Complet list of 1acy hssp fileClick here to see the 3D structure Complete list of 1acy.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1ACY
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-03-13
HEADER     COMPLEX(ANTIBODY/HIV-1 FRAGMENT)        10-FEB-94   1ACY
COMPND     MOL_ID: 1; MOLECULE: IGG1-KAPPA 59.1 FAB (LIGHT CHAIN); CHAIN: L; ENGI
SOURCE     MOL_ID: 1; ORGANISM_SCIENTIFIC: MUS MUSCULUS; ORGANISM_COMMON: HOUSE M
AUTHOR     J.B.GHIARA,I.A.WILSON
DBREF      1ACY H  114   226  UNP    P01869   IGH1M_MOUSE      1    100
DBREF      1ACY P  308   332  UNP    P05877   ENV_HV1MN      306    328
DBREF      1ACY L    1   211  PDB    1ACY     1ACY             1    211
SEQLENGTH   436
NCHAIN        2 chain(s) in 1ACY data set
NALIGN      465
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : Q66JS7_MOUSE2HFE    0.87  0.94    1  215   21  235  215    0    0  238  Q66JS7     Igk protein OS=Mus musculus GN=Igk PE=1 SV=1
    2 : Q52L64_MOUSE2R2H    0.81  0.91    1  215   21  237  217    2    2  240  Q52L64     ENSMUSG00000076577 protein OS=Mus musculus GN=Igkv8-30 PE=1 SV=1
    3 : A0N7J3_9MURI        0.80  0.90    1  215    1  216  216    1    1  219  A0N7J3     Mc5 VLCL (Fragment) OS=Mus sp. GN=Mc5 VLCL PE=2 SV=1
    4 : A2NHM3_MOUSE1ZEA    0.80  0.91    1  215    1  216  216    1    1  219  A2NHM3     If kappa light chain (Fragment) OS=Mus musculus GN=Igkc PE=1 SV=1
    5 : A2P1G9_MOUSE        0.80  0.90    1  215    1  216  216    1    1  219  A2P1G9     Kappa light chain (Fragment) OS=Mus musculus GN=Igkc PE=2 SV=1
    6 : Q65ZC0_MOUSE1T66    0.80  0.91    1  215    1  216  216    1    1  219  Q65ZC0     Kappa light chain C_region (Fragment) OS=Mus musculus PE=1 SV=1
    7 : A0A5E3_MOUSE1OB1    0.79  0.90    1  215   23  234  215    2    3  237  A0A5E3     LOC100046793 protein OS=Mus musculus GN=LOC100046793 PE=1 SV=1
    8 : I6L9E1_MOUSE        0.79  0.89    1  215   23  233  215    1    4  236  I6L9E1     Uncharacterized protein OS=Mus musculus PE=2 SV=1
    9 : Q58EU8_MOUSE1ND0    0.79  0.91    1  215   21  236  216    1    1  239  Q58EU8     Igk protein OS=Mus musculus GN=Igk PE=1 SV=1
   10 : Q5XFY8_MOUSE3OZ9    0.79  0.88    1  215   23  232  215    2    5  235  Q5XFY8     Uncharacterized protein OS=Mus musculus PE=1 SV=1
   11 : I6L9E2_MOUSE        0.78  0.88    1  215   23  232  215    2    5  235  I6L9E2     Uncharacterized protein OS=Mus musculus PE=2 SV=1
   12 : I6L971_MOUSE1R0A    0.77  0.89    1  215   20  230  215    2    4  233  I6L971     Uncharacterized protein (Fragment) OS=Mus musculus GN=Igkj1 PE=1 SV=1
   13 : I6L991_MOUSE1N6Q    0.77  0.89    1  215   21  231  215    1    4  234  I6L991     Uncharacterized protein OS=Mus musculus PE=1 SV=1
   14 : Q52L95_MOUSE        0.77  0.88    1  215   23  233  215    2    4  236  Q52L95     Igk protein OS=Mus musculus GN=Igk PE=2 SV=1
   15 : Q7TS98_MOUSE4KVC    0.77  0.88    1  215   23  233  215    1    4  236  Q7TS98     Anti-colorectal carcinoma light chain OS=Mus musculus PE=1 SV=1
   16 : I6L958_MOUSE1CIC    0.76  0.89    1  215   21  231  215    2    4  234  I6L958     Igk protein OS=Mus musculus GN=Igk PE=1 SV=1
   17 : I6L978_MOUSE3VRL    0.75  0.89    1  215   21  231  215    2    4  234  I6L978     Igk protein OS=Mus musculus GN=Igk PE=1 SV=1
   18 : A0N7J2_9MURI3VRL    0.69  0.83  217  437    1  216  222    3    7  219  A0N7J2     Mc5 VHCH1 (Fragment) OS=Mus sp. GN=Mc5 VHCH1 PE=1 SV=1
   19 : Q5M842_RAT  1ZAN    0.68  0.85  217  437   20  236  222    4    6  458  Q5M842     IgG-2a protein OS=Rattus norvegicus GN=IgG-2a PE=1 SV=1
   20 : U5LP42_MOUSE        0.68  0.83  217  437   20  239  222    2    3  463  U5LP42     Anti-H5N1 hemagglutinin monoclonal anitbody H5M9 heavy chain (Fragment) OS=Mus musculus PE=2 SV=1
   21 : I6L985_MOUSE1Q9O    0.67  0.80  217  437   20  245  230    4   13  469  I6L985     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   22 : Q4KM66_RAT  1ZAN    0.67  0.87    1  215   21  231  215    2    4  234  Q4KM66     LOC500183 protein OS=Rattus norvegicus GN=LOC500183 PE=1 SV=1
   23 : Q99LC4_MOUSE2VIR    0.67  0.82  217  437   20  239  222    2    3  463  Q99LC4     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   24 : Q4VBH1_RAT  2HTK    0.66  0.83  217  437   20  241  224    3    5  467  Q4VBH1     Ighg protein OS=Rattus norvegicus GN=Ighg PE=1 SV=1
   25 : B2RZB2_RAT          0.65  0.87    1  215   20  230  215    1    4  233  B2RZB2     Uncharacterized protein OS=Rattus norvegicus PE=2 SV=1
   26 : Q569B4_RAT  2J4W    0.65  0.80  217  437   20  242  225    3    6  468  Q569B4     Ighg protein OS=Rattus norvegicus GN=Ighg PE=1 SV=1
   27 : Q5BK05_RAT          0.64  0.82  217  437   20  236  222    3    6  458  Q5BK05     LOC367586 protein OS=Rattus norvegicus GN=LOC367586 PE=2 SV=1
   28 : Q5I0J0_RAT          0.64  0.82  217  437   20  239  222    2    3  465  Q5I0J0     Immunoglobulin heavy chain (Gamma polypeptide) OS=Rattus norvegicus GN=Ighg PE=2 SV=1
   29 : Q5M7V3_RAT          0.64  0.83  217  437   20  239  222    2    3  461  Q5M7V3     LOC367586 protein OS=Rattus norvegicus GN=LOC367586 PE=2 SV=1
   30 : Q66K04_MOUSE        0.64  0.78  217  437   20  241  226    3    9  471  Q66K04     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
   31 : Q91Z05_MOUSE1T66    0.64  0.81  217  436   20  236  221    3    5  473  Q91Z05     Ighg protein OS=Mus musculus GN=Ighg PE=1 SV=1
   32 : Q505N9_MOUSE1MVU    0.63  0.81  217  437   20  238  222    3    4  468  Q505N9     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   33 : Q6GMX6_HUMAN1ZA6    0.63  0.79  217  437   20  236  222    3    6  465  Q6GMX6     IGH@ protein OS=Homo sapiens GN=IGH@ PE=1 SV=1
   34 : HVM63_MOUSE 1ZAN    0.62  0.80  217  437    1  220  224    4    7  237  P84751     Ig heavy chain Mem5 (Fragment) OS=Mus musculus PE=1 SV=1
   35 : I3LAQ0_PIG          0.62  0.82    2  215   22  235  214    0    0  240  I3LAQ0     Uncharacterized protein OS=Sus scrofa GN=IGKC PE=4 SV=1
   36 : I7G9T4_MACFA        0.62  0.80  217  437   20  242  224    4    4  474  I7G9T4     Macaca fascicularis brain cDNA clone: QtrA-18020, similar to human similar to FLJ27099 protein (LOC388078), mRNA, RefSeq: XM_370835.1 OS=Macaca fascicularis PE=2 SV=1
   37 : Q5BJZ2_RAT  2OP4    0.62  0.82  217  437   20  236  222    3    6  458  Q5BJZ2     LOC367586 protein OS=Rattus norvegicus GN=LOC367586 PE=1 SV=1
   38 : Q569W9_MOUSE1RUQ    0.61  0.81  217  437   20  238  222    3    4  468  Q569W9     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   39 : Q569X1_MOUSE1MPA    0.61  0.77  217  436   20  239  222    3    4  476  Q569X1     Ighg protein OS=Mus musculus GN=Ighg PE=1 SV=1
   40 : F6Z2Q3_CALJA        0.60  0.80    1  215   21  232  216    2    5  235  F6Z2Q3     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   41 : F7A2K7_MACMU        0.60  0.78    1  215   23  234  216    2    5  237  F7A2K7     Uncharacterized protein OS=Macaca mulatta GN=IGKV1-5 PE=4 SV=1
   42 : Q6GMX0_HUMAN2D7T    0.60  0.82    1  215   23  233  215    1    4  236  Q6GMX0     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
   43 : Q6PJA7_MOUSE1SY6    0.60  0.80  217  437   20  242  225    3    6  472  Q6PJA7     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   44 : Q8R3H6_MOUSE        0.60  0.81  217  436   20  237  221    3    4  474  Q8R3H6     Ighg protein OS=Mus musculus GN=Ighg PE=2 SV=1
   45 : Q8TCD0_HUMAN3PGF    0.60  0.81    1  215   21  236  216    1    1  239  Q8TCD0     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
   46 : Q9D8L4_MOUSE1F11    0.60  0.82  217  437   20  238  222    3    4  473  Q9D8L4     Putative uncharacterized protein OS=Mus musculus GN=Ighg2a PE=1 SV=1
   47 : E2RCC8_CANFA        0.59  0.78  217  437   20  239  223    4    5  473  E2RCC8     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
   48 : F6WEL0_CALJA        0.59  0.79    1  215   23  234  217    4    7  237  F6WEL0     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   49 : F7A2J9_MACMU        0.59  0.78    1  215   21  232  216    2    5  235  F7A2J9     Uncharacterized protein OS=Macaca mulatta GN=IGKV1-5 PE=4 SV=1
