   0  24  50   0   0   1   0   0   0   0   0   204    0    0   1.456     48  0.27
  168  164 L   0   3   0   0   0   0   0  11   1   1   3  44   0   0   5  24   4   0   0   1   204    0    0   1.704     56  0.31
  169  165 L   0   8   0   0   0   0   1   0  14  42   4   0   0   0   0   0   0  15   0  12   204    0    0   1.751     58  0.24
  170  166 L  11   1   0   1   0   0   0   1   1   0  52   0   0   0   0   0  28   2   0   0   206    0    0   1.326     44  0.24
  171  167 L   1   4   0   0   0   0   0   0   0   0   2   4   0   0   2  55   5   0   1  24   206    0    0   1.374     45  0.37
  172  168 L   0   1   0   0   0   0   0   6   0   0  25   0   0   0   2   0  61   3   0   1   206    0    0   1.133     37  0.39
  173  169 L   0   0   0   0   0   0   0   0   1   3  61   1   0   0   1  27   2   1   1   0   206    0    0   1.152     38  0.45
  174  170 L   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   4   0   1  46  47   206    0    0   0.961     32  0.63
  175  171 L   0   0   0   0   0   0   0   6   0   0  30   0   0   4   0   1   4   0  52   1   206    0    0   1.254     41  0.46
  176  172 L   0   9   0   0   0   0   0   1   0   0   5  33   0   1   3  46   2   0   0   0   206    2    4   1.402     46  0.28
  177  173 L   0   0   0   0   3   0  96   0   0   0   0   0   0   0   0   0   0   0   0   0   204    0    0   0.180      6  0.98
  178  174 L   5   0   0  11   0   0   0   0  37   0  40   1   0   2   0   0   2   0   0   0   205    0    0   1.413     47  0.31
  179  175 L   5  17   4  10   0   5   0   0  49   0   0   0   1   0   0   0   1   7   0   0   206    0    0   1.631     54  0.20
  180  176 L   0   0   0   0   0   0   0   0   0   0  98   1   0   0   0   0   0   0   0   0   206    0    0   0.107      3  0.96
  181  177 L   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   206    0    0   0.031      1  0.99
  182  178 L   1   0   3   1   2   0  57   0   0   0   2  32   0   0   0   0   0   0   0   0   206    0    0   1.102     36  0.28
  183  179 L   0  99   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.055      1  1.00
  184  180 L   0   0   0   0   0   0   0   0   3   0  53  37   0   0   2   1   0   0   1   0   206    0    0   1.083     36  0.46
  185  181 L   3  87   3   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   206    0    0   0.560     18  0.90
  186  182 L   0   0   0   0   0   0   0   0   0  13  24  57   0   0   0   1   4   0   0   0   205    1    0   1.164     38  0.45
  187  183 L   1   0   0   0   0   0   0   0  25  25  26   2   0   0   2  16   0   1   0   0   204    0    0   1.699     56  0.32
  188  184 L   0   1   0   0   0   0   0   0   7   0  20   8   0   0   1   0  12  17   2  31   205    0    0   1.840     61  0.37
  189  185 L   4   0   0   0   0   0   0   0   2   0   0   0   0   0   0   8  39  27   0  20   205    0    0   1.450     48  0.51
  190  186 L   0   0   0   0   0  74  26   0   0   0   0   0   0   0   0   0   0   0   0   0   205    0    0   0.577     19  0.88
  191  187 L   0   9   0   1   0   0   0   0   4   0   2   1   0   0   3  43  10  19   6   2   205    0    0   1.794     59  0.28
  192  188 L   0   0   0   4   0   0   0   0   0   0  60   0   0   0  18  16   0   1   0   0   205    0    0   1.183     39  0.42
  193  189 L   2   0   0   0   0   0   2   1   8   0   2   0   0  64   6   6   0   0   0   8   203    0    0   1.366     45  0.44
  194  190 L   0   0   0   0   0   0   0   7   4   0  16   0   0   0  11  19   2  11  20   8   203    0    0   2.082     69  0.29
  195  191 L  14   5   1   0   0   0   0   0   5   0  52   9   0   0   6   2   3   0   1   0   203    0    0   1.632     54  0.28
  196  192 L   6   0   0   0   9   0  85   0   0   0   0   0   0   0   0   0   0   0   0   0   203    0    0   0.531     17  0.85
  197  193 L   0   0   0   0   0   0   0   0  12   0  61  24   0   0   0   0   0   1   0   0   203    0    0   1.017     33  0.52
  198  194 L   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   203    0    0   0.000      0  1.00
  199  195 L   4   3   0   0   0   0   0   0   0   0   0   0   0   8   3  12  31  37   0   0   203    0    0   1.600     53  0.39
  200  196 L  85   0   1   0   0   0   0   0  13   0   0   0   0   0   0   0   0   0   0   0   203    0    0   0.467     15  0.77
  201  197 L   1   0   0   0   0   0   0   0   0   0  13  81   0   0   0   2   1   0   0   0   203    0    0   0.714     23  0.68
  202  198 L   0   6   0   0   0   0   0   0   0   0   0   0   0  92   1   0   1   0   0   0   203    0    0   0.347     11  0.80
  203  199 L   0   0   0   0   0   0   0   5   1   0   2   0   0   0   0  17  20  45   1   7   202    0    0   1.553     51  0.45
  204  200 L   1   0   0   0   0   0   0  64   0   0  20  13   0   0   0   0   0   0   1   0   202    0    0   0.979     32  0.59
  205  201 L   0  23   0   0   0   0   0   2   0   0  48   2   0   4   0   9   9   0   3   0   180    0    0   1.518     50  0.17
  206  202 L   0   0   0   1   0   0   0   0   3   3  12  79   0   0   0   0   1   0   1   2   180    0    0   0.787     26  0.68
  207  203 L   0   0   0   0   0   0   0  10   8   6  65   6   0   0   0   1   4   0   0   0    83    0    0   1.225     40  0.52
  208  204 L   0   1   0   0   0   0   0   0   3  81   0  10   0   0   0   0   0   4   0   0    67    0    0   0.717     23  0.67
  209  205 L  21  46  31   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    67    0    0   1.110     37  0.70
  210  206 L  49   2   3   0   0   0   0   0   0   0   2  44   0   0   0   0   0   0   0   0    63    0    0   0.950     31  0.46
  211  207 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  86  13   0   0   2    63    0    0   0.460     15  0.74
  212  208 L   0   0   0   0   0   0   0   0   0   0  86  14   0   0   0   0   0   0   0   0    63    0    0   0.410     13  0.72
  213  209 L   0   0  14   0  86   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.410     13  0.81
  214  210 L   0   0   0   0   0   0   0   0   0   0  11   0   0   0  29   0   6   2  52   0    63    0    0   1.182     39  0.37
  215  211 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0  74  26   0   0   0   0    54    0    0   0.572     19  0.80
  216          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  217    1 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  38  53   0   9   192    0    0   0.948     31  0.69
  218    2 H  72   1   7   0   0   0   0   0   2   0   0   0   0   0   0   0   1  18   0   1   194    0    0   0.900     30  0.60
  219    3 H   1   2   1   0   0   0   0   0   0   0   1   6   0   3   2  21  62   1   2   0   197    0    0   1.227     40  0.51
  220    4 H   4  95   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   217    0    0   0.216      7  0.96
  221    5 H  50   4   0   0   0   0   0   0   2   0   3  11   0   1   0   5  18   3   0   2   217    0    0   1.673     55  0.26
  222    6 H   0   1   0   0   0   0   0   0   0   0   2   0   0   0   0   0  34  61   0   0   218    0    0   0.836     27  0.66
  223    7 H   0   0   0   0   0   0   0   0   0   5  91   2   0   0   0   1   0   0   0   0   218    0    0   0.395     13  0.87
  224    8 H   1   0   0   0   0   0   0  84   2   0   0   0   0   0   0   0   0  11   0   1   218    0    0   0.596     19  0.79
  225    9 H   0   0   0   0   0   0   0  50  17  23   8   1   0   0   0   0   0   0   0   0   218    0    0   1.298     43  0.51
  226   10 H  11   0   0   0   0   0   0  52   2   0   1   0   0   0   0   0   0  26   0   7   218    0    0   1.290     43  0.49
  227   11 H  24  67   6   1   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   218    0    0   0.902     30  0.74
  228   12 H  67   3   4   0   0   0   0   0   4   0   0   0   0   0   2  20   0   0   0   0   218    0    0   1.069     35  0.46
  229   13 H   0   1   0   0   0   0   0   0   1   1   0   0   0   0  16  37  40   1   1   0   218    0    0   1.333     44  0.49
  230   14 H   1   1   0   0   0   0   0   0   0  95   1   1   0   0   0   0   0   0   0   0   218    0    0   0.278      9  0.91
  231   15 H   0   0   0   0   0   0   0  84   0   0  12   0   0   0   1   0   0   2   0   0   218    0    0   0.591     19  0.80
  232   16 H   1   0   0   0   0   0   0  41  17   0   2   3   0   0   4   1   6  18   0   4   218    1    0   1.778     59  0.41
  233   17 H   0   0   0   0   0   0   0   0   0   0  88  10   0   0   0   0   0   0   0   0   217    0    0   0.472     15  0.80
  234   18 H  26  59   1   2   0   0   0   0   0   0   0   0   0  10   1   0   0   0   0   0   217    0    0   1.095     36  0.56
  235   19 H   0   1   0   0   0   0   0   0   0   0  12   6   0   0  45  33   0   0   0   0   218    0    0   1.288     42  0.48
  236   20 H   6  83   8   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   218    0    0   0.656     21  0.87
  237   21 H   0   0   0   0   0   0   0   0   2   0  78  17   0   0   0   0   0   1   0   0   218    0    0   0.742     24  0.67
  238   22 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   219    2    0   0.029      0  0.99
  239   23 H  18   0   1   0   0   0   0   0  23   0   8  20   0   0   1  26   0   2   0   0   217    0    0   1.756     58  0.24
  240   24 H  14   0   1   0   2   0   0  21  53   1   0   6   1   0   0   0   0   0   0   0   217    0    0   1.346     44  0.48
  241   25 H   0   0   0   0   0   0   0   0   0   1  94   3   0   0   0   0   0   0   0   0   218    1    0   0.294      9  0.91
  242   26 H   0   0   0   0   0   0   0  97   1   0   0   0   0   0   0   0   0   0   0   1   218   19    4   0.154      5  0.96
  243   27 H   0   3   3   0  66   0  23   3   0   0   1   0   0   1   0   0   0   0   1   1   199    0    0   1.067     35  0.77
  244   28 H   0   0   1   1   0   0   0   1   1   1  17  66   0   0   3   1   0   0   1   5   200  161    0   1.257     41  0.54