   50 : F7E8F0_CALJA        0.59  0.81    1  215   23  234  216    2    5  237  F7E8F0     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   51 : F7EKL6_CALJA        0.59  0.80    1  215   23  234  216    2    5  237  F7EKL6     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   52 : F7EKS1_CALJA        0.59  0.80    1  215   25  236  216    2    5  239  F7EKS1     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   53 : G1LUD1_AILME        0.59  0.80    1  215   21  236  216    1    1  239  G1LUD1     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
   54 : M3YD79_MUSPF        0.59  0.79    1  215   21  237  217    2    2  244  M3YD79     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
   55 : Q0KKI6_HUMAN        0.59  0.80    1  215    1  216  216    1    1  219  Q0KKI6     Immunoblobulin light chain (Fragment) OS=Homo sapiens PE=2 SV=1
   56 : Q58E56_MOUSE        0.59  0.81  217  437   20  242  225    3    6  477  Q58E56     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
   57 : Q5EFE6_HUMAN        0.59  0.79    2  215   22  231  216    3    8  234  Q5EFE6     Anti-RhD monoclonal T125 kappa light chain (Precursor) OS=Homo sapiens PE=2 SV=1
   58 : Q6PF95_MOUSE1XGY    0.59  0.78  217  437   20  234  222    3    8  464  Q6PF95     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   59 : Q6PIP8_MOUSE2R2H    0.59  0.77  217  437   20  234  226    4   16  464  Q6PIP8     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   60 : Q6PJB2_MOUSE1YNK    0.59  0.80  217  437   20  235  222    3    7  465  Q6PJB2     Igh protein OS=Mus musculus GN=Igh PE=1 SV=1
   61 : Q7Z3Y4_HUMAN1PG7    0.59  0.80    1  215   23  233  215    1    4  236  Q7Z3Y4     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
   62 : S6B2B6_HUMAN        0.59  0.79  217  437   20  246  227    2    6  275  S6B2B6     IgG H chain OS=Homo sapiens PE=2 SV=1
   63 : F6SRA2_CALJA        0.58  0.79    1  215   21  233  217    3    6  236  F6SRA2     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   64 : F6V7T7_CALJA        0.58  0.79    1  215   21  236  220    5    9  239  F6V7T7     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   65 : M3XG21_FELCA        0.58  0.81    1  215   21  237  217    2    2  240  M3XG21     Uncharacterized protein OS=Felis catus PE=4 SV=1
   66 : Q6PIL8_HUMAN1U6A    0.58  0.79    1  215   21  233  216    2    4  236  Q6PIL8     IGK@ protein OS=Homo sapiens GN=IGK@ PE=1 SV=1
   67 : S6BGD4_HUMAN        0.58  0.77  217  429   20  234  217    3    6  234  S6BGD4     IgG H chain OS=Homo sapiens PE=2 SV=1
   68 : F1MH40_BOVIN        0.57  0.77    1  215   21  237  219    4    6  240  F1MH40     Uncharacterized protein OS=Bos taurus PE=4 SV=2
   69 : F6TEC6_CALJA        0.57  0.79    1  215   21  232  216    2    5  235  F6TEC6     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   70 : K7G0P2_PELSI        0.57  0.74    1  204   23  230  208    4    4  244  K7G0P2     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
   71 : Q6MZX7_HUMAN        0.57  0.79  217  437   27  250  224    2    3  476  Q6MZX7     Putative uncharacterized protein DKFZp686M24218 OS=Homo sapiens GN=DKFZp686M24218 PE=1 SV=1
   72 : Q6P5S8_HUMAN2NY0    0.57  0.78    1  215   21  233  217    3    6  236  Q6P5S8     IGK@ protein OS=Homo sapiens GN=IGK@ PE=1 SV=1
   73 : A8K008_HUMAN3CFJ    0.56  0.77  217  437   20  243  226    5    7  472  A8K008     cDNA FLJ78387 OS=Homo sapiens PE=2 SV=1
   74 : F1MZ96_BOVIN        0.56  0.79    1  215   21  237  217    2    2  240  F1MZ96     Uncharacterized protein OS=Bos taurus PE=4 SV=2
   75 : F1PNY2_CANFA        0.56  0.79    1  215   21  235  218    4    6  238  F1PNY2     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
   76 : F7F0D6_MACMU        0.56  0.75  217  437    4  234  234    4   16  466  F7F0D6     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=IGHM PE=4 SV=1
   77 : Q6N089_HUMAN1U6A    0.56  0.77  217  437   20  243  226    4    7  472  Q6N089     Putative uncharacterized protein DKFZp686P15220 OS=Homo sapiens GN=DKFZp686P15220 PE=1 SV=1
   78 : Q6PJF2_HUMAN1QLR    0.56  0.78    1  215   21  232  218    4    9  235  Q6PJF2     IGK@ protein OS=Homo sapiens GN=IGK@ PE=1 SV=1
   79 : S6B291_HUMAN        0.56  0.76  217  437   20  237  223    4    7  466  S6B291     IgG H chain OS=Homo sapiens PE=2 SV=1
   80 : G1RH32_NOMLE        0.55  0.77  217  437   56  273  223    4    7  287  G1RH32     Uncharacterized protein OS=Nomascus leucogenys PE=4 SV=2
   81 : G1THZ6_RABIT        0.55  0.76  222  436   24  232  216    4    8  480  G1THZ6     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=2
   82 : Q05B55_BOVIN        0.55  0.78    1  215   21  237  219    4    6  240  Q05B55     IGK protein OS=Bos taurus GN=IGK PE=2 SV=1
   83 : S6AWD9_HUMAN        0.55  0.76  217  437   20  237  223    4    7  311  S6AWD9     IgG H chain OS=Homo sapiens PE=2 SV=1
   84 : S6AWF0_HUMAN        0.55  0.75  217  429   20  239  222    4   11  239  S6AWF0     IgG H chain OS=Homo sapiens PE=2 SV=1
   85 : B0JYP6_BOVIN        0.54  0.77    1  215   21  237  219    4    6  240  B0JYP6     IGK protein OS=Bos taurus GN=IGK PE=2 SV=1
   86 : F6RL43_MACMU        0.54  0.76  217  437   20  237  223    4    7  469  F6RL43     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
   87 : F7ATB8_CALJA        0.54  0.76    1  215   23  228  216    3   11  231  F7ATB8     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
   88 : F7D7L3_MACMU        0.54  0.77  217  437   20  243  226    4    7  475  F7D7L3     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
   89 : G3SC88_GORGO        0.54  0.76    1  215   21  237  217    2    2  240  G3SC88     Uncharacterized protein OS=Gorilla gorilla gorilla PE=4 SV=1
   90 : L8B0W5_PIG          0.54  0.72  217  437   20  243  226    4    7  470  L8B0W5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
   91 : Q5EFE5_HUMAN        0.54  0.74  217  437   20  246  233    5   18  475  Q5EFE5     Anti-RhD monoclonal T125 gamma1 heavy chain (Precursor) OS=Homo sapiens PE=2 SV=1
   92 : Q68CN4_HUMAN3EYF    0.54  0.75  217  437   20  245  228    4    9  470  Q68CN4     Putative uncharacterized protein DKFZp686E23209 OS=Homo sapiens GN=DKFZp686E23209 PE=1 SV=2
   93 : Q6MZU6_HUMAN        0.54  0.75  217  437   20  239  227    5   13  464  Q6MZU6     Putative uncharacterized protein DKFZp686C15213 OS=Homo sapiens GN=DKFZp686C15213 PE=1 SV=1
   94 : Q6N030_HUMAN2NY1    0.54  0.74  217  437   20  242  225    4    6  518  Q6N030     Putative uncharacterized protein DKFZp686I15212 OS=Homo sapiens GN=DKFZp686I15212 PE=1 SV=1
   95 : Q6N096_HUMAN        0.54  0.74  217  437   20  237  223    4    7  466  Q6N096     Putative uncharacterized protein DKFZp686I15196 OS=Homo sapiens GN=DKFZp686I15196 PE=2 SV=1
   96 : S6BAP0_HUMAN        0.54  0.73  217  429   20  229  215    4    7  229  S6BAP0     IgG H chain OS=Homo sapiens PE=2 SV=1
   97 : S6C4R2_HUMAN        0.54  0.74  217  437   20  242  225    4    6  275  S6C4R2     IgG H chain OS=Homo sapiens PE=2 SV=1
   98 : F6RL33_MACMU        0.53  0.76  217  437   20  238  223    4    6  470  F6RL33     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
   99 : F6RL61_MACMU        0.53  0.76  217  437   20  242  225    4    6  474  F6RL61     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
  100 : F6SFX9_MONDO        0.53  0.79    1  215   17  234  218    3    3  237  F6SFX9     Uncharacterized protein (Fragment) OS=Monodelphis domestica PE=4 SV=1
  101 : F6ZEZ0_CALJA        0.53  0.75    1  170   23  189  171    2    5  190  F6ZEZ0     Uncharacterized protein OS=Callithrix jacchus GN=LOC100896501 PE=4 SV=1
  102 : F7E0L9_MACMU        0.53  0.74  217  437   20  246  229    4   10  547  F7E0L9     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
  103 : L8AXL3_PIG          0.53  0.73  217  437   20  239  223    4    5  466  L8AXL3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  104 : L8B0R9_PIG          0.53  0.72  217  431   20  226  217    5   12  455  L8B0R9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  105 : L8B0U1_PIG          0.53  0.73  217  437   20  240  223    3    4  467  L8B0U1     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  106 : L8HT76_9CETA        0.53  0.74    3  215   30  246  221    4   12  249  L8HT76     Ig kappa chain C region OS=Bos mutus GN=M91_09392 PE=4 SV=1
  107 : Q5EBM2_HUMAN2I5Y    0.53  0.74  217  437   20  243  226    4    7  519  Q5EBM2     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
  108 : Q6MZQ6_HUMAN4LLQ    0.53  0.75  217  437   20  246  229    4   10  475  Q6MZQ6     Putative uncharacterized protein DKFZp686G11190 OS=Homo sapiens GN=DKFZp686G11190 PE=1 SV=1
  109 : Q7Z351_HUMAN3PGF    0.53  0.73  217  437   20  253  236    4   17  482  Q7Z351     Putative uncharacterized protein DKFZp686N02209 OS=Homo sapiens GN=DKFZp686N02209 PE=2 SV=1
  110 : S6BAQ4_HUMAN        0.53  0.73  217  413   20  220  203    4    8  236  S6BAQ4     IgG H chain OS=Homo sapiens PE=2 SV=1
  111 : S6BGE0_HUMAN        0.53  0.75  217  437   20  240  223    3    4  300  S6BGE0     IgG H chain OS=Homo sapiens PE=2 SV=1
  112 : S6C4S0_HUMAN4NM4    0.53  0.74  217  437   20  243  226    4    7  275  S6C4S0     IgG H chain OS=Homo sapiens PE=2 SV=1
  113 : S6C4S4_HUMAN        0.53  0.74  217  429   20  239  222    4   11  239  S6C4S4     IgG H chain OS=Homo sapiens PE=2 SV=1
  114 : A4F255_HUMAN2QAD    0.52  0.73  220  437    1  228  230    4   14  234  A4F255     Immunoblobulin G1 Fab heavy chain variable region (Fragment) OS=Homo sapiens GN=VHCH1 PE=1 SV=1
  115 : F7H602_MACMU        0.52  0.74  217  437   20  248  231    4   12  480  F7H602     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
  116 : F7HL06_MACMU        0.52  0.75  217  437   20  244  227    4    8  476  F7HL06     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
  117 : F7HQW4_MACMU        0.52  0.72  217  437   20  249  232    5   13  481  F7HQW4     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
  118 : L8B0S2_PIG          0.52  0.71  217  431   20  241  225    5   13  469  L8B0S2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  119 : L8B0T2_PIG          0.52  0.72  217  435   20  242  225    4    8  471  L8B0T2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  120 : L8B0U3_PIG          0.52  0.73  217  437   20  242  225    4    6  469  L8B0U3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  121 : L8B157_PIG          0.52  0.70  217  437   20  247  230    4   11  474  L8B157     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  122 : L8B165_PIG          0.52  0.72  217  434   20  232  221    5   11  462  L8B165     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  123 : Q6MZV7_HUMAN        0.52  0.77  217  437   20  244  227    4    8  473  Q6MZV7     Putative uncharacterized protein DKFZp686C11235 OS=Homo sapiens GN=DKFZp686C11235 PE=1 SV=1
  124 : Q6N094_HUMAN        0.52  0.72  217  437   20  251  234    4   15  480  Q6N094     Putative uncharacterized protein DKFZp686O01196 OS=Homo sapiens GN=DKFZp686O01196 PE=1 SV=1
  125 : Q6N095_HUMAN2NXY    0.52  0.74  217  437   20  246  230    5   12  475  Q6N095     Putative uncharacterized protein DKFZp686K03196 OS=Homo sapiens GN=DKFZp686K03196 PE=1 SV=1
  126 : Q6N097_HUMAN        0.52  0.72  217  437   20  252  235    4   16  481  Q6N097     Putative uncharacterized protein DKFZp686H20196 OS=Homo sapiens GN=DKFZp686H20196 PE=2 SV=1
  127 : Q7Z379_HUMAN        0.52  0.73  217  423   19  227  211    6    6  478  Q7Z379     Putative uncharacterized protein DKFZp686K04218 (Fragment) OS=Homo sapiens GN=DKFZp686K04218 PE=1 SV=1
  128 : S6AWG0_HUMAN        0.52  0.71  217  413   20  220  204    5   10  236  S6AWG0     IgG H chain OS=Homo sapiens PE=2 SV=1
  129 : S6B2A6_HUMAN        0.52  0.73  217  437   20  245  229    5   11  300  S6B2A6     IgG H chain OS=Homo sapiens PE=2 SV=1
  130 : S6BAM6_HUMAN        0.52  0.72  217  437   20  245  229    5   11  319  S6BAM6     IgG H chain OS=Homo sapiens PE=2 SV=1
  131 : S6BAP4_HUMAN        0.52  0.74  217  437   20  241  224    4    5  275  S6BAP4     IgG H chain OS=Homo sapiens PE=2 SV=1
  132 : S6BGE5_HUMAN        0.52  0.75  217  437   20  241  224    4    5  316  S6BGE5     IgG H chain OS=Homo sapiens PE=2 SV=1
  133 : S6C4Q7_HUMAN        0.52  0.74  217  437   20  241  224    4    5  300  S6C4Q7     IgG H chain OS=Homo sapiens PE=2 SV=1
  134 : L8AXM9_PIG          0.51  0.71  217  437   20  245  228    4    9  472  L8AXM9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  135 : L8B0S7_PIG          0.51  0.69  217  437   20  253  236    4   17  480  L8B0S7     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  136 : L8B0V2_PIG          0.51  0.72  217  435   20  244  227    4   10  478  L8B0V2     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  137 : L8B0V6_PIG          0.51  0.72  217  435   20  245  228    3   11  474  L8B0V6     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  138 : L8B0V9_PIG          0.51  0.70  217  435   20  244  227    4   10  478  L8B0V9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  139 : L8B0W0_PIG          0.51  0.73  217  437   20  233  223    4   11  460  L8B0W0     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  140 : L8B0W9_PIG          0.51  0.70  217  436   20  246  229    4   11  470  L8B0W9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  141 : L8B173_PIG          0.51  0.72  217  437   20  242  226    5    8  469  L8B173     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  142 : L8B180_PIG          0.51  0.71  217  431   20  235  222    5   13  464  L8B180     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  143 : Q7Z374_HUMAN        0.51  0.73  217  423   32  241  211    5    5  492  Q7Z374     Putative uncharacterized protein DKFZp686C02218 (Fragment) OS=Homo sapiens GN=DKFZp686C02218 PE=1 SV=1
  144 : S6BAN1_HUMAN        0.51  0.71  217  437   20  244  228    5   10  318  S6BAN1     IgG H chain OS=Homo sapiens PE=2 SV=1
  145 : G1KAJ9_ANOCA        0.50  0.67    1  215   26  236  218    5   10  241  G1KAJ9     Uncharacterized protein OS=Anolis carolinensis PE=4 SV=2
  146 : L8AXK8_PIG          0.50  0.71  217  435   20  239  224    5    9  473  L8AXK8     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  147 : L8AXL9_PIG          0.50  0.71  217  437   20  245  228    4    9  472  L8AXL9     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  148 : L8AXM5_PIG          0.50  0.70  217  437   20  245  230    5   13  472  L8AXM5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  149 : L8B0T7_PIG          0.50  0.70  217  437   20  249  232    4   13  476  L8B0T7     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  150 : L8B0U8_PIG          0.50  0.72  217  437   20  238  223    4    6  465  L8B0U8     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  151 : L8B0X5_PIG          0.50  0.70  217  437   20  248  231    4   12  475  L8B0X5     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  152 : L8B0Y0_PIG          0.50  0.71  217  437   20  244  227    3    8  471  L8B0Y0     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  153 : L8B0Y6_PIG          0.50  0.71  217  437   20  248  231    4   12  475  L8B0Y6     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  154 : L8B130_PIG          0.50  0.70  217  435   20  244  227    4   10  478  L8B130     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  155 : L8B149_PIG          0.50  0.71  217  437   20  247  230    4   11  474  L8B149     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  156 : Q5HZC6_XENTR        0.50  0.72    1  204   22  226  205    1    1  239  Q5HZC6     LOC734128 protein (Fragment) OS=Xenopus tropicalis GN=LOC734128 PE=2 SV=1
  157 : Q5RE17_PONAB        0.50  0.72  217  437   20  246  229    4   10  475  Q5RE17     Putative uncharacterized protein DKFZp469C2335 OS=Pongo abelii GN=DKFZp469C2335 PE=2 SV=1
  158 : Q5U413_MOUSE        0.50  0.69  217  429   19  232  216    5    5  483  Q5U413     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  159 : Q6NTU5_XENLA        0.50  0.72    1  204   26  230  205    1    1  243  Q6NTU5     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  160 : S6BGF5_HUMAN        0.50  0.70  217  429   20  240  224    5   14  240  S6BGF5     IgG H chain OS=Homo sapiens PE=2 SV=1