  245   29 H   7  13   7   0  55   0  11   0   0   0   0   0   0   0   0   0   0   0   0   7    56    0    0   1.392     46  0.55
  246   30 H   0   0  11   0   0   0   0   7   0   0  48  26   0   0   0   0   0   0   7   2    61    0    0   1.378     45  0.40
  247   31 H   2   4   4   1  68   0   0   1   0   0  11   4   0   0   1   0   0   0   1   2   218   16    0   1.284     42  0.46
  248   32 H   0   0   1   0   1   0   2   3   0   0  54  20   0   0   4   4   0   1   8   1   204    0    0   1.526     50  0.41
  249   33 H   0   1   3   0   0   0   0   7   1   0  43   4   0   0   3   2   0   1  12  22   204    0    0   1.739     58  0.38
  250   34 H   1   1   1   2   3   0  72   0   2   0   4   4   0   6   0   0   0   0   2   1   220    2    0   1.250     41  0.53
  251   35 H   1   1   0   0   3  21  22  11  17   1   5   2   1   2   0   0   0   4   4   5   218    1    0   2.261     75  0.10
  252   35 H   9   3  19  58   4   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0   218    0    0   1.308     43  0.57
  253   35 H   0   1   1   0   0   0   6   6   5   0  20   4   0  26   0   0   1   0  24   5   219    0    0   1.983     66  0.27
  254   36 H   0   0   0   0   1  97   0   0   0   0   0   0   0   0   0   0   0   0   0   0   221    0    0   0.167      5  0.98
  255   37 H  76   1  19   0   1   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   221    0    0   0.735     24  0.85
  256   38 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0  84  14   0   0   0   0   221    1    0   0.498     16  0.85
  257   39 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0  98   0   0   0   220    0    0   0.110      3  0.97
  258   40 H   2   0   0   0   3   0   0   0  59   9   9   3   0   0  10   3   0   0   0   0   220    0    0   1.502     50  0.39
  259   41 H   0   0   0   0   0   0   0   0   1  87   5   3   0   4   0   0   0   0   0   0   221    0    0   0.544     18  0.80
  260   42 H   0   0   0   0   0   0   0  90   2   0   1   0   0   0   0   1   0   6   0   0   221    0    0   0.443     14  0.88
  261   43 H   0   0   0   0   0   0   0   0   1   0   1   0   0   1   5  73  14   0   2   0   221    0    0   0.968     32  0.66
  262   44 H   0   0   0   0   0   0   0  85   3   0   5   1   0   0   5   1   0   0   0   0   221    0    3   0.665     22  0.76
  263   45 H   0  95   1   0   1   0   0   0   0   3   0   0   0   0   0   0   0   0   0   0   221    0    0   0.276      9  0.91
  264   46 H   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   5  92   0   0   221    0    0   0.349     11  0.90
  265   47 H   0   0   0   0   1  93   2   0   0   0   1   0   1   0   0   0   0   0   0   0   221    0    0   0.371     12  0.90
  266   48 H  33  26  31  10   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   221    0    0   1.327     44  0.69
  267   49 H   2   0   0   0   0   0   0  36  43   0  18   0   0   0   0   0   0   0   0   0   221    0    0   1.183     39  0.58
  268   50 H   5   3   1   2   5   7  19   6  14   0   5   7   1   4  10   1   3   3   3   1   221    0    0   2.637     88  0.07
  269   51 H   3   1  86   3   3   0   1   0   0   0   0   2   0   0   0   0   0   0   0   0   221    0    0   0.682     22  0.83
  270   52 H   0   0   2   0   1   6  13   5   2   0  24   4   1   3   7   1   0   0  21   9   221    0    0   2.258     75  0.17
  271   53 H   1   2   0   0   1   3  12   2   1  21  22  19   0   1   2   1   0   0   5   4   221   14   85   2.202     73  0.15
  272   54 H   0   0   0   0   0   0   5  19   1   1  21   2   0   0   0   1   2   2  13  31   207   21  124   1.889     63  0.37
  273   55 H   1   1   0   0   0   1   5  58   1   0  20   5   0   0   2   0   0   0   2   3   200    0    0   1.440     48  0.46
  274   56 H   1   0   1   0   0   0   6  10   3   3  33  11   0   1   3   3   1   6  10   6   217    0    0   2.249     75  0.25
  275   57 H   1   0  12   1   0   0   0   0   4   3   3  63   0   0   0   5   4   2   3   0   220    0    0   1.438     47  0.47
  276   58 H   2   0   3   0   3   4  48   1   3   0   5   2   0   5   2   6   0   5   6   4   221    0    0   2.053     68  0.21
  277   59 H   0   2   2   0   3   0  89   0   0   0   1   0   0   0   0   0   0   0   0   0   221    0    0   0.572     19  0.82
  278   60 H   2   1   0   0   0   0   0   1  45   4  18   6   0   0   1   0   0   0  21   1   221    0    0   1.566     52  0.39
  279   61 H   0   0   0   0   0   0   0   1   2  12   3   0   0   0   1   0  18  16   2  43   221    0    0   1.650     55  0.49
  280   62 H   0   0   0   0   1   0   0   1   6   1  62   4   0   0   1  16   0   0   4   1   221    0    0   1.363     45  0.48
  281   63 H  56  16   1   1  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   221    0    0   1.107     36  0.59
  282   64 H   0   0   0   0   0   0   0   0   0   0   0   2   0   0   4  77  14   2   0   0   221    0    0   0.818     27  0.71
  283   65 H   0   0   0   0   0   0   0  77   0   0  10   1   0   0   0   0   0   1   4   6   221    0    0   0.862     28  0.73
  284   66 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0  81  15   3   0   0   0   221    0    0   0.605     20  0.82
  285   67 H   6   9   4   0  62   0   0   0  16   0   1   1   0   0   0   0   0   0   0   0   221    0    0   1.228     40  0.46
  286   68 H   1   0   4   0   0   0   0   0   2   0   5  86   0   0   0   0   0   0   1   0   221    0    0   0.645     21  0.76
  287   69 H   5  16  69   4   3   0   0   0   0   2   0   1   0   0   0   0   0   0   0   0   221    0    0   1.105     36  0.70
  288   70 H   0   0   1   0   0   0   0   0   0   0  72  24   0   0   0   0   0   0   1   0   221    0    0   0.737     24  0.63
  289   71 H   9   1   1   0   0   0   0   0   8   1   3   3   0   0  59  13   0   0   0   0   221    0    0   1.455     48  0.39
  290   72 H   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   6   1  90   221    1    0   0.460     15  0.89
  291   73 H   1   0   0   0   0   0   0   1   1   0   0  20   0   0   0  13   0   0  49  12   220    0    0   1.451     48  0.42
  292   74 H   0   0   0   0   0   1   0   1  22   5  61   2   0   0   0   0   0   0   7   0   220    4    1   1.183     39  0.55
  293   75 H   0   2   1   0   0   0   0   0   2   0  20   5   0   0   6  36  16   1  11   0   217    0    0   1.842     61  0.30
  294   76 H   0   0   0   0   0   0   0   1   3   0  27   3   0   0   0   3   0   0  61   1   218    0    0   1.151     38  0.52
  295   77 H   0   4   3   5   0   0   0   0   0   0  12  50   0   0   0   7  13   2   1   0   221    0    0   1.725     57  0.29
  296   78 H  15  42   2   0   5   0   0   0  33   0   0   0   0   0   0   0   0   0   0   0   221    0    0   1.347     44  0.40
  297   79 H   0   1   0   0  13   0  73   0   0   0   5   0   0   2   0   0   1   0   3   0   221    0    0   1.016     33  0.68
  298   80 H   0  80   0  19   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   221    0    0   0.542     18  0.95
  299   81 H   0   0   0   0   0   0   0   0   0   0   1   0   0   3   3   6  71  11   0   2   221    0    0   1.135     37  0.64
  300   82 H   2  28   9  59   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   221    0    0   1.046     34  0.81
  301   82 H   0   0   0   0   0   0   0   0   1   0  22  12   0   0   5   3   0   0  49   5   221    0    0   1.514     50  0.41
  302   82 H   0   0   0   0   0   0   0   8   0   0  76   1   0   0   3   2   0   0  10   0   221    0    0   0.926     30  0.67
  303   82 H   9  86   0   3   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   221    0    0   0.566     18  0.87
  304   83 H   0   0   0   0   0   0   0   0   1   0   3  25   0   0  43  20   5   0   0   2   221    0    0   1.473     49  0.37
  305   84 H   4   0   0   0   0   0   0   0  24   8  28  31   0   0   0   0   0   0   1   1   221    0    0   1.603     53  0.38
  306   85 H   0   0   0   0   0   0   0   1   6   0   2   0   0   0   0   0   0  83   1   5   221    0    0   0.708     23  0.79
  307   86 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   1  98   221    0    0   0.123      4  0.98
  308   87 H   0   0   0   2   0   0   0   0   1   0  24  72   0   0   0   0   0   0   0   0   221    0    0   0.718     23  0.63
  309   88 H   0   0   0   0   0   0   0   3  95   0   0   1   0   0   0   0   0   0   0   0   221    0    0   0.221      7  0.94
  310   89 H  52   3   6   8   2   0   0   0   0   0   0  12   0   1  16   0   1   0   0   0   221    0    0   1.542     51  0.39
  311   90 H   0   0   0   0   0   0  99   0   0   0   0   0   1   0   0   0   0   0   0   0   221    0    0   0.080      2  0.99
  312   91 H   0   0   0   0  12   1  86   0   0   0   0   0   0   1   0   0   0   0   0   0   221    0    0   0.463     15  0.96
  313   92 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   221    0    0   0.029      0  0.98
  314   93 H   6   0   0   0   0   0   0   3  76   0   2  13   0   0   0   0   0   0   0   0   221    1    0   0.873     29  0.69
  315   94 H   0   0   1   1   0   0   0   3   0   0   5   4   0   0  72  10   0   0   1   0   220    0    0   1.110     37  0.61
  316   95 H   1   1   1   1   0   3   4  22   3   1   4   4   2   7   3   1   1   8   3  29   220    0    0   2.336     77  0.24
  317   96 H   3   6   3   1   3   0   8  15   4   7   8  17   1   2   7   1   2   3   4   5   220    0    0   2.680     89  0.10
  318   97 H   9   5   3   1   3   4  11  12   5   5   7   6   1   5   4   1   7   3   3   7   220    0    0   2.807     93  0.07
  319   98 H   6   6   2   2   5   3  14  11   6   3  10   3   3   1  10   1   2   0   3   8   221    0    0   2.712     90  0.06
  320   99 H   5   6   2   0   5   3  17  17   5   3   8   6   2   1   5   1   1   2   4   7   221    0    0   2.646     88  0.07