  161 : F6TGA0_XENTR        0.49  0.69    1  204   26  226  206    3    7  239  F6TGA0     Uncharacterized protein OS=Xenopus tropicalis GN=LOC734128 PE=4 SV=1
  162 : L8B139_PIG          0.49  0.72  217  437   20  238  223    4    6  465  L8B139     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  163 : Q4V801_XENLA        0.49  0.69  220  435   22  239  220    5    6  560  Q4V801     LOC398774 protein OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
  164 : L8AXK3_PIG          0.48  0.72  217  437   20  244  227    4    8  471  L8AXK3     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  165 : A5D7Q2_BOVIN        0.47  0.69  217  429   20  237  221    5   11  487  A5D7Q2     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  166 : L8B0W4_PIG          0.47  0.66  217  437   20  254  239    5   22  481  L8B0W4     IgG heavy chain OS=Sus scrofa GN=IGHG PE=2 SV=1
  167 : Q99M22_MOUSE        0.47  0.68  217  429   19  229  216    6    8  479  Q99M22     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  168 : F6XE80_CALJA        0.46  0.68  217  437   20  239  228    8   15  467  F6XE80     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  169 : F7E1E8_CALJA        0.46  0.69  217  437   20  242  230    8   16  470  F7E1E8     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  170 : F7HBI3_CALJA        0.46  0.68  217  423   20  224  212    9   12  487  F7HBI3     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  171 : A1L3I1_XENLA        0.45  0.69  217  435   20  241  224    6    7  562  A1L3I1     LOC398774 protein OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
  172 : F6YZ67_CALJA        0.44  0.67  217  437   20  238  230    7   20  466  F6YZ67     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  173 : F7AXD1_CALJA        0.44  0.67  217  437   20  237  230    8   21  465  F7AXD1     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  174 : F7GMQ8_MACMU        0.44  0.63   11  206   29  223  202    5   13  234  F7GMQ8     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  175 : G1RZR1_NOMLE        0.44  0.64   13  206   62  254  199    5   11  265  G1RZR1     Uncharacterized protein OS=Nomascus leucogenys GN=LOC100589708 PE=4 SV=2
  176 : L5KG32_PTEAL        0.44  0.61    1  215   21  213  218    4   28  216  L5KG32     Ig kappa chain C region OS=Pteropus alecto GN=PAL_GLEAN10002463 PE=4 SV=1
  177 : Q569B8_RAT          0.44  0.69  217  436   17  241  227    7    9  590  Q569B8     Igh-6 protein OS=Rattus norvegicus GN=Rwdd4 PE=2 SV=1
  178 : Q8NCL6_HUMAN        0.44  0.68  217  423   20  229  213    8    9  493  Q8NCL6     cDNA FLJ90170 fis, clone MAMMA1000370, highly similar to Ig alpha-1 chain C region OS=Homo sapiens PE=1 SV=1
  179 : F6QQP0_MACMU        0.43  0.63   11  206   29  222  201    5   12  233  F6QQP0     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  180 : F6W0E5_MACMU        0.43  0.63   14  206   32  228  199    4    8  239  F6W0E5     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  181 : F7AY53_XENTR        0.43  0.68  217  434   25  240  225    6   16  541  F7AY53     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=ighx PE=4 SV=1
  182 : F7DKI0_MACMU        0.43  0.64   14  206   32  226  197    4    6  237  F7DKI0     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  183 : F7GMK4_MACMU        0.43  0.63   11  206   29  223  202    5   13  234  F7GMK4     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  184 : F7GMQ6_MACMU        0.43  0.63   11  206   29  222  200    5   10  233  F7GMQ6     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  185 : G7PHD1_MACFA        0.43  0.63   14  206   32  228  199    4    8  239  G7PHD1     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_02501 PE=4 SV=1
  186 : H3A3U7_LATCH        0.43  0.67    1  215   22  238  223    6   14  241  H3A3U7     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  187 : Q58E53_MOUSE        0.43  0.66  217  429   20  236  218    5    6  487  Q58E53     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  188 : Q58E54_MOUSE        0.43  0.66  217  429   20  234  216    4    4  485  Q58E54     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  189 : Q5FW04_XENTR        0.43  0.67  217  434   26  239  225    6   18  555  Q5FW04     Ighx protein (Fragment) OS=Xenopus tropicalis GN=ighx PE=2 SV=1
  190 : Q5M8X4_XENTR        0.43  0.69  217  434   20  236  222    6    9  367  Q5M8X4     Uncharacterized protein OS=Xenopus tropicalis GN=MGC108125 PE=2 SV=1
  191 : Q5U472_MOUSE        0.43  0.66  217  429   20  233  217    6    7  484  Q5U472     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  192 : Q5VLR6_RAT          0.43  0.66  217  429   20  235  217    5    5  482  Q5VLR6     BWK3 OS=Rattus norvegicus GN=LOC366772 PE=2 SV=1
  193 : Q6GMX3_HUMAN        0.43  0.64    8  206   26  225  203    6    7  236  Q6GMX3     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  194 : Q6GMX4_HUMAN4D9L    0.43  0.64    1  206   20  225  212    7   12  236  Q6GMX4     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  195 : Q6INK3_XENLA        0.43  0.67  217  434   20  236  222    6    9  584  Q6INK3     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  196 : Q6MZV6_HUMAN        0.43  0.69  217  423   20  228  213    8   10  479  Q6MZV6     Putative uncharacterized protein DKFZp686L19235 OS=Homo sapiens GN=DKFZp686L19235 PE=2 SV=1
  197 : Q6P089_HUMAN        0.43  0.69  217  423   20  229  213    8    9  480  Q6P089     IGH@ protein OS=Homo sapiens GN=IGH@ PE=1 SV=1
  198 : Q8N355_HUMAN4HK0    0.43  0.66    8  206   26  223  203    4    9  234  Q8N355     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  199 : Q91X92_MOUSE        0.43  0.66  217  429   20  231  216    6    7  482  Q91X92     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  200 : Q96E61_HUMAN        0.43  0.62    8  206   26  225  206    6   13  236  Q96E61     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  201 : S6B2B0_HUMAN        0.43  0.65    8  198   27  217  194    5    6  217  S6B2B0     IgG L chain OS=Homo sapiens PE=2 SV=1
  202 : S6BGD6_HUMAN        0.43  0.65    1  206   20  224  209    6    7  235  S6BGD6     IgG L chain OS=Homo sapiens PE=2 SV=1
  203 : A5PK72_BOVIN        0.42  0.62    8  206   26  225  202    4    5  236  A5PK72     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  204 : F7GMQ3_MACMU        0.42  0.63   14  206   32  225  199    5   11  236  F7GMQ3     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  205 : F7GMQ4_MACMU        0.42  0.63   14  206   32  225  199    5   11  236  F7GMQ4     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  206 : F7HM36_MACMU        0.42  0.63   14  206   32  224  198    5   10  235  F7HM36     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  207 : G3RQ12_GORGO        0.42  0.60   12  206   30  226  202    4   12  237  G3RQ12     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101128003 PE=4 SV=1
  208 : G3RVT8_GORGO        0.42  0.60   12  206   30  226  202    4   12  237  G3RVT8     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101128003 PE=4 SV=1
  209 : H3AB65_LATCH        0.42  0.69  218  437   17  243  229    6   11  597  H3AB65     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  210 : Q6GMV8_HUMAN        0.42  0.63    8  206   26  223  204    5   11  234  Q6GMV8     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  211 : Q6GMW3_HUMAN        0.42  0.64    8  206   26  223  205    5   13  234  Q6GMW3     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  212 : Q6IPQ0_HUMAN        0.42  0.63   12  206   30  225  199    5    7  236  Q6IPQ0     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  213 : Q6N041_HUMAN        0.42  0.69  217  429   35  253  222    8   12  498  Q6N041     Putative uncharacterized protein DKFZp686O16217 (Fragment) OS=Homo sapiens GN=DKFZp686O16217 PE=2 SV=1
  214 : Q6NS95_HUMAN        0.42  0.63    8  206   26  223  204    5   11  234  Q6NS95     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  215 : Q6P5S3_HUMAN        0.42  0.63   11  206   29  225  199    5    5  236  Q6P5S3     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  216 : Q8NEJ1_HUMAN        0.42  0.63    8  206   26  225  205    5   11  236  Q8NEJ1     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  217 : Q96K68_HUMAN        0.42  0.67  217  423   20  230  217    9   16  494  Q96K68     cDNA FLJ14473 fis, clone MAMMA1001080, highly similar to Homo sapiens SNC73 protein (SNC73) mRNA OS=Homo sapiens PE=2 SV=1
  218 : S6BAN6_HUMAN        0.42  0.65    8  198   26  216  195    6    8  216  S6BAN6     IgG L chain OS=Homo sapiens PE=2 SV=1
  219 : S6C4S2_HUMAN        0.42  0.62    8  198   26  217  197    6   11  217  S6C4S2     IgG L chain OS=Homo sapiens PE=2 SV=1
  220 : A2NUT2_HUMAN4M1D    0.41  0.64    8  206   26  224  205    5   12  235  A2NUT2     Lambda-chain (AA -20 to 215) (Precursor) OS=Homo sapiens PE=1 SV=1
  221 : C6KXN3_HUMAN4AJ0    0.41  0.61   14  206   32  221  197    5   11  232  C6KXN3     Lambda light chain of human immunoglobulin surface antigen-related protein (Fragment) OS=Homo sapiens GN=IgLC-rG PE=1 SV=1
  222 : F1MLW8_BOVIN        0.41  0.61   11  206   29  222  202    6   14  233  F1MLW8     Uncharacterized protein OS=Bos taurus PE=4 SV=2
  223 : F7I7D9_CALJA        0.41  0.64    8  206   26  229  207    6   11  240  F7I7D9     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  224 : H2L5S8_ORYLA        0.41  0.66    8  192   31  209  189    5   14  232  H2L5S8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101172990 PE=4 SV=1
  225 : I3J7W3_ORENI        0.41  0.67    1  209   24  246  223    7   14  254  I3J7W3     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  226 : Q567P1_HUMAN        0.41  0.65    8  206   26  224  202    5    6  235  Q567P1     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  227 : Q5XHD5_XENLA        0.41  0.65  217  433   18  235  223    8   11  589  Q5XHD5     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  228 : Q6DHW4_HUMAN        0.41  0.63    8  206   26  226  206    5   12  237  Q6DHW4     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  229 : Q6GMV7_HUMAN        0.41  0.63    8  206   26  225  203    5    7  236  Q6GMV7     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  230 : Q6GMW6_HUMAN        0.41  0.63    8  206   26  224  202    5    6  235  Q6GMW6     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  231 : Q6GPX4_XENLA        0.41  0.67  217  434   20  237  225    7   14  585  Q6GPX4     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  232 : Q6IN99_HUMAN        0.41  0.63    8  206   26  224  205    5   12  235  Q6IN99     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  233 : Q6N092_HUMAN        0.41  0.69  217  429   44  261  221    8   11  519  Q6N092     Putative uncharacterized protein DKFZp686K18196 (Fragment) OS=Homo sapiens GN=DKFZp686K18196 PE=1 SV=1
  234 : Q6PAF5_XENLA        0.41  0.70  217  418   30  225  204    4   10  225  Q6PAF5     LOC398774 protein (Fragment) OS=Xenopus laevis GN=LOC398774 PE=2 SV=1
  235 : Q6PDB8_MOUSE        0.41  0.64  217  429   20  234  218    7    8  485  Q6PDB8     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  236 : Q6PIK1_HUMAN1MCB    0.41  0.62   12  206   30  224  199    5    8  235  Q6PIK1     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  237 : Q6PJG0_HUMAN1JVK    0.41  0.62   11  206   29  224  201    6   10  235  Q6PJG0     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
  238 : S6BAP8_HUMAN        0.41  0.65    8  198   26  217  195    5    7  217  S6BAP8     IgG L chain OS=Homo sapiens PE=2 SV=1
  239 : A6H7J7_BOVIN        0.40  0.60    8  206   26  224  206    6   14  235  A6H7J7     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  240 : F1MCF8_BOVIN        0.40  0.61    8  206   26  223  204    7   11  234  F1MCF8     Uncharacterized protein OS=Bos taurus GN=IGLL1 PE=4 SV=2
  241 : F1PYR5_CANFA        0.40  0.65   12  206   30  221  198    5    9  232  F1PYR5     Uncharacterized protein OS=Canis familiaris PE=4 SV=2
  242 : F7GMK5_MACMU        0.40  0.61   11  206   29  225  204    6   15  236  F7GMK5     Uncharacterized protein OS=Macaca mulatta GN=LOC100430606 PE=4 SV=1
  243 : F7H6V3_CALJA        0.40  0.62   12  206   30  228  204    5   14  239  F7H6V3     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  244 : F7II77_CALJA        0.40  0.66  217  385   20  198  182    7   16  207  F7II77     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  245 : G1RZR5_NOMLE        0.40  0.58   11  206   29  222  203    6   16  233  G1RZR5     Uncharacterized protein OS=Nomascus leucogenys GN=LOC100589708 PE=4 SV=1
  246 : G3PGY2_GASAC        0.40  0.65  220  431   10  226  221    7   13  502  G3PGY2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  247 : H2L5S9_ORYLA        0.40  0.63    8  192   30  213  193    5   17  235  H2L5S9     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101172990 PE=4 SV=1
  248 : K4G9C3_CALMI        0.40  0.67    1  214   21  230  215    3    6  235  K4G9C3     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  249 : K4GER5_CALMI        0.40  0.66    1  214   21  231  216    4    7  236  K4GER5     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  250 : K7FQA1_PELSI        0.40  0.57   10  206   28  231  209    7   17  242  K7FQA1     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  251 : Q5FWF9_HUMAN2FL5    0.40  0.62   12  206   30  221  200    6   13  232  Q5FWF9     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  252 : Q6GMW4_HUMAN        0.40  0.59   16  206   34  222  198    7   16  233  Q6GMW4     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  253 : Q6MZX9_HUMAN        0.40  0.68  217  423   20  232  216    8   12  483  Q6MZX9     Putative uncharacterized protein DKFZp686M08189 OS=Homo sapiens GN=DKFZp686M08189 PE=2 SV=1
  254 : Q6PIQ7_HUMAN        0.40  0.63   11  206   29  225  201    6    9  236  Q6PIQ7     IGL@ protein OS=Homo sapiens GN=IGL@ PE=2 SV=1
  255 : Q6ZVX0_HUMAN        0.40  0.66  217  423   20  236  220    8   16  487  Q6ZVX0     cDNA FLJ41981 fis, clone SMINT2011888, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=1 SV=1
  256 : Q7Z2U7_HUMAN        0.40  0.64    8  206   26  223  204    5   11  234  Q7Z2U7     Uncharacterized protein OS=Homo sapiens PE=1 SV=1
  257 : Q8N5F4_HUMAN4HPY    0.40  0.61   11  206   29  222  202    6   14  233  Q8N5F4     IGL@ protein OS=Homo sapiens GN=IGL@ PE=1 SV=1
  258 : Q8VEA0_MOUSE        0.40  0.63  217  429   20  233  221    8   15  484  Q8VEA0     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  259 : Q91XE1_MOUSE        0.40  0.61  217  429   19  229  219    8   14  480  Q91XE1     Igh protein (Fragment) OS=Mus musculus GN=Igh PE=2 SV=1
  260 : Q91Z07_MOUSE        0.40  0.64  217  429   20  236  220    6   10  486  Q91Z07     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  261 : Q99M11_MOUSE        0.40  0.62    8  206   26  224  203    6    8  235  Q99M11     Igl protein OS=Mus musculus GN=Igl PE=2 SV=1
  262 : R4I3X3_EPICO        0.40  0.65    8  207   28  231  205    4    6  243  R4I3X3     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  263 : S6AWE6_HUMAN        0.40  0.63   11  198   29  215  191    6    7  215  S6AWE6     IgG L chain OS=Homo sapiens PE=2 SV=1
  264 : S6BAR0_HUMAN        0.40  0.62   11  198   29  216  191    5    6  216  S6BAR0     IgG L chain OS=Homo sapiens PE=2 SV=1
  265 : S6C4Q9_HUMAN        0.40  0.62   11  198   29  217  194    5   11  217  S6C4Q9     IgG L chain OS=Homo sapiens PE=2 SV=1
  266 : A0A5E4_HUMAN        0.39  0.60   11  206   29  224  200    6    8  235  A0A5E4     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  267 : A4IFI0_BOVIN        0.39  0.61    8  206   26  224  204    7   10  235  A4IFI0     IGLL1 protein OS=Bos taurus GN=IGLL1 PE=2 SV=1
  268 : A5PK49_BOVIN        0.39  0.60    8  206   26  223  206    7   15  234  A5PK49     IGL@ protein OS=Bos taurus GN=IGL@ PE=2 SV=1
  269 : A6QM09_BOVIN        0.39  0.58   11  206   29  221  203    6   17  232  A6QM09     Putative uncharacterized protein OS=Bos taurus PE=2 SV=1