  321  100 H   3   5   2   2   9   5  14  14   8   3  10   4   3   2   1   1   2   1   4  10   221    0    0   2.696     89  0.08
  322  100 H   3   6   5   1  10   5  18   9   8   3   5   5   2   1   2   1   5   1   3   8   221    0    0   2.732     91  0.07
  323  100 H   4   3   2   2  11  10  14  13   5   2   7   5   4   0   1   1   2   0   4  10   221    0    0   2.646     88  0.07
  324  100 H   3   5   3   2   9  12  14  13   6   2   5   5   0   2   1   0   3   3   1  11   221   88  113   2.623     87  0.07
  325  101 H   1   2   0   0   0   0   1   1   5   5   8   1   1   2   0   2   5   3   4  62   133    0    0   1.574     52  0.50
  326  102 H   8  24   3   1   8   0  34   1   1   5   3   2   1   3   0   1   1   1   1   1   153    0    0   2.095     69  0.25
  327  103 H   0   2   0   1   0  90   0   0   0   0   1   1   0   1   3   1   1   0   0   0   177    0    0   0.515     17  0.86
  328  104 H   1   0   1   0   0   0   0  90   0   0   3   1   0   0   0   0   1   0   0   0   204   28    3   0.525     17  0.84
  329  105 H   0   0   0   0   0   0   0   1   4  21   1   0   0   1   4   4  61   1   2   1   183    0    0   1.287     42  0.51
  330  106 H   0   0   0   1   0   0   0  96   0   1   0   1   1   1   0   0   0   0   1   1   191    0    0   0.228      7  0.93
  331  107 H  18   2   3   0   0   0   0   1   5   0   3  65   0   0   1   0   0   0   1   0   202    0    0   1.204     40  0.52
  332  108 H   2  29   0  13   0   0   0   0   2   3   7  17   1   0   1   4   3  13   0   1   208    0    0   2.158     72  0.19
  333  109 H  77   9   7   0   1   0   1   0   0   0   1   1   0   0   1   0   0   0   0   0   214    0    0   0.954     31  0.75
  334  110 H  13   1   3   0   0   0   0   0   1   2   4  70   2   0   0   0   1   0   0   2   217    0    0   1.190     39  0.55
  335  111 H  87   4   4   0   0   0   1   1   1   0   1   0   0   0   0   0   0   0   0   0   218    0    0   0.639     21  0.82
  336  112 H   0   1   0   0   0   0   1   0   1   1  79  11   0   0   0   0   1   1   1   0   219    0    0   0.927     30  0.65
  337  113 H   0   1   0   0   0   0   0   1  10   1  79   2   0   0   1   0   0   0   0   1   220    0    0   0.910     30  0.69
  338  114 H   6   0   1   0   0   0   0   7  59   0   1   2   0   0   0   0   0  21   0   1   221   12   37   1.294     43  0.48
  339  115 H   1   1   0   0   1   0   2   4   0  31  35   5   0   0   0   8   1   4   1   2   209    0    0   1.892     63  0.31
  340  116 H   0   1   0   0   1   0   0   3  20  13  10  31   0   0   0  13   2   0   3   0   210    0    0   1.968     65  0.26
  341  117 H   0   0   0   0   0   0   0   3   4   0   9  39   0   1  19  20   0   0   2   0   217    0    0   1.719     57  0.29
  342  118 H   4   1   0   0   0   0   0  18  32   8  15   0   0   0   0   1   0  13   6   0   218    0   10   1.913     63  0.34
  343  119 H   3   2   0   0   1   0   0   1   0  83   1   0   0   2   3   0   4   0   0   0   218    0    0   0.812     27  0.68
  344  120 H   1   3   0   0   0   0   0   0   1   0  53  22   1   0   2  10   2   0   1   3   218    0    0   1.522     50  0.38
  345  121 H  59   7  19   0   0   0   0   1   1   0   3   0   2   0   0   0   5   2   1   0   219    0    0   1.396     46  0.55
  346  122 H   5   0   4   0  42   0  43   0   1   0   0   0   0   0   0   0   0   4   0   0   220    0    0   1.206     40  0.65
  347  123 H   1   1   0   0   0   0   0   2   0  83   1   0   0   0   0   0  10   0   0   0   220    0    0   0.714     23  0.71
  348  124 H   0  98   0   1   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   221    0    0   0.132      4  0.97
  349  125 H  10   0   6   1   0   0   0   0  40   0  13  25   0   0   2   0   2   0   0   0   221    5   79   1.652     55  0.31
  350  126 H   0   5   0   0   0   0   0   0   0  70  14   0   0   0   0   0   5   0   0   4   216    0    0   1.046     34  0.53
  351  127 H   5   1   0   0   0   0   0  14   4   4  16   0  39   0   2   0  14   0   0   1   219    0    0   1.800     60  0.25
  352  128 H   0   0   0   0   0   0   1  22  19   3  31   9  11   0   0   0   0   3   0   0   219    0    0   1.772     59  0.40
  353  129 H   4  17   0   1   0   0   0  11   5   5   6   6   0   0  22   6   0   8   2   5   220   84   45   2.336     77  0.08
  354  130 H  11  10   1   1   0   0   0   2   4   1  25   0   0   0   3   8   0   1   1  33   136    0    0   1.899     63  0.16
  355  133 H   3   2   0   0   0   0   0   5   1   0   7  45   0   0   3  14  18   0   0   4   159    0    0   1.707     56  0.26
  356  134 H   0   0   0   0   2   0   0   0   0  20  62   9   0   0   0   0   4   0   0   3   220    0    0   1.191     39  0.49
  357  135 H   0   0   0   4   0   0   0  42   2   0  19   1   0   0   1   0   0  10   7  15   221    0    0   1.668     55  0.43
  358  136 H   0   0   0   0   0   0   0  22   2  13  20   2   0   1   0   0   6   4   4  26   221    0    0   1.883     62  0.37
  359  137 H   0   2   0   5   0   0   0   0   0  21  17  20   0   3   5   1   1   1  23   0   221    0    0   2.001     66  0.21
  360  138 H  70  10   4   0   0   0   0   0  14   0   0   2   0   0   0   0   0   0   0   0   221    0    0   0.991     33  0.66
  361  139 H  11   0  17   0   0   0   0   0  34   0   2  28   0   0   3   3   0   0   0   0   221    0    0   1.626     54  0.29
  362  140 H   9  53  33   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   221    0    0   1.052     35  0.72
  363  141 H   0   0   0   0   0   0   0  75   9   0   8   6   0   0   0   0   0   0   0   0   221    0    0   0.918     30  0.70
  364  142 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   221    0    0   0.029      0  0.99
  365  143 H   0  83   0   2   1   0   0   0   2   0   0   2   0   0   0   5   5   0   0   0   221    0    0   0.764     25  0.67
  366  144 H  49   0  17   0   0   0   0   1  31   0   1   0   0   0   0   0   0   0   0   0   221    1    0   1.165     38  0.50
  367  145 H   1   1   0   0   0   0   0   0   0   0  30   3   0  17   4  33  11   0   0   0   220    0    0   1.613     53  0.26
  368  146 H   0   0   0   0   0   0   4  37   0   0  16   0   0   0   0   0   0   0   0  42   221    0    0   1.228     40  0.50
  369  147 H   0   0   0   0  30   0  64   0   0   0   4   0   0   0   0   0   0   0   0   0   221    0    0   0.877     29  0.81
  370  148 H   3  10   0   2  70   0   1   0   0   0   5   7   0   0   0   0   0   0   1   0   221    0    0   1.117     37  0.57
  371  149 H   1   1   1   0   6   0   0   0   2  83   4   0   0   0   0   0   0   0   0   0   221   10   70   0.788     26  0.62
  372  150 H   0   0   0   0   0   0   0  19   2   0   9   3   0   0   0   0   1  59   1   6   211    0    0   1.293     43  0.54
  373  151 H   0   0   0   0   0   0   0   1   0  53  24  20   0   0   0   0   0   0   0   1   219    0    0   1.164     38  0.45
  374  152 H  45  16   7  17   0   0  10   0   0   0   0   1   0   1   0   0   0   0   0   0   221    1    0   1.601     53  0.47
  375  153 H   0   0   0   0   0   5   3   0   1   0  16  45   0   1   0   0   0   0  24   3   220    0    0   1.562     52  0.29
  376  154 H  64   5   4   9  11   1   1   0   0   0   0   5   0   0   0   0   0   0   0   0   221    0    0   1.270     42  0.57
  377  156 H   0   0   0   0   0   0   0   3   4   0  23  57   0   2   0   4   4   1   3   1   221    0    0   1.407     46  0.43
  378  157 H   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   221    0    0   0.000      0  1.00
  379  162 H   5   0   8   0   0   0   1  20   0   0  10   1   0   0   0   4   0   1  48   2   221    3   43   1.619     54  0.31
  380  163 H   0   0   0   0   0   0   0   1   0   2  51   0   0   2  13  19   1   0   8   2   218    0    0   1.497     49  0.36
  381  164 H   0   0   0   0   0   0   0  54   6   0  20   3   0   0   0   2  14   0   1   0   218    0    0   1.354     45  0.45
  382  165 H   0   0   0   0   0   0   0  22  35   8  19   0   0   0   0   1   8   3   1   1   221    0    0   1.736     57  0.39
  383  166 H   2  42   6   0   0   0   3   4   6   8   2   1   0   0   0  21   1   0   4   1   221    0    0   1.866     62  0.12
  384  167 H   7   1   0   2   0   0   0  17   1   0  21  30   0   0   0   0   0   0   0  19   221    0    0   1.745     58  0.31
  385  168 H   1   2  17   0   0   0   0   0   0   0  42  16   0   0   3  12   5   0   3   0   221    2    5   1.686     56  0.22
  386  169 H   2   0   0   0   0   0   0  62   7   0   4  19   0   0   0   0   0   0   0   4   218    0    0   1.214     40  0.57
  387  171 H  48  18   3   0   3   0   0   0   0   0   1  18   0   0   7   0   0   0   0   0   219    0    0   1.472     49  0.38
  388  172 H  20   1   1   2   0   1   0   0   0   0   0   0   0  42   3   8   0  13   7   0   220    0    0   1.786     59  0.19
  389  173 H   0   1   0   0   8  12   1   1   0   0   4  46   0   0   0   0   4   0  21   0   220    0    0   1.632     54  0.18
  390  174 H   3   1   7   5  66   0   9   0   0   8   0   0   0   0   0   0   0   0   0   0   219    0    0   1.208     40  0.56
  391  175 H   1   0   0   0   0   0   0   9   2  80   2   0   0   0   2   3   0   0   0   0   219    0    0   0.834     27  0.67
  392  176 H   1   0   0   0   0   3   2   0  34  26  27   2   0   1   1   0   0   0   0   0   215    0    0   1.596     53  0.34
  393  177 H  54   5   7   0   3   0   1   0  18   0   0   0   0   1   0   3   8   0   0   0   214    0    0   1.524     50  0.36
  394  178 H   0  65   0   4   0   0   4   3   2   0   2   0   0   3   6   0   1   0   1   8   214    0    0   1.402     46  0.35
  395  179 H   4   0   0   0   0   0   1   0  26   2   4   7   0   0   3   4  47   0   1   0   214    0    4   1.620     54  0.30
  396  180 H   1   0   0   0   0   0   0  10   4  15  59   0   0   0   0   0   2   3   1   3   214    8  158   1.400     46  0.50
  397  183 H   0   0   0   0   0   0   0  76   0   0   5   0   0   0   0   1   0   0   1  17   206    0    0   0.774     25  0.74
  398  184 H   0  61   1   1   1   0   4   2   0   1   2   5   0   0  18   5   0   0   1   3   199    0    0   1.388     46  0.25
  399  185 H   0   0   0   0   4   0  95   0   0   0   0   0   0   0   0   0   0   0   0   0   205    0    0   0.226      7  0.98
  400  186 H   1   1   1   0   0   0   1   0   4   0  40  54   0   0   0   0   0   0   0   0   195    0    0   0.939     31  0.52
  401  187 H   1  49   0  24   0   0   0   2   8   0   2   9   0   0   1   3   0   1   0   0   190    0    0   1.486     49  0.43
  402  188 H   3   0   3   0   0   0   0   0   1   0  85   7   1   0   0   0   0   0   0   0   191    0    0   0.599     20  0.73
  403  189 H   0   0   0   0   0   0   0   1   0   0  99   0   0   0   0   0   0   0   0   0   191    0    0   0.033      1  0.99
  404  190 H  17   2   0  18   0   0   1   0   0   0  13   1   0   3   0   0  45   0   1   0   191    0    0   1.536     51  0.23
  405  191 H  56  37   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   190    0    0   0.877     29  0.73
  406  192 H   0   3   3   0   1   0   0   0   0   0   1  81   0   1   5   1   1   1   5   0   189    0    0   0.846     28  0.62
  407  193 H  56  36   5   1   1   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   188    0    0   0.976     32  0.70
  408  194 H   0   2   0   0   0   0   1   0   6  73   7   7   0   0   1   2   0   0   0   1   188    1    0   1.040     34  0.59
  409  195 H   0   2   1   0   0   0   0   0  54   0  37   0   1   0   2   4   0   0   0   0   187    0    0   1.040     34  0.49
  410  196 H  20   0   0   0   0   0   0   0   7   0  52  10   0   1   1   4   1   1   2   2   187    0    0   1.508     50  0.31
  411  198 H   3   1   0   0   0   0   0   2   0   1  31  13   0   0   1   0  12  24   4   9   187    1   12   1.863     62  0.28
  412  199 H   0  30   0   0   2  27   0   0   0   0   4   0  32   0   1   1   2   3   0   0   187    0    0   1.501     50 -0.03
  413  200 H   0   3   2   0   0   0   0  20   3  39  20   0   0   0   0   4   2   1   1   5   188    0    0   1.744     58  0.32
  414  202 H   1   0   1   0   0   0   0   1   9   0  31  21   0   0   1   3   0  20   5   7   188    0    0   1.824     60  0.31
  415  203 H   0   3   3   1   0   0   2  29   0   0   2   4   0   0   1  21  27   3   0   5   188    0    0   1.839     61  0.23
  416  204 H   0   0   0   0   0   0   0   2   3   1  21  28   1   0   1  15   1  27   0   0   188    4   89   1.671     55  0.30
  417  205 H  40   3   7   0   9   0  39   0   0   0   0   0   0   0   1   0   2   0   0   0   184    0    0   1.333     44  0.38
  418  206 H   9   0   8   0   0   0   4   0   0   0   1  48   0   0   2  26   1   1   1   0   183    0    0   1.496     49  0.30
  419  208 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   187    0    0   0.000      0  1.00
  420  209 H   1   1   0   0   0   0   0   0   1   0  25   1   0  11   0   5   1   3  52   0   187    0    0   1.352     45  0.40
  421  210 H  90   0   2   0   0   0   0   0   8   0   0   0   0   0   0   0   0   0   0   0   187    0    0   0.381     12  0.83
  422  211 H   4   0   0   0   0   0   2   0  14   0   4   3   0   2   0  14  25   1  27   3   187    0    0   1.942     64  0.25
  423  212 H   0   0   0   0   0   0   1   1   0   0   0   0   0  96   0   1   0   0   3   0   187    0    0   0.223      7  0.92
  424  213 H   0   5   0   0   0   0   5   3   1  34   3   3   0   1   0  19   0   0   5  21   177    0    0   1.850     61  0.16
  425  214 H   3   0   0   0   0   0   2   3  33  20  25   5   1   0   0   0   0   1   4   3   177    0    0   1.761     58  0.33
  426  215 H   1   0   0   0   0   0   0   7   0   0  34  29   0   0   0   3   1   0  26   0   176    0    0   1.439     48  0.35
  427  216 H   0   0   3   0   0   0   0   2   5  27  19  16   0   0   0   1   0   0  26   1   176    0    0   1.763     58  0.27
  428  217 H  23   0   0   0   2   0   0   0   1   3   7  54   0   0   0  10   0   0   0   0   176    0    0   1.312     43  0.34
  429  218 H   0   0   1   0   0   0   0   0   0   1   5   2   0   1   1  57  28   2   0   3   176    0    0   1.227     40  0.47
  430  219 H  83   3   1   0   0   0   0   0   0   0   0   5   0   0   0   3   5   0   0   0   125    0    0   0.703     23  0.67
  431  220 H   0   0   0   0   0   0   0   0   4   0   0   6   0   3   0   0   1  10   2  74   125    0    0   0.994     33  0.64
  432  221 H  10   7   0   0   0   0   0   0   1   0   1   0   0   0   0  80   2   0   0   0   113    0    0   0.751     25  0.53
  433  222 H   0   0   0   0   0   0   0   0   0  12   4   4   1   0  38  41   0   1   0   0   113    0    0   1.322     44  0.48
  434  223 H  59   9  28   0   0   0   0   0   0   0   0   0   0   0   0   5   0   0   0   0   109    0    0   1.028     34  0.68
  435  224 H  11   0   0   0   0   0   0  25   1   9   1   1   0   0   0   0   0  44   0   9   101    0    0   1.517     50  0.39
  436  225 H   4   2  12   0   0   0   0   0   5  47   1  22   0   0   4   1   0   1   0   0    92    0    0   1.603     53  0.33
  437  226 H   0   0   0   0   0   0   0   0   0   0   0   0   0   1  31  68   0   0   0   0    78    0    0   0.681     22  0.75
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     2    29    49     1 sLl
     2    34    55     1 nQk
     3    29    29     1 sIv
     4    29    29     1 sIv
     5    29    29     1 sLv
     6    29    29     1 sLv
     9    29    49     1 sLl
    18   271    55     1 gGg
    19   270    73     1 sGg
    20   270    73     2 nKAn
    20   271    76     1 nGy
    20   323   129     4 sGTSFa
    22   271    74     1 dGg
    22   323   127     2 yPFd
    23   271    74     1 gSg
    25   271    74     1 dGg
    26   270    73     2 nKNy
    26   271    76     1 yNy
    26   323   129     1 yFd
    27   271    74     1 dGs
    28   270    73     2 sKSn
    28   271    76     1 nNy
    29   271    74     1 gSt
    30   271    74     1 gSg
    31   270    54     2 nKGn
    31   271    57     1 nGy
    33   270    73     1 pEd
    34   271    74     1 gNg
    35   392   195     1 sSg
    36   271    74     1 pTg
    36   324   128     1 aFd
    36   396   201     1 sSg
    37   159   179     1 nSi
    38    93   115     1 nSa
    39   271    74     1 gNg
    41   270    73     1 pNn
    41   323   127     3 dHYFd
    42    29    49     1 sLv
    43   271    74     1 gSg
    44    94   116     1 sAs
    44   158   181     1 nSi
    45    93   113     1 nSa
    46   159   181     1 nSi
    47   159   181     1 nSi
    48   159   183     1 nSi
    49    29    49     1 sLl
    50    29    49     1 sLi
    50    99   120     1 aPp
    51    29    29     1 sLv
    52   270    73     1 pEd
    52   323   127     1 yFd
    53    92   113     2 yNSp
    55   270    73     1 pGd
    56   271    74     1 sGs
    56   394   198     1 sSg
    57    95   115     1 wPp
    57   159   180     1 nSi
    58    30    50     1 vSs
    58    93   114     1 vKr
    58    95   117     2 nHCv
    58   159   183     1 nSi
    59    29    49     1 sLl
    59    99   120     1 aPr
    60   270    73     1 pNn
    60   323   127     3 dQYFd
    61   271    74     1 gTg
    62    94   114     1 gTs
    63   270    73     2 lRSd
    63   271    76     1 dNy
    64   270    73     2 pYNd
    65   270    73     2 sKTd
    65   271    76     1 dGg
    65   323   129     1 gMd
    65   395   202     1 sSg
    66    29    49     1 sLv
    66    97   118     2 tEDp
    66   161   184     1 sNf
    67   159   179     1 nSi
    68    29    51     1 sLt
    68    34    57     1 lNa
    68    99   123     1 tPl
    68   115   140     1 gPv
    69   271    74     1 nSg
    69   323   127     3 yYGMd
    69   395   202     1 sSg
    70   243    27     1 dGs
    70   366   151     1 sSg
    71    30    50     1 vFs
    71    95   116     1 sPs
    72    29    49     1 sLk
    72   163   184     1 sNf
    73    29    49     1 sLl
    73    97   118     2 nPNp
    74   272    59     2 yRSk
    74   325   114     7 tVSLCDAFd
    74   397   193     1 sSg
    75   325   135     2 aYFp
    75   397   209     1 sSg
    76    30    50     1 vSs
    76    93   114     2 gSSq
    77    29    49     1 sLk
    77    97   118     2 sDDp
    77   161   184     1 sNf
    78   271    74     1 dGr
    78   323   127     6 lGLEDAFh
    78   395   205     1 sSg
    79    29    49     1 sLk
    79    97   118     2 sSAp
    79   161   184     1 sNf
    80   271    74     1 gGg
    80   393   197     1 sSg
    81   153   175     1 nSi
    82   388   195     1 sSg
    83    29    49     1 sLl
    83    99   120     1 sHw
    84   271    74     1 eGg
    84   323   127     5 hTNYALd
    84   395   204     1 sSg
    85   270    73     1 sRg
    85   271    75     1 gGs
    85   393   198     1 sSg
    86   271    74     1 gGg
    86   392   196     1 sSg
    87   271    74     1 gGg
    87   323   127     2 gLFs
    87   395   201     1 sSg
    88    29    45     1 sVs
    88    97   114     1 kRn
    88    99   117     1 hCv
    89   159   181     1 nSi
    90   271    74     1 gGg
    90   323   127     3 yWYFd
    90   395   202     1 sSg
    91   271   110     1 dSs
    91   392   232     1 sSg
    92   271    74     1 gGg
    92   394   198     1 pSg
    93   271    74     1 sGv
    93   395   199     1 pSg
    94   271    74     1 sGg
    94   323   127     3 vTSMd
    94   395   202     1 pSg
    95   271    74     1 tGv
    95   323   127     1 aMd
    95   395   200     1 pSg
    96    91   120     6 hGLPPTVn