  270 : F1MLW7_BOVIN        0.39  0.60    8  206   26  223  204    5   11  234  F1MLW7     Uncharacterized protein OS=Bos taurus GN=IGLL1 PE=4 SV=2
  271 : F7I7B2_CALJA        0.39  0.63    8  206   26  227  206    6   11  238  F7I7B2     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  272 : F7IMW5_CALJA        0.39  0.63  217  423   20  224  213    9   14  487  F7IMW5     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  273 : G3PGZ8_GASAC        0.39  0.65  220  431   23  235  218    9   11  587  G3PGZ8     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  274 : G3PH38_GASAC        0.39  0.66  220  431   22  233  217    8   10  596  G3PH38     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  275 : G3TRS4_LOXAF        0.39  0.59   11  206   29  224  203    7   14  235  G3TRS4     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  276 : G3U5R4_LOXAF        0.39  0.60   10  206   28  222  202    6   12  233  G3U5R4     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  277 : G3UK57_LOXAF        0.39  0.60   11  206   29  224  202    6   12  235  G3UK57     Uncharacterized protein OS=Loxodonta africana PE=4 SV=1
  278 : G7MWV9_MACMU        0.39  0.67  217  434   21  250  233    8   18  600  G7MWV9     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_18625 PE=4 SV=1
  279 : G7N3E4_MACMU        0.39  0.59   10  206   28  228  204    6   10  239  G7N3E4     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_02860 PE=4 SV=1
  280 : I3ISX9_DANRE        0.39  0.66  220  431   21  233  218    9   11  573  I3ISX9     Uncharacterized protein OS=Danio rerio GN=ighv1-4 PE=4 SV=1
  281 : K4G4T3_CALMI        0.39  0.66    1  214   21  231  216    4    7  236  K4G4T3     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  282 : K4G7J9_CALMI        0.39  0.66    1  214   21  230  215    3    6  235  K4G7J9     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  283 : K4GK69_CALMI        0.39  0.66    1  214   21  229  216    4    9  234  K4GK69     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  284 : K9J2X3_DESRO        0.39  0.68  217  429   13  228  219    7    9  472  K9J2X3     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  285 : M3XIH0_LATCH        0.39  0.59    8  204   26  228  207    8   14  241  M3XIH0     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
  286 : Q0IIV1_XENTR        0.39  0.61    9  204   25  216  199    5   10  229  Q0IIV1     LOC734127 protein (Fragment) OS=Xenopus tropicalis GN=LOC734127 PE=2 SV=1
  287 : Q0P3Z5_DANRE        0.39  0.65    1  207   21  224  210    6    9  238  Q0P3Z5     Zgc:153659 OS=Danio rerio GN=zgc:153659 PE=2 SV=1
  288 : Q1RMN8_BOVIN        0.39  0.60    8  206   26  223  204    5   11  234  Q1RMN8     Immunoglobulin light chain, lambda gene cluster OS=Bos taurus GN=IGL@ PE=2 SV=1
  289 : Q3KQK0_MOUSE        0.39  0.65  217  429   20  233  217    6    7  484  Q3KQK0     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  290 : Q3SYJ4_MOUSE        0.39  0.65  217  429   20  233  217    6    7  484  Q3SYJ4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  291 : Q3T101_BOVIN4K3D    0.39  0.61    8  206   26  224  205    6   12  235  Q3T101     IGL@ protein OS=Bos taurus GN=IGL@ PE=1 SV=1
  292 : Q52L51_MOUSE        0.39  0.65  217  429   20  232  217    7    8  483  Q52L51     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  293 : Q566J7_MOUSE        0.39  0.64  217  429   20  232  219    8   12  483  Q566J7     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  294 : Q569B3_RAT          0.39  0.66  217  436   20  247  228    6    8  617  Q569B3     Igh-6 protein OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
  295 : Q6DDQ7_XENLA        0.39  0.64  217  436   18  237  226    8   12  614  Q6DDQ7     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  296 : Q6INM5_XENLA        0.39  0.64  217  436   18  242  229    8   13  593  Q6INM5     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  297 : Q6MZW0_HUMAN2QTJ    0.39  0.65  217  429   37  248  223    9   21  506  Q6MZW0     Putative uncharacterized protein DKFZp686J11235 (Fragment) OS=Homo sapiens GN=DKFZp686J11235 PE=1 SV=1
  298 : Q6N091_HUMAN        0.39  0.69  217  429   38  255  221    8   11  500  Q6N091     Putative uncharacterized protein DKFZp686C02220 (Fragment) OS=Homo sapiens GN=DKFZp686C02220 PE=1 SV=1
  299 : Q8K172_MOUSE        0.39  0.66  217  429   20  231  217    7    9  482  Q8K172     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  300 : Q8WY24_HUMAN2ESG    0.39  0.68  217  429   20  239  223    8   13  497  Q8WY24     SNC66 protein OS=Homo sapiens PE=1 SV=1
  301 : Q96DK0_HUMAN        0.39  0.64  217  429   20  238  223    9   14  496  Q96DK0     CDNA FLJ25298 fis, clone STM07683, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=2 SV=1
  302 : Q99KA4_MOUSE        0.39  0.63  217  429   20  237  221    7   11  487  Q99KA4     Igh protein OS=Mus musculus GN=Igh-VJ558 PE=2 SV=1
  303 : S6BGF9_HUMAN        0.39  0.63   11  198   26  213  192    5    8  213  S6BGF9     IgG L chain OS=Homo sapiens PE=2 SV=1
  304 : A1L2N8_XENLA        0.38  0.59  217  434   24  240  229    7   23  588  A1L2N8     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
  305 : A9UMG6_XENTR        0.38  0.65  217  434   34  256  229    6   17  634  A9UMG6     LOC100135349 protein (Fragment) OS=Xenopus tropicalis GN=LOC100135349 PE=2 SV=1
  306 : F1Q526_DANRE        0.38  0.63   10  209   29  230  207    7   12  241  F1Q526     Uncharacterized protein OS=Danio rerio PE=4 SV=1
  307 : F7HAF7_CALJA        0.38  0.62   11  206   29  225  200    6    7  236  F7HAF7     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  308 : F7IIR0_CALJA        0.38  0.62   11  206   29  225  200    5    7  236  F7IIR0     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  309 : G1Q329_MYOLU        0.38  0.62   10  206   31  228  201    6    7  239  G1Q329     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  310 : G3UQQ8_MELGA        0.38  0.56    8  206   13  207  206    7   18  218  G3UQQ8     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
  311 : J9NVC6_CANFA        0.38  0.66  217  435   26  249  228    9   13  620  J9NVC6     Uncharacterized protein OS=Canis familiaris PE=4 SV=1
  312 : K4G3A9_CALMI        0.38  0.65    1  214   21  231  216    4    7  236  K4G3A9     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  313 : K9IZ41_DESRO        0.38  0.61    8  206   26  224  202    5    6  235  K9IZ41     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  314 : M3XU30_MUSPF        0.38  0.61   16  206   34  221  196    6   13  232  M3XU30     Uncharacterized protein OS=Mustela putorius furo PE=4 SV=1
  315 : Q3B8R4_RAT          0.38  0.67  217  436   20  246  227    5    7  595  Q3B8R4     Igh-6 protein OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
  316 : Q4V9Z4_MOUSE        0.38  0.60  217  429   19  225  221    8   22  476  Q4V9Z4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  317 : Q5CZ94_HUMAN        0.38  0.60   11  206   29  223  198    5    5  234  Q5CZ94     Putative uncharacterized protein DKFZp781M0386 OS=Homo sapiens GN=DKFZp781M0386 PE=2 SV=1
  318 : Q6GNB8_XENLA        0.38  0.63    8  204   26  218  200    5   10  231  Q6GNB8     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  319 : Q6N090_HUMAN        0.38  0.66  217  429   38  248  219   10   14  506  Q6N090     Putative uncharacterized protein DKFZp686G21220 (Fragment) OS=Homo sapiens GN=DKFZp686G21220 PE=1 SV=1
  320 : Q6ZW64_HUMAN        0.38  0.68  217  429   20  236  221   10   12  494  Q6ZW64     cDNA FLJ41552 fis, clone COLON2004478, highly similar to Protein Tro alpha1 H,myeloma OS=Homo sapiens PE=1 SV=1
  321 : Q7SZQ3_DANRE        0.38  0.64  227  431   31  235  212   10   14  499  Q7SZQ3     Ighm protein (Fragment) OS=Danio rerio GN=ighm PE=2 SV=1