    96    93   128     1 cCv
    96   157   193     1 sNf
    97   271    74     1 sGv
    97   323   127     6 sPAYWYFd
    97   395   205     1 sSg
    98   271    74     1 gNg
    98   323   127     2 tYFd
    98   395   201     1 sSg
    99   271    74     1 dAs
    99   392   196     1 sSg
   100   271    74     1 dGn
   100   323   127    13 iFGLIPLYFYYSAMd
   100   395   212     1 sSg
   101   271    74     1 gGg
   101   323   127     6 gWILNNFs
   101   395   205     1 sSg
   102   271    74     1 gGg
   102   323   127     8 fCHCDYYGLd
   102   395   207     1 sSg
   103   271    74     1 gGg
   103   323   127     4 tPSASp
   103   395   203     1 sSg
   104   270    73     1 fSd
   104   387   191     1 pSg
   105   270    73     2 dSVt
   105   322   127     7 dWIPVYSMn
   105   394   206     1 pSg
   106   271    74     1 sGs
   106   323   127     2 lSMd
   106   395   201     1 pSg
   107   270    73     2 tSEy
   107   271    76     1 yDg
   107   323   129     5 lGGDAMd
   107   395   206     1 pSg
   108   271    74     1 gYg
   108   390   194     1 pSg
   109   270    73     1 pEd
   109   323   127     3 ySRFd
   109   395   202     1 sSg
   110   271    74     1 sGn
   110   323   127     4 yPSFFd
   110   395   203     1 sSg
   111   271    74     1 rGn
   111   323   127    11 tSTSGPVRHNWFd
   111   395   210     1 sSg
   112   270    73     2 pRSd
   112   322   127     6 fGELDAFd
   112   394   205     1 sSg
   113   272    87     1 yNe
   113   349   165     1 sLd
   113   369   186     1 pQe
   113   377   195     1 sEs
   113   394   213     1 sGd
   113   414   234     1 kSv
   114   268    52     1 dGs
   114   320   105    10 rILDPPFHKGMd
   114   392   187     1 sSg
   115   270    73     1 sNg
   115   271    75     1 gGi
   115   323   128     8 sPKLCYWYFd
   115   395   208     1 sSg
   116   271    74     1 tGl
   116   323   127     1 gLk
   116   395   200     1 pSg
   117   271    74     1 gGg
   117   323   127     5 fLYYGVh
   117   395   204     1 pSg
   118   270    73     2 tSDy
   118   271    76     1 yDg
   118   323   129     3 tPHMd
   118   395   204     1 pSg
   119   270    73     2 rGSy
   119   271    76     1 ySg
   119   323   129    11 gAYCYDQYYYALd
   119   395   212     1 pSg
   120   270    73     1 aSd
   120   323   127     4 gYGAMd
   120   395   203     1 pSg
   121   271    74     1 sGg
   121   323   127     6 aVTGDAMd
   121   395   205     1 pSg
   122   323   126     8 wYVWTYYGIe
   122   395   206     1 pSg
   123   271    74     1 sGg
   123   323   127     6 wSNRYPMd
   123   395   205     1 pSg
   124   270    73     2 sGSy
   124   271    76     1 ySg
   124   323   129     5 lPTTDMd
   124   395   206     1 pSg
   125   271    74     1 sGg
   125   323   127     6 wSNRYPMd
   125   395   205     1 pSg
   126   272    75     1 aGr
   126   324   128     1 pMd
   126   396   201     1 pSg
   127   271    74     1 dGg
   127   323   127    12 iLSGYFRGWKTVFa
   127   395   211     1 sSg
   128   349   151     1 sLd
   128   369   172     1 pQe
   128   377   181     1 sEs
   128   394   199     1 sGd
   128   414   220     1 kSv
   129    93   118     2 ySTp
   129   109   136     1 dDa
   130   271    74     1 sGl
   130   323   127     5 sVEYAId
   130   395   204     1 pSg
   131   271    74     1 gGg
   131   393   197     1 pSg
   132   271    74     1 dGg
   132   388   192     1 pSg
   133   270    73     2 cGGw
   133   271    76     1 wSg
   133   323   129     6 gWLYHPIy
   133   395   207     1 pSg
   134   323   126     5 gYVCAVd
   134   395   203     1 pSg
   135   271    74     1 sGt
   135   323   127     8 dTCYYYFFTd
   135   395   207     1 pSg
   136   270    73     2 sVSy
   136   271    76     1 ySg
   136   323   129     5 tYYYAMn
   136   395   206     1 pSg
   137    29    50     1 sVv
   138    29    54     1 sVa
   139    93   118     2 wDPp
   140   270    73     2 rGSy
   140   271    76     1 ySg
   140   323   129     7 aSCHNNPMd
   140   395   208     1 pSg
   141   270    73     1 gGg
   141   393   197     1 pSg
   142   270    73     1 pSn
   142   323   127     6 yHKRSYFq
   142   395   205     1 sSg
   143   349   151     1 tFp
   143   369   172     1 pSg
   143   394   198     1 sGg
   143   414   219     1 eSv
   144   270    73     2 tSAd
   144   323   128     3 pFALd
   144   395   203     1 pSg
   145   270    73     1 sSg
   145   271    75     1 gNq
   145   323   128    13 sSSSRSPPRYYETMs
   145   395   213     1 pSg
   146   267    72     1 sIg
   146   319   125     1 yFd
   146   348   155     1 gSs
   146   391   199     1 qSg
   146   411   220     1 kSf
   147   271    74     1 nGg
   147   323   127     2 pDTn
   147   392   198     1 sSg
   148   271    74     1 nGg
   148   323   127     2 pDTn
   148   336   142     5 aASLAAs
   148   392   203     1 sSg
   149   346   148     1 tLp
   149   366   169     1 pSg
   149   391   195     1 sGg
   149   411   216     1 eSv
   150   270    73     1 gGg
   150   322   126     6 sSERNYId
   150   368   178     1 pSa
   150   413   224     1 qSv
   151   271    74     1 nGg
   151   323   127     3 ePGHs
   151   333   140     4 aSLAAs
   151   389   200     1 sSg
   152   324   127     1 hHs
   152   333   137     3 vASEs
   152   365   172     1 pQe
   152   388   196     1 pGg
   152   408   217     1 kSv
   153   271    74     1 dGt
   153   323   127     1 vFd
   153   369   174     1 pQe
   153   377   183     1 sEs
   153   394   201     1 sGd
   153   414   222     1 kSv
   154   271    74     1 dGd
   154   323   127     1 gFd
   154   352   157     1 gSs
   154   395   201     1 qSg
   154   415   222     1 kSf
   155    83   111     5 yGMSSLc
   155    99   132     1 pKa
   156    81   142     4 dSSSKh
   156    98   163     1 pKa
   157    75    95     3 aLTLa
   158   270    73     2 yTTd
   158   347   152     1 sLd
   158   367   173     1 pQe
   158   375   182     1 sEs
   158   392   200     1 sGd
   158   412   221     1 kSv
   159   270    73     2 sRSd
   159   322   127     2 yGFs
   159   368   175     1 pQe
   159   376   184     1 sEs
   159   393   202     1 sGd
   159   413   223     1 kSv
   160    83   111     4 dRTSLc
   160    99   131     1 pKa
   161    83   114     5 aSRQNSs
   161   101   137     1 pKa
   162   270    73     1 gTa
   162   332   136     7 vTAASLAAs
   162   388   199     1 sSg
   163    83   114     5 aSTLSLc
   163    99   135     1 pKa
   164    83   111     5 dNAQSLc
   164    99   132     1 pKa
   165    83   111     3 ePVSq
   165   100   131     1 pKa
   166    83   114     5 aSSSTFs
   166   101   137     1 pKa
   167    93   114     6 ySYPLTXv
   167   110   137     1 tVt
   167   128   156     1 nKk
   168   352   152     1 sPl
   168   378   179     3 nYQNn
   168   410   214     2 nVLe
   168   415   221     1 eYl
   169   323   126     1 nFa
   169   348   152     1 tFp
   169   368   173     1 pSg
   169   393   199     1 sGg
   169   413   220     1 eSv
   170    31    50     1 gAg
   170    94   114     4 dSSLSg
   170   110   134     1 pKa
   171   271    74     1 gGg
   171   336   140     2 aSAp
   171   347   153     1 dNv
   171   389   196     1 sDv
   171   390   198     1 vDg
   172   270    88     1 pRd
   172   323   142     4 aSYYFd
   172   348   171     1 sLd
   172   368   192     1 pQe
   172   376   201     1 sEs
   172   393   219     1 sGd
   172   413   240     1 kSv
   173   271    98     1 dGs
   173   323   151     3 dDALd
   173   369   200     1 pQe
   173   377   209     1 sEs
   173   394   227     1 sGd
   173   414   248     1 kSv
   174   270    73     1 pQn
   174   323   127     1 yFd
   174   348   153     1 sLd
   174   368   174     1 pQe
   174   376   183     1 sEs
   174   393   201     1 sGd
   174   413   222     1 kSv
   175    86   111     3 dSSSd
   175   104   132     1 pKa
   176    25    50     1 gAg
   176    88   114     5 dGSLSGs
   176   103   134     1 pKa
   177    89   114     2 eSGt
   177   107   134     1 pKs
   178    83   114     5 aSTMTCv
   178    98   134     1 pKa
   179    83   114     5 aSTYKCg
   179    98   134     1 pKa
   180    83   114     4 aSKGCv
   180    98   133     1 pKa
   181    82   111     6 dSSTAHTs
   181   100   135     1 pKa
   182    82   111     6 dSSTAHSs
   182   100   135     1 pKa
   183   325   128     2 hALd
   183   350   155     1 tFp
   183   370   176     1 pSg
   183   395   202     1 sGg
   183   415   223     1 eSv
   184   272    75     1 wNd
   184   349   153     1 tFp
   184   369   174     1 pSg
   184   394   200     1 sGg
   184   414   221     1 eSv
   185   271    74     1 dGg
   185   375   179     2 kSSs
   185   392   198     1 qSg
   186   272    75     1 wNd
   186   324   128     1 lFd
   186   370   175     1 pSg
   186   395   201     1 sGg
   186   415   222     1 tTv
   187    86   111     4 aSRDDh
   187   103   132     1 pKa
   188    86   111     5 hGSSEVi
   188   102   132     1 pKa
   189    25    50     1 gAg
   189    88   114     5 dDSLTGr
   189   103   134     1 pKa
   190    83   114     3 aGSNn
   190   100   134     1 pKa
   191    86   111     4 dTGPDh
   191   103   132     1 pKa
   192    86   114     1 sSt
   192    88   117     1 tPp
   192   104   134     1 pKa
   193    88   113     5 dDSLSVh
   193   104   134     1 pKa
   194   270    73     1 tGg
   194   346   150     1 tFp
   194   366   171     1 pSg
   194   391   197     1 sGg
   194   411   218     1 eSv
   195    88   113     5 dSSLSAg
   195   103   133     1 pKa
   196    82   113     1 sTs
   196    98   130     1 pKa
   197    83   111     5 dPVSLCd
   197    98   131     1 pKs
   198    25    50     1 gVs
   198    88   114     5 kRGDTFh
   198    90   121     1 sGp
   198   106   138     1 pKa
   199    27    57     1 kSn
   199    90   121     3 wFESl
   200    29    52     1 sVy
   200    34    58     1 yKk
   200    95   120     3 sVHWw
   200    97   125     5 nNQDVFf
   200    99   132     2 vSLw
   200   163   198     1 sSw
   200   177   213     1 gLy
   201    88   113     1 dDn
   201    90   116     1 lNs
   201   106   133     1 pKa
   202    88   113     6 dDSMSGPg
   202   104   135     1 pKa
   203    88   113     1 dDs
   203    90   116     2 lDGp
   203   106   134     1 pKa
   204    88   113     1 dDs
   204    90   116     1 lTg
   204   106   133     1 pKa
   205   270    73     1 dAs
   205   337   141     2 aSAp
   205   348   154     1 dNv
   205   390   197     1 sDv
   205   391   199     1 vDg
   206    88   113     5 dTSLTAg
   206   103   133     1 pKa
   207   271    74     1 dGs
   207   323   127     4 dDEFVd
   207   348   156     1 sLd
   207   368   177     1 pQe
   207   376   186     1 sEs
   207   393   204     1 sGd
   207   413   225     1 kSv
   208   270    73     1 sSs
   208   323   127     1 aMd
   208   348   153     1 tFp
   208   368   174     1 pSg
   208   393   200     1 sGg
   208   413   221     1 eSv
   209    85   114     3 aGSNn
   209   101   133     1 pKa
   210    22    50     1 gSh
   210    85   114     3 vGSGt
   210   101   133     1 pKa
   211    86   111     5 aGDSSSd
   211   103   133     1 pKs
   212    22    47     1 nNi
   212    85   111     3 sADLs
   212   103   132     1 pKs
   213    82   111     2 pESq
   213    99   130     1 pKs
   214    80   109     6 sTDSSGNh
   214    82   117     1 sTc
   214    98   134     1 pKa
   215    82   111     6 dSSSGNSd
   215    84   119     2 vSIt
   215   100   137     1 pKa
   216    81   110     5 aDSSGNh
   216    97   131     1 pKv
   217    78   111     1 tSs
   217    80   114     1 lKc
   217    96   131     1 pAv
   218   267    60     1 tSs
   218   320   114     6 gWVITNFd
   218   411   211     1 rSf
   219    27    56     1 kSn
   219    88   118     2 sFHy
   219    90   122     5 iNSFESl
   220    95   115     1 sSn
   221    93   113     1 qSs
   221    95   116     1 sNp
   222    82   109     3 ySSPv
   222    84   114     6 aPSQWSMc
   222    86   122     1 hCv
   222   102   139     1 pKa
   222   120   158     1 kNk
   223    80   109     4 sTDISg
   223    97   130     1 pKa
   224   271    72     1 gGg
   224   338   140     2 sNPp
   224   373   177     3 gDKNn
   224   390   197     1 sSg
   224   410   218     1 ePf
   225    14    47     1 lRt
   225    76   110     5 rDSSGSh
   225    92   131     1 pKa
   226   270    90     1 vEn
   226   366   187     1 pQe
   226   374   196     1 sEs
   226   391   214     1 sGd
   226   411   235     1 kSv
   227   346   159     1 gSs
   227   389   203     1 qSg
   228    22    50     1 gNy
   228    85   114     3 aGTYt
   228   102   134     1 pKa
   229   271    74     1 dGr
   229   323   127     8 sYYVEGHYFd
   229   348   160     1 sLd
   229   368   181     1 pQe
   229   376   190     1 sEs
   229   393   208     1 sGd
   229   413   229     1 kSv
   230    86   111     4 dNSGGq
   230   103   132     1 pKa
   231    82   110     5 sDSSGNh
   231    98   131     1 pKa
   232   271    74     1 qTg
   232   323   127     5 fGYNWFd
   232   369   178     1 pQe
   232   377   187     1 sEs
   232   394   205     1 sGd
   232   414   226     1 kSv
   233   270    73     1 sGg
   233   322   126     4 sGSYFd
   233   347   155     1 tLp
   233   367   176     1 pSg
   233   392   202     1 sGg
   233   412   223     1 eSv
   234   271    74     1 nFg
   234   323   127     4 sYYYLq
   234   369   177     1 pQe
   234   377   186     1 sEs
   234   394   204     1 sGd
   234   414   225     1 kSv
   235    60    85     2 gSId
   235    88   115     1 sSg
   235   105   133     1 pKt
   236    27    54     1 sSg
   236    88   116     1 sLh
   236    90   119     3 nINSa
   237    22    50     1 sTs
   237    85   114     2 lGSg
   237   102   133     1 pKa
   238    22    47     1 tNi
   238    85   111     2 aGDy
   238    88   116     1 vNt
   238   104   133     1 pKs
   239    22    47     1 nNi
   239    85   111     5 sADLSLf
   239   101   132     1 pKs
   240    81   109     6 sTDSSDNa
   240    96   130     1 pKs
   241    88   113     4 dSSSGa
   241   103   132     1 pKs
   242    88   113     5 tSSSTFh
   242    90   120     1 sGp
   242   105   136     1 pKa
   243   270    73     2 nKAn
   243   271    76     1 nGg
   243   323   129     8 ePRHKPPCRg
   243   327   141     1 gHq
   243   369   184     1 pQe
   244    81   109     5 sGDSSSs
   244    97   130     1 gCh
   244    99   133     1 lKa
   245    83   111     4 dGHPRk
   245    98   130     1 aGh
   245   100   133     1 lKa
   246   272    76     2 yRSk
   246   325   131     3 dNWFd
   246   354   163     1 nAp
   246   380   190     3 kFKNn
   246   412   225     2 dVMq
   246   417   232     1 eHv
   247    23    50     1 gYy
   247    84   112     3 gTAAl
   247    86   117     2 hTQs
   247   104   137     1 pKa
   248    93   113     1 qSs
   248    95   116     1 sNp
   249    95   115     1 sSn
   250    93   113     2 qSSs
   251   271    67     1 nGd
   251   323   120     2 qSFe
   251   348   147     1 sLq
   251   368   168     1 pPe
   251   393   194     1 aGg
   251   413   215     1 gTq
   252    36    61     1 sGs
   252    46    72     3 rSASe
   252    60    89     2 gSKd
   252    88   119     3 dSTNn
   252   123   157     1 kNr
   253    85   109     2 dGGa
   253   101   127     1 dVk
   254    95   115     2 hSSn
   254   129   151     1 kRa
   255    88   113     4 dSSSSt
   255   103   132     1 pKs
   256   270    73     1 pSd
   256   348   152     1 tFp
   256   368   173     1 pSg
   256   393   199     1 sGg
   256   413   220     1 eSv
   257   271    74     1 gRg
   257   348   152     1 tFp
   257   368   173     1 pSg
   257   393   199     1 sGg
   257   413   220     1 eSv
   258    86   111     1 sAe
   258    88   114     4 dSSSNa
   258   103   133     1 pKs
   259   270    73     2 nLAy
   259   346   151     1 tFp
   259   366   172     1 pSg
   259   391   198     1 sGg
   259   411   219     1 eSv
   260   271    72     1 dGg
   260   323   125     3 wNAFd
   260   376   181     3 gDKNn
   260   393   201     1 sSg
   260   413   222     1 eQf
   261   270    91     1 aYs
   261   323   145     3 nDAFh
   261   348   173     1 sLd
   261   368   194     1 pQe
   261   376   203     1 sEs
   261   393   221     1 sGd
   261   413   242     1 kSv
   262   271    74     1 nGg
   262   323   127     2 wSFd
   262   369   175     1 pQe
   262   377   184     1 sEs
   262   394   202     1 sGd
   262   409   218     1 qCl
   263   271    74     1 nSg
   263   346   150     1 tFp
   263   366   171     1 pSg
   263   391   197     1 sGg
   263   411   218     1 eSv
   264   270    73     2 nRAn
   264   271    76     1 nGy
   264   346   152     1 tFp
   264   366   173     1 pSg
   264   391   199     1 sGg
   264   411   220     1 eSv
   265   271    73     1 sGy
   265   345   148     1 tFp
   265   365   169     1 pSg
   265   390   195     1 sGg
   265   410   216     1 eSv
   266   243    60     2 gALi
   266   272    91     1 yQq
   266   340   160     2 aSAp
   266   351   173     1 gNv
   266   393   216     1 sAa
   266   394   218     1 aDg
   267    84   112     2 sFHy
   267    86   116     4 pHIQAl
   267   101   135     1 tGs
   268    84   108     4 dTDTGg
   268   101   129     1 dVk
   269    86   114     5 kRGLSTv
   269   101   134     1 pKa
   270    86   114     3 kRGDt
   270   103   134     1 pKa
   271   270    73     1 nGg
   271   322   126     2 dHHs
   271   331   137     3 vASEs
   271   363   172     1 pQe
   271   386   196     1 pGg
   271   406   217     1 kSv
   272    22    53     1 gRt
   272    85   117     1 dSt
   272    87   120     1 lGc
   272   103   137     1 pKs
   273   267    73     1 tSs
   273   334   141     3 aSTRp
   273   370   180     2 nKVn
   273   402   214     1 dWe
   273   407   220     1 aTf
   274   267    72     1 pSs
   274   333   139     3 aSTRp
   274   369   178     2 nKVn
   274   401   212     1 dWe
   274   406   218     1 aTf
   275    81   109     3 sGDSs
   275    83   114     1 sSa
   275    99   131     1 lKa
   276    33    45     1 sPg
   276    85    98     5 dSSSTGg
   276   100   118     1 pKv
   277   268    73     1 sGs
   277   348   154     1 nPd
   277   409   216     1 kSy
   278    93   113     1 qSs
   278    95   116     1 sPs
   279    88   113     1 dSs
   279    90   116     1 lSg
   279   106   133     1 pKs
   280    76   109     2 sIVg
   280    78   113     2 lGQc
   280    94   131     1 pTs
   281   354   157     1 sPl
   281   380   184     3 nYQNn
   281   412   219     2 nVLe
   281   417   226     1 eYl
   282   270    73     1 pGd
   282   347   151     1 tFp
   282   367   172     1 pSg
   282   392   198     1 sGg
   282   412   219     1 eSv
   283   325   128     1 yFd
   283   354   158     1 sPl
   283   380   185     3 nYQNn
   283   412   220     2 nVLe
   283   417   227     1 eYl
   284    84   112     1 lSy
   284   103   132     1 pKa
   285   271    72     1 dGg
   285   374   176     3 gDKNn
   285   391   196     1 sSg
   285   411   217     1 eQf
   286    86   111     2 dSGa
   286   100   127     1 tGd
   287   270    91     1 lYd
   287   365   187     1 pQe
   287   373   196     1 sEs
   287   390   214     1 sGd
   287   405   230     1 qCl
   288   270    73     2 lRSn
   288   271    76     1 nNy
   288   323   129     1 yFd
   288   348   155     1 tFp
   288   368   176     1 pSg