  322 : Q80ZI7_MOUSE        0.38  0.62  217  429   20  236  222    8   14  487  Q80ZI7     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  323 : Q91WP5_MOUSE        0.38  0.62  217  429   20  228  217    7   12  479  Q91WP5     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  324 : Q99LA6_MOUSE        0.38  0.65  217  429   20  234  218    7    8  484  Q99LA6     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  325 : R4I5B0_EPICO        0.38  0.65    8  207   28  231  206    4    8  243  R4I5B0     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  326 : R9PXM5_CHICK        0.38  0.57   10  206   28  219  204    8   19  229  R9PXM5     Uncharacterized protein OS=Gallus gallus GN=Gga.57 PE=4 SV=1
  327 : S6B286_HUMAN        0.38  0.60   11  198   29  215  191    5    7  215  S6B286     IgG L chain OS=Homo sapiens PE=2 SV=1
  328 : B2RYY0_XENTR        0.37  0.60    9  204   27  218  200    5   12  231  B2RYY0     Uncharacterized protein OS=Xenopus tropicalis PE=2 SV=1
  329 : F1R2L7_DANRE        0.37  0.63    1  209   48  259  216    6   11  264  F1R2L7     Uncharacterized protein (Fragment) OS=Danio rerio GN=LOC793066 PE=4 SV=1
  330 : F7BEZ6_XENTR        0.37  0.58    9  204   25  218  201    6   12  231  F7BEZ6     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=igl@ PE=4 SV=1
  331 : F7BF18_XENTR        0.37  0.58    9  204   33  227  201    5   11  240  F7BF18     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=igl@ PE=4 SV=1
  332 : F7H1Q4_CALJA        0.37  0.59   11  206   29  223  201    5   11  234  F7H1Q4     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  333 : F7I7E2_CALJA        0.37  0.61   11  206   29  223  200    5    9  234  F7I7E2     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  334 : G0YP42_MOUSE1PG7    0.37  0.59   11  206   29  223  199    6    7  234  G0YP42     Anti-human Langerin 2G3 lambda chain OS=Mus musculus PE=1 SV=1
  335 : G1LPA5_AILME        0.37  0.58   12  206   31  222  198    5    9  233  G1LPA5     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
  336 : G1Q0M3_MYOLU        0.37  0.60   15  206   33  221  194    4    7  232  G1Q0M3     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  337 : G1QEL1_MYOLU        0.37  0.60   10  206   28  224  202    6   10  235  G1QEL1     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  338 : G3UR71_MELGA        0.37  0.57   10  206   13  206  204    7   17  217  G3UR71     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=1
  339 : H0XPV0_OTOGA        0.37  0.59   16  204   34  218  196    7   18  231  H0XPV0     Uncharacterized protein OS=Otolemur garnettii PE=4 SV=1
  340 : H2RWF3_TAKRU        0.37  0.65  220  433   22  233  216    4    6  279  H2RWF3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  341 : H3A0Z5_LATCH        0.37  0.59   16  204   34  234  204    9   18  247  H3A0Z5     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
  342 : H9GTZ4_ANOCA        0.37  0.58    8  206   28  222  204    8   14  232  H9GTZ4     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=LOC100560921 PE=4 SV=1
  343 : I3IT31_DANRE        0.37  0.62  220  431   20  228  218    9   15  568  I3IT31     Uncharacterized protein OS=Danio rerio GN=ighv1-4 PE=4 SV=1
  344 : K4FT06_CALMI        0.37  0.65    1  214   21  232  219    4   12  237  K4FT06     Ig lambda-like chain, V-C region-nurse shark OS=Callorhynchus milii PE=2 SV=1
  345 : K4G9V5_CALMI        0.37  0.64    4  214    1  208  216    4   13  213  K4G9V5     Ig lambda-like chain, V-C region OS=Callorhynchus milii PE=2 SV=1
  346 : K9IRB0_DESRO        0.37  0.66  217  429   13  226  217    6    7  272  K9IRB0     Uncharacterized protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  347 : Q0P3Z6_DANRE        0.37  0.61   16  207   52  254  204   11   13  268  Q0P3Z6     Uncharacterized protein (Fragment) OS=Danio rerio GN=zgc:153659 PE=2 SV=1
  348 : Q2KHS9_MOUSE        0.37  0.64  217  429   20  235  219    7    9  486  Q2KHS9     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  349 : Q2NLC3_MOUSE        0.37  0.64  217  429   20  229  217    7   11  480  Q2NLC3     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  350 : Q2T9K9_MOUSE        0.37  0.62  217  429   20  231  217    7    9  482  Q2T9K9     LOC677563 protein OS=Mus musculus GN=LOC677563 PE=2 SV=1
  351 : Q3KQK2_MOUSE        0.37  0.62  217  429   20  228  217    7   12  479  Q3KQK2     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  352 : Q4VAB6_MOUSE        0.37  0.65  217  429   20  232  217    7    8  483  Q4VAB6     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  353 : Q5HZY6_MOUSE        0.37  0.63  217  429   20  235  219    7    9  486  Q5HZY6     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  354 : Q6GN83_XENLA        0.37  0.63  217  436   31  254  227    7   10  605  Q6GN83     MGC69066 protein (Fragment) OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  355 : Q6GNH3_XENLA        0.37  0.63    8  204   26  220  201    5   10  233  Q6GNH3     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  356 : Q6P2J1_HUMAN        0.37  0.60   11  206   29  224  201    6   10  235  Q6P2J1     Uncharacterized protein OS=Homo sapiens PE=2 SV=1
  357 : Q8K0F2_MOUSE        0.37  0.63  217  429   20  237  221    7   11  488  Q8K0F2     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  358 : Q91WR1_MOUSE        0.37  0.63  217  429   20  237  221    7   11  488  Q91WR1     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  359 : Q91WT1_MOUSE        0.37  0.63  217  429   20  230  217    7   10  481  Q91WT1     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  360 : R4I4V8_EPICO        0.37  0.62    1  207   20  234  218    9   14  247  R4I4V8     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  361 : S6C4R7_HUMAN        0.37  0.61   11  198   26  212  191    5    7  212  S6C4R7     IgG L chain OS=Homo sapiens PE=2 SV=1
  362 : U3JZF7_FICAL        0.37  0.55   15  204    1  186  197    8   18  199  U3JZF7     Uncharacterized protein OS=Ficedula albicollis PE=4 SV=1
  363 : A4FU62_MOUSE        0.36  0.58   11  206   29  223  199    6    7  233  A4FU62     LOC207685 protein (Fragment) OS=Mus musculus GN=LOC207685 PE=2 SV=1
  364 : G1N5T4_MELGA        0.36  0.55   10  206   28  219  205    6   21  230  G1N5T4     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100545541 PE=4 SV=2
  365 : G1Q584_MYOLU        0.36  0.59   10  206   28  226  205    7   14  237  G1Q584     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  366 : G1Q5P0_MYOLU        0.36  0.61   10  206   28  225  203    6   11  236  G1Q5P0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  367 : H0ZF58_TAEGU        0.36  0.58   10  202   28  217  198    7   13  232  H0ZF58     Uncharacterized protein OS=Taeniopygia guttata GN=IGLL1 PE=4 SV=1
  368 : H2M8T0_ORYLA        0.36  0.60  217  425   29  245  225   10   24  617  H2M8T0     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
  369 : H2RWF5_TAKRU        0.36  0.62  220  433   24  241  222    5   12  363  H2RWF5     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  370 : I3IT76_DANRE        0.36  0.61  220  431   20  228  218    9   15  568  I3IT76     Uncharacterized protein OS=Danio rerio GN=ighv1-4 PE=4 SV=1
  371 : I3IXP5_ORENI        0.36  0.63   14  207    1  197  198    3    5  208  I3IXP5     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100701627 PE=4 SV=1
  372 : K9IKE8_DESRO        0.36  0.65  217  429   20  234  223    8   18  478  K9IKE8     Putative secreted protein OS=Desmodus rotundus PE=2 SV=1
  373 : M3WUE7_FELCA        0.36  0.53    1  186   18  160  187    6   45  251  M3WUE7     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
  374 : Q2TAW9_MOUSE        0.36  0.63  217  429   20  231  217    7    9  482  Q2TAW9     Uncharacterized protein OS=Mus musculus PE=2 SV=1
  375 : Q32NZ5_MOUSE        0.36  0.63  217  429   20  231  218    8   11  482  Q32NZ5     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  376 : Q566X2_DANRE        0.36  0.61    1  209   48  261  218    7   13  266  Q566X2     LOC793066 protein (Fragment) OS=Danio rerio GN=LOC793066 PE=2 SV=1
  377 : Q5BJ31_DANRE        0.36  0.65  220  431   21  230  217    8   12  570  Q5BJ31     Ighm protein OS=Danio rerio GN=ighm PE=2 SV=1