   288   393   202     1 sGg
   288   413   223     1 eSv
   289   271    74     1 gGs
   289   323   127     4 gYSRFd
   289   348   156     1 tLp
   289   368   177     1 pSg
   289   393   203     1 sGg
   289   413   224     1 eSv
   290   271    74     1 eTg
   290   323   127     1 aMd
   290   348   153     1 tLp
   290   368   174     1 pSg
   290   393   200     1 sGg
   290   413   221     1 eSv
   291    27    54     1 sHg
   291    90   118     5 hYINSAn
   292    28    56     1 aPg
   292    78   107     3 sADSs
   292    80   112     1 sTa
   292    96   129     1 pKv
   292   114   148     1 aTk
   293   243    50     2 gALi
   293   335   144     2 aSAp
   293   346   157     1 dNv
   293   388   200     1 sDv
   293   389   202     1 vDg
   294    85   111     3 dSDAa
   294    98   127     1 tGd
   295    68   115     2 gGGs
   295    96   145     4 hYINTl
   295   111   164     1 tGs
   296    85   117     4 tNSVPq
   296   100   136     1 tGd
   297    86   114     5 aGSSTSt
   298    86   114     3 kRGDa
   298   101   132     1 pKa
   299    84   112     1 lWy
   299    86   115     1 sNh
   299   102   132     1 pKs
   300    83   113     2 fQTc
   300    99   131     1 pKs
   301    34    46     1 sPg
   301    84    97     5 sRDSSTg
   301    99   117     1 pKv
   302    76   109     6 rADDSGCa
   302    91   130     1 pKa
   303   270    82     1 gSs
   303   322   135     6 iHDNWAFd
   303   336   155     1 dTp
   303   376   196     2 tQGs
   303   407   229     2 dQMk
   303   412   236     1 kEr
   304    84   111     3 aISHc
   304   101   131     1 pIv
   304   119   150     1 kNk
   305   271    80     1 dGs
   305   350   160     1 nSl
   305   376   187     3 kYENl
   305   382   196     1 nQd
   305   408   223     2 dIIq
   305   413   230     1 eYi
   306    93   113     5 qSSSNPg
   307    90    90     5 qSSSGSn
   308   270    66     1 pGd
   308   369   166     1 pPe
   308   394   192     1 aGg
   308   414   213     1 gTq
   309    14    65     1 gIg
   309    15    67     1 gDr
   309    19    72     1 gCr
   309    54   108     2 gSGa
   309    80   136     2 sVHw
   309    82   140     1 iSn
   309   117   176     1 kRa
   309   147   207     1 sSg
   309   148   209     1 gGq
   309   161   223     1 gLy
   310   270    73     1 pYn
   310   323   127     2 aEKd
   310   348   154     1 tFp
   310   368   175     1 pSg
   310   393   201     1 sGg
   310   413   222     1 eSv
   311   271    74     1 gRg
   311   346   150     1 tFp
   311   366   171     1 pSg
   311   391   197     1 sGg
   311   411   218     1 eSv
   312   271    73     1 dSs
   312   341   144     1 tFp
   312   361   165     1 pSg
   312   386   191     1 sGg
   312   406   212     1 eSv
   313   270    73     1 pSd
   313   323   127     2 wYFd
   313   348   154     1 tFp
   313   368   175     1 pSg
   313   393   201     1 sGg
   313   413   222     1 eSv
   314    86   111     3 dSDSk
   314   101   129     1 tGd
   315    22    50     1 gNy
   315    85   114     3 vGSGt
   315   101   133     1 pKa
   316   271    74     1 nSg
   316   323   127     4 vDYSMd
   316   348   156     1 tFp
   316   368   177     1 pSg
   316   393   203     1 sGg
   316   413   224     1 eSv
   317   271    74     1 nGg
   317   343   147     1 tFp
   317   363   168     1 pSg
   317   388   194     1 sGg
   317   408   215     1 eSv
   318    29    48     1 kVa
   318    34    54     1 gSq
   318    69    90     2 gSGa
   318    97   120     4 hYINSq
   318   160   187     1 sSs
   318   161   189     1 sWe
   318   174   203     1 gHy
   319    84   112     1 lWy
   319    86   115     1 sTh
   319   102   132     1 pKs
   320    29    56     1 sPg
   320    81   109     6 dSSTAAHg
   320    96   130     1 pKv
   321    82   113     1 iDc
   321    98   130     1 pKs
   322    22    50     1 gRy
   322    85   114     4 rSGSTc
   322   101   134     1 pKs
   323    22    50     1 gRt
   323    85   114     3 aGTSc
   323   101   133     1 pKs
   324    29    56     1 vPg
   324    81   109     1 dSs
   324    83   112     1 iSr
   324    99   129     1 pQv
   324   160   191     1 tRy
   325   268    75     1 sGs
   325   320   128     6 wHNVFKFd
   325   410   224     1 kSy
   326    28    61     1 pGn
   326    38    72     3 kHDSe
   326    52    89     2 gSTd
   326    80   119     6 dNSRNAVh
   326    82   127     1 tVv
   326    98   144     1 sSs
   326   116   163     1 kNr
   327   267    71     1 tGt
   327   332   137     1 aQp
   327   364   170     1 pAd
   327   372   179     1 kDp
   327   378   186     1 lSd
   327   409   218     1 kNy
   328   265    68     1 sGt
   328   328   132     1 aQp
   328   360   165     1 pAd
   328   368   174     1 kDp
   328   374   181     1 lSd
   328   405   213     1 kNy
   329    21    21     1 sSg
   329    82    83     3 pLNEf
   330   270    73     1 aNn
   330   323   127     1 yLd
   330   348   153     1 sLq
   330   368   174     1 pPe
   330   393   200     1 aGg
   330   413   221     1 gTq
   331   270    73     1 pSs
   331   344   148     1 tFp
   331   364   169     1 pSg
   331   389   195     1 sGg
   331   409   216     1 eSv
   332   270    73     1 pSs
   332   346   150     1 tFp
   332   366   171     1 pSg
   332   391   197     1 sGg
   332   411   218     1 eSv
   333   270    73     1 tYy
   333   346   150     1 tFp
   333   366   171     1 pSg
   333   391   197     1 sGg
   333   411   218     1 eSv
   334   271    74     1 nSg
   334   347   151     1 tFp
   334   367   172     1 pSg
   334   392   198     1 sGg
   334   412   219     1 eSv
   335    32    79     1 gCs
   335    67   115     3 gGGTa
   335    93   144     2 sVHy
   335    95   148     2 iSNs
   335   111   166     1 tGs
   336   267    71     1 tGt
   336   329   134     1 aQp
   336   361   167     1 pAd
   336   369   176     2 kDPa
   336   406   215     1 kPy
   337    85   109     2 dGGa
   337    99   125     1 tGd
   338    85   111     5 dNDSDAa
   338    98   129     1 tGd
   339    36    61     1 aGn
   339    46    72     3 ySDSs
   339    60    89     2 gSKd
   339    88   119     2 hASs
   339   102   135     1 tGd
   340   243    57     2 gASl
   340   272    88     2 hNSd
   340   375   193     3 gDKNn
   340   392   213     1 sSg
   340   412   234     1 eQf
   341   270    73     1 pYn
   341   346   150     1 tLp
   341   366   171     1 pSg
   341   391   197     1 sGg
   341   411   218     1 eSv
   342   270    73     1 pYn
   342   323   127     4 sYDRGd
   342   348   156     1 tFp
   342   368   177     1 pSg
   342   393   203     1 sGg
   342   413   224     1 eSv
   343   270    73     1 pGd
   343   345   149     1 tFp
   343   365   170     1 pSg
   343   390   196     1 sGg
   343   410   217     1 eSv
   344    22    50     1 gRt
   344    84   113     6 gQASGSGc
   344   100   135     1 pKs
   345    51    71     3 lESDg
   345    53    76     1 sYe
   345    91   115     1 vDf
   345    93   118     2 tDGc
   345   109   136     1 pAv
   346   265    68     1 sGt
   346   328   132     1 aQp
   346   360   165     1 pAd
   346   368   174     1 kDp
   346   374   181     1 lSd
   346   405   213     1 kNy
   347    84   112     1 lYy
   347    86   115     1 sGp
   347   104   134     1 pKs
   348    84   112     1 lYy
   348    86   115     4 sGXXXx
   348   101   134     1 pKs
   349   243    60     2 gALi
   349   272    91     1 yAq
   349   376   196     3 eDKSn
   349   393   216     1 aSg
   349   413   237     1 tEl
   350   270    73     1 pGd
   350   343   147     1 tFp
   350   363   168     1 pSg
   350   388   194     1 sGg
   350   408   215     1 eSv
   351   271    73     1 gSg
   351   350   153     1 sPl
   351   376   180     3 nYQNn
   351   408   215     2 nVLe
   351   413   222     1 eYl
   352    36    51     1 sGn
   352    46    62     3 ySDSn
   352    60    79     2 gSKd
   352    88   109     4 hSPSRs
   352   102   127     1 tGd
   353    32    61     1 aGn
   353    42    72     3 nSDSs
   353    56    89     2 gSKd
   353    82   117     1 iWy
   353    84   120     1 sSs
   353    99   136     1 tGd
   354   270    73     2 nKPy
   354   271    76     1 yNy
   354   342   148     1 tLp
   354   362   169     1 pSg
   354   387   195     1 sGg
   354   407   216     1 eSv
   355   270    73     1 pGd
   355   345   149     1 tLp
   355   365   170     1 pSg
   355   390   196     1 sGg
   355   410   217     1 eSv
   356   271    74     1 gSg
   356   323   127     5 gSLAWFv
   356   348   157     1 tFp
   356   368   178     1 pSg
   356   393   204     1 sGg
   356   413   225     1 eSv
   357   270    73     1 pFd
   357   345   149     1 tFp
   357   365   170     1 pSg
   357   390   196     1 sGg
   357   410   217     1 eSv
   358    86   114     4 aGSSSt
   358   100   132     1 gLs
   359    44    72     3 yNSDs
   359    46    77     1 dKh
   359    58    90     2 gSKd
   359    86   120     6 dNSLSACt
   359   100   140     1 rAq
   359   102   143     1 pKa
   360   271    55     1 gGg
   360   336   121     9 gDYSTFHHSGm
   360   347   141     1 vQs
   360   351   146     1 eLr
   360   394   190     1 gDg
   361    33    33     3 lKSDg
   361    35    38     1 sYt
   361    73    77     4 vTGSNc
   361    89    97     1 pAv
   362   269    53     1 sSs
   362   341   126     1 tQp
   362   345   131     1 vTv
   362   387   174     1 gDs
   363    22    66     1 aVh
   363    23    68     1 hSr
   363    24    70     3 rCYNg
   363    27    76     1 sTs
   363    90   140     3 nSDGt
   363   106   159     1 dSg
   364   269    53     1 gSs
   364   343   128     1 tQp
   364   347   133     1 vTk
   364   389   176     1 gAs
   365   270    54     1 tYt
   365   335   120     9 gGGGSGGGGSg
   365   346   140     1 qSp
   365   350   145     1 lSa
   366    37    62     1 pGh
   366    47    73     3 fSPSd
   366    61    90     2 gSKd
   366    87   118     1 vGt
   366    89   121     5 pVMGRRp
   366   106   143     1 pKf
   367   271    55     1 sGs
   367   323   108     2 hFQd
   367   337   124     9 gGVGVGGRSTg
   367   348   144     1 tQk
   367   352   149     1 eIi
   368   271    74     1 gGg
   368   337   141     8 gESAGPFKWe
   368   341   153     1 vSs
   368   371   184     3 kFKNn
   368   403   219     2 dVMq
   368   408   226     1 eHv
   369    39    72     3 yFSYl
   369    41    77     1 dKh
   369    53    90     2 gSKd
   369    81   120     5 gHSQQSp
   369    98   142     1 pKa
   370    22    49     1 aVh
   370    23    51     1 hSr
   370    24    53     3 rCYNg
   370    27    59     1 sTs
   370    90   123     3 nSDGt
   371   271    55     1 dGg
   371   331   116     7 iIGSDSYSg
   371   342   134     1 vQs
   371   346   139     1 eLk
   371   389   183     1 dTg
   372   267    71     1 sGt
   372   329   134     1 aQp
   372   361   167     1 pAd
   372   369   176     1 kDp
   372   375   183     1 lSd
   372   406   215     1 kNy
   373    48    70     1 wGs
   373    55    78     1 gFs
   373    62    86     1 sNh
   373    90   115     2 dSSv
   373   108   135     1 sLp
   374    49    79     1 gWt
   374    82   113     1 lVy
   374    84   116     1 sGa
   374   100   133     1 pKs
   375   271    74     1 dTg
   375   323   127     7 dGGSCLLFe
   375   339   150     2 pNSl
   375   346   159     1 sLq
   375   366   180     1 pPe
   375   391   206     1 aGg
   375   411   227     1 gTq
   376    48    74     1 gWt
   376    81   108     1 vVy
   376    83   111     1 sGa
   376    99   128     1 pKs
   377    22    49     1 gFv
   377    46    74     3 fKSGs
   377    48    79     1 dNy
   377    60    92     2 gSKd
   377    88   122     4 hGNSNt
   377   104   142     1 pKs
   378    22    49     1 gFv
   378    46    74     3 fKSDs
   378    48    79     1 dKd
   378    60    92     2 gSKd
   378    88   122     5 hGNSNTa
   378   103   142     1 pKs
   379   270    73     2 pNYd
   379   322   127     2 gGFa
   379   347   154     1 tLp
   379   367   175     1 lSg
   379   392   201     1 sGg
   379   412   222     1 eSv
   380   261    64     1 gTi
   380   371   175     3 gDKNn
   380   388   195     1 sSg
   380   408   216     1 eQf
   381    51    69     3 hSTSg
   381    53    74     1 sIy
   381    65    87     2 pSRd
   381    93   117     4 dSSAAt
   381   107   135     1 sSe
   382    44    72     3 sWGTg
   382    46    77     1 nQn
   382    51    83     1 sGt
   382    86   119     2 tGSa
   382   100   135     1 tGd
   383   270    74     1 pSt
   383   323   128     3 gAWFp
   383   337   145     9 vSSGGGGSGGg
   383   341   158     4 gGGGSt
   383   348   169     1 qSp
   383   352   174     1 mSm
   383   376   199     2 yQQk
   384    85   111     5 dSDSLEg
   384    87   118     1 lQw
   385    47    72     3 yFSRs
   385    54    82     1 sKi
   385    61    90     2 gSKd
   385    87   118     3 vGAQa
   385   104   138     1 pKs
   386   270    54     1 tGg
   386   334   119     8 gPGVEGEVPg
   386   345   138     1 qEs
   386   349   143     1 gLv
   386   367   162     1 vTs
   387   270    54     1 sGs
   387   271    56     1 sGr
   387   329   115     8 tGEGEKGGRe
   387   340   134     1 vEs
   387   344   139     1 gLv
   388    40    50     1 pGe
   388    50    61     3 dHGNs
   388    52    66     1 aPv
   388    57    72     1 gFs
   388    64    80     1 sKs
   388    92   109     2 dDSa
   388   109   128     1 sLr
   389    40    55     1 pGe
   389    50    66     3 yHTHs
   389    52    71     1 sPd
   389    57    77     1 gFs
   389    64    85     1 sKs
   389    92   114     4 dDSASt
   389   108   134     1 sLr
   390   268    55     1 sGs
   390   331   119     7 aAAVGSWIc
   390   342   137     1 tQp
   390   346   142     1 vTv
   391   268    55     1 gSs
   391   320   108     1 lPs
   391   332   121     8 tSTDSIFCSs
   391   343   140     1 tQp
   391   347   145     1 vTv
   392   271    55     1 dAs
   392   323   108     4 vGYNFs
   392   327   116     1 gKq
   392   337   127     8 gDGLGSRERf
   392   348   146     1 tQs
   392   352   151     1 eAk
   394   269    53     1 gSs
   394   337   122     1 tQp
   394   341   127     1 vTk
   394   383   170     1 gAs
   395   270   179     1 pTs
   395   323   233     6 rTASGAAq
   395   333   249     5 aLSRSPl
   395   344   265     1 tRs
   395   348   270     1 aLk
   395   391   314     1 eGs
   396   261    73     1 gTl
   396   270    83     1 tGy
   396   370   184     3 eDKSn
   396   387   204     1 aSg
   396   407   225     1 kPf
   397    44    78     3 sSGTg
   397    46    83     1 nQn
   397    51    89     1 sWt
   397    86   125     2 tGSa
   397   100   141     1 tGd
   398    28    49     2 dVNi
   398    49    72     3 yFSHs
   398    56    82     1 pKv
   398    63    90     2 gFKd
   398    89   118     3 vGTQs
   398    91   123     2 lEKg
   398   107   141     1 pAs
   399    40    61     1 pGe
   399    50    72     3 hHGAn
   399    52    77     1 aLe
   399    57    83     1 gFs
   399    64    91     1 sKs
   399    92   120     4 dDSARe
   399   107   139     1 sLr
   400   271    55     1 sSs
   400   334   119     6 aRSKSQGs
   400   345   136     1 vEs
   400   349   141     1 gLv
   401   268    53     1 sSs
   401   320   106     3 gTDVq
   401   334   123     9 sSNQSSSSSSs
   401   345   143     1 tQp
   401   349   148     1 vSl
   402   268    55     1 sGs
   402   320   108     1 gVk
   402   331   120     6 aAAVGSWi
   402   342   137     1 tQp
   402   346   142     1 vTv
   403   268    55     1 dGs
   403   320   108     3 wTKKq
   403   344   135     1 tQp
   403   348   140     1 vTv
   403   390   183     1 gAs
   404   271    55     1 dGg
   404   323   108     7 fPNSRSWRe
   404   336   128     8 tLSIIRLSGq
   404   347   147     1 tQs
   404   351   152     1 qVg
   404   394   196     1 sSs
   405   256    80     2 sAKs
   405   341   167     2 sLNg
   405   358   186     1 aNk
   405   378   207     1 sLy
   406   269    54     1 pTs
   406   322   108     2 rSVl
   406   330   118     7 aNGDSGLTg
   406   341   136     1 vEs
   406   345   141     1 gVr
   407    39    61     1 pGg
   407    49    72     3 yHSHs
   407    51    77     1 sPt
   407    56    83     1 gFs
   407    63    91     1 sTh
   407    91   120     1 dGs
   407   109   139     1 sLp
   408   267    54     1 gSg
   408   319   107     8 wVRQAAGKGl
   408   330   126     7 gSATSGHTh
   408   341   144     1 tQp
   408   345   149     1 vIv
   408   387   192     1 gNs
   409   270    54     1 sAp
   409   321   106     1 tVp
   409   334   120     8 gNVLSGGGIn
   409   345   139     1 vEs
   409   349   144     1 dVk
   410   270    54     1 dGg
   410   322   107     3 tLLQk
   410   341   129     1 vEs
   410   345   134     1 dVk
   411    28    49     2 dVRi
   411    49    72     3 yFSHs
   411    51    77     1 dHs
   411    63    90     2 gSKd
   411    89   118     1 lGf
   411    91   121     1 qNs
   411   108   139     1 pKs
   412   249    33     2 lSWq
   412   299    85     1 aLd
   412   313   100     4 vFLTEp
   412   353   144     3 sDASg
   412   387   181     1 kSy
   413    44    81     3 sWGTg
   413    46    86     1 nQn
   413    51    92     1 sWt
   413    86   128     2 tGSa
   413   100   144     1 tGd
   414    47    66     1 lYf
   414    49    69     3 iHSSs
   414    51    74     1 sPn
   414    56    80     1 gFs
   414    63    88     1 sTh
   414    91   117     4 dNSVNe
   414   107   137     1 sLp
   414   133   164     2 sILp
   415   270    54     1 sGs
   415   271    56     1 sGg
   415   333   119     7 dDGSGGGGd
   415   344   137     1 vQs
   415   348   142     1 eVr
   415   391   186     1 gNg
   416   271    55     1 dGs
   416   324   109     1 gPg
   416   334   120     9 aDQNTGTQGGl
   416   345   140     1 qEs
   416   349   145     1 gLv
   416   367   164     1 iTt
   416   392   190     1 dGs
   417    40    58     1 pGe
   417    48    67     1 rFy
   417    50    70     3 hTHSs
   417    52    75     1 pDs
   417    57    81     1 gFs
   417    64    89     1 sKs
   417    92   118     4 dRSADe
   417   108   138     1 sLr
   418    39    60     1 pGg
   418    49    71     3 yHTWg
   418    51    76     1 sPt
   418    56    82     1 gFs
   418    63    90     1 sTh
   418    91   119     4 dSSVDe
   418   107   139     1 sLp
   419   268    53     1 sGs
   419   320   106     9 gEQEDPAFALs
   419   325   120     6 gSSGGWLn
   419   336   137     1 tQp
   419   340   142     1 mLv
   420   271    55     1 dGd
   420   323   108     9 gSQPEANSLAc
   420   340   134     1 vQs
   420   344   139     1 eTk
   420   387   183     1 dTg
   421   270    54     1 sAp
   421   331   116     7 nVLSGGGIn
   421   342   134     1 vEs
   421   346   139     1 dVk
   422   267    54     1 dGs
   422   327   115     8 aGNGPGSGEg
   422   338   134     1 vEs
   422   342   139     1 dVk
   423   270    73     2 hTAd
   423   343   148     1 iTs
   423   368   174     1 dGn
   424   270    54     1 tSs
   424   323   108    10 eANQKASYSTSp
   424   340   135     1 eEs
   424   344   140     1 gVr
   425   331   115     4 qGKGFp
   425   342   130     1 vEp
   425   346   135     1 dVk
   425   389   179     1 tSt
   426   261    68     1 gTi
   426   270    78     1 tGy
   426   367   176     3 gDKNn
   426   384   196     1 sSg
   426   404   217     1 eQf
//