  378 : Q5M8U3_XENTR        0.36  0.59    9  204   25  216  199    5   10  229  Q5M8U3     LOC734127 protein (Fragment) OS=Xenopus tropicalis GN=LOC734127 PE=2 SV=1
  379 : Q5U512_XENLA        0.36  0.59    9  204   27  220  202    5   14  233  Q5U512     LOC594871 protein OS=Xenopus laevis GN=LOC594871 PE=2 SV=1
  380 : Q5XGQ4_XENLA        0.36  0.56    8  204   26  226  206    8   14  239  Q5XGQ4     LOC594870 protein OS=Xenopus laevis GN=LOC594870 PE=2 SV=1
  381 : Q63ZL4_XENLA        0.36  0.57   12  204   30  227  202    9   13  240  Q63ZL4     LOC594871 protein OS=Xenopus laevis GN=LOC594871 PE=2 SV=1
  382 : Q7TMK4_MOUSE        0.36  0.62  217  429   20  229  221    8   19  479  Q7TMK4     Immunoglobulin heavy chain complex OS=Mus musculus GN=Igh PE=2 SV=1
  383 : Q8VCV5_MOUSE        0.36  0.63  217  429   20  231  217    7    9  481  Q8VCV5     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  384 : Q91WT3_MOUSE        0.36  0.63  217  429   20  230  218    9   12  481  Q91WT3     Igh protein OS=Mus musculus GN=Igh-VJ558 PE=2 SV=1
  385 : U5NG59_GINCI        0.36  0.60  217  427    3  213  216    7   10  284  U5NG59     Secreted IgW heavy chain (Fragment) OS=Ginglymostoma cirratum PE=2 SV=1
  386 : G3IMG2_CRIGR        0.35  0.53    1  177   21  168  185    7   45  173  G3IMG2     Putative uncharacterized protein OS=Cricetulus griseus GN=I79_025101 PE=4 SV=1
  387 : K9IWW7_DESRO        0.35  0.60   11  206   29  225  199    5    5  236  K9IWW7     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  388 : K9IZ43_DESRO        0.35  0.58   11  206   29  225  202    6   11  236  K9IZ43     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  389 : L7N2R1_XENTR        0.35  0.63  217  434   34  255  231    9   22  634  L7N2R1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=ighx PE=4 SV=1
  390 : M7BWW9_CHEMY        0.35  0.55    1  189  168  336  197   11   36  430  M7BWW9     Ig kappa chain V-III region CLL OS=Chelonia mydas GN=UY3_10237 PE=4 SV=1
  391 : Q4QQW0_RAT          0.35  0.63  217  436   19  242  228    8   12  591  Q4QQW0     Igh-6 protein (Fragment) OS=Rattus norvegicus GN=Igh-6 PE=2 SV=1
  392 : Q58E08_XENLA        0.35  0.56    8  204   16  218  208    9   16  231  Q58E08     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
  393 : Q8K0Z4_MOUSE        0.35  0.63  217  429   20  230  217    7   10  480  Q8K0Z4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  394 : Q8VCX4_MOUSE        0.35  0.64  217  429   20  238  222    7   12  489  Q8VCX4     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  395 : S9X3E8_9CETA        0.35  0.54    1  189   21  171  191    6   42  380  S9X3E8     Ig kappa chain V-II region RPMI 6410-like protein OS=Camelus ferus GN=CB1_000688040 PE=4 SV=1
  396 : F1N160_BOVIN        0.34  0.54    8  206   26  234  212    9   16  245  F1N160     Uncharacterized protein OS=Bos taurus GN=VPREB1 PE=4 SV=2
  397 : F7BB77_CALJA        0.34  0.58   11  206   29  225  201    5    9  236  F7BB77     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  398 : F7CRS2_CALJA        0.34  0.57   11  206   29  234  210    9   18  245  F7CRS2     Uncharacterized protein OS=Callithrix jacchus PE=4 SV=1
  399 : G1TKP3_RABIT        0.34  0.58   16  206   35  227  199    8   14  238  G1TKP3     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=1
  400 : G1TSJ0_RABIT        0.34  0.55    2  196   24  190  195    7   28  203  G1TSJ0     Uncharacterized protein OS=Oryctolagus cuniculus PE=4 SV=2
  401 : H0W5L9_CAVPO        0.34  0.56   16  206   34  233  203    8   15  244  H0W5L9     Uncharacterized protein OS=Cavia porcellus GN=LOC100735142 PE=4 SV=1
  402 : H2S812_TAKRU        0.34  0.58    8  207   45  253  211    9   13  265  H2S812     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101062439 PE=4 SV=1
  403 : I3ISY6_DANRE        0.34  0.62  220  431   21  230  218    9   14  570  I3ISY6     Uncharacterized protein OS=Danio rerio GN=ighv1-4 PE=4 SV=1
  404 : K9IL19_DESRO        0.34  0.63  217  429   20  240  225    9   16  529  K9IL19     Putative secreted protein OS=Desmodus rotundus PE=2 SV=1
  405 : M7BKR4_CHEMY        0.34  0.52    1  198   48  224  202    8   29  358  M7BKR4     Ig kappa chain V-III region VG OS=Chelonia mydas GN=UY3_10243 PE=4 SV=1
  406 : Q58E61_MOUSE        0.34  0.62  217  429   20  235  220    8   11  485  Q58E61     Igh protein OS=Mus musculus GN=Igh PE=2 SV=1
  407 : U5NJD4_GINCI        0.34  0.59  217  424    4  214  215    7   11  286  U5NJD4     Secreted IgW heavy chain (Fragment) OS=Ginglymostoma cirratum PE=2 SV=1
  408 : F6UM84_ORNAN        0.33  0.53  217  400    1  194  198    6   18  257  F6UM84     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus PE=4 SV=1
  409 : F6W3M2_MACMU        0.33  0.62  217  434   20  244  234    8   25  614  F6W3M2     Uncharacterized protein OS=Macaca mulatta GN=IGHM PE=4 SV=1
  410 : G1M4T3_AILME        0.33  0.56    8  206   26  229  209    9   15  240  G1M4T3     Uncharacterized protein OS=Ailuropoda melanoleuca PE=4 SV=1
  411 : H2S813_TAKRU        0.33  0.58    8  207   28  231  209    8   14  243  H2S813     Uncharacterized protein OS=Takifugu rubripes GN=LOC101062439 PE=4 SV=1
  412 : I3JA36_ORENI        0.33  0.58  220  399    2  179  182    5    6  215  I3JA36     Uncharacterized protein (Fragment) OS=Oreochromis niloticus PE=4 SV=1
  413 : K9IR26_DESRO        0.33  0.57    8  206   28  233  211   10   17  244  K9IR26     Putative secreted mucin (Fragment) OS=Desmodus rotundus PE=2 SV=1
  414 : K9J517_DESRO        0.33  0.57    8  206   28  233  212   10   19  244  K9J517     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  415 : Q7T0R1_XENLA        0.33  0.58  217  436   20  236  226   10   15  587  Q7T0R1     MGC69066 protein OS=Xenopus laevis PE=2 SV=1
  416 : A2RVA3_XENLA        0.32  0.54   11  204   29  226  202    8   12  239  A2RVA3     Uncharacterized protein OS=Xenopus laevis PE=2 SV=1
  417 : F6S2S6_XENTR        0.32  0.54    9  204   27  220  202    5   14  233  F6S2S6     Uncharacterized protein OS=Xenopus tropicalis PE=4 SV=1
  418 : H2ZX70_LATCH        0.32  0.53    1  185    1  161  187    8   28  235  H2ZX70     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  419 : I3JD33_ORENI        0.32  0.55    3  207   23  226  211    9   13  236  I3JD33     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100700295 PE=4 SV=1
  420 : K7GG21_PELSI        0.32  0.55  220  406    4  187  196    5   21  230  K7GG21     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  421 : K9IHN7_DESRO        0.32  0.58   12  206   31  224  198    6    7  235  K9IHN7     Putative secreted mucin OS=Desmodus rotundus PE=2 SV=1
  422 : K9IR05_DESRO        0.32  0.58   13  206   27  219  197    6    7  230  K9IR05     Putative secreted protein (Fragment) OS=Desmodus rotundus PE=2 SV=1
  423 : L9JMB0_TUPCH        0.32  0.54    1  186   21  193  195    8   31  325  L9JMB0     Ig kappa chain V-II region RPMI 6410 OS=Tupaia chinensis GN=TREES_T100021699 PE=4 SV=1
  424 : Q6GNC5_XENLA        0.32  0.54   11  204   35  232  202    8   12  245  Q6GNC5     Uncharacterized protein (Fragment) OS=Xenopus laevis PE=2 SV=1
  425 : Q7SYU1_XENLA        0.32  0.54   11  204   38  235  202    8   12  248  Q7SYU1     LOC779021 protein (Fragment) OS=Xenopus laevis GN=LOC779021 PE=2 SV=1
  426 : U5NG66_GINCI        0.32  0.59  217  424    8  218  215    8   11  773  U5NG66     Secreted IgW heavy chain (Fragment) OS=Ginglymostoma cirratum PE=2 SV=1
  427 : U5NGC1_GINCI        0.32  0.60  217  426   20  224  215    7   15  982  U5NGC1     Secreted IgW heavy chain OS=Ginglymostoma cirratum PE=2 SV=1
  428 : U5NJK8_GINCI        0.32  0.60  217  426   20  223  215    8   16  981  U5NJK8     Secreted IgW heavy chain OS=Ginglymostoma cirratum PE=2 SV=1
  429 : A0N8U8_HETFR        0.31  0.57    3  214   19  236  223    8   16  242  A0N8U8     Variable region OS=Heterodontus francisci PE=4 SV=1
  430 : G1PFS0_MYOLU        0.31  0.57    4  206   22  232  217   11   20  243  G1PFS0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
  431 : G3N7B2_GASAC        0.31  0.55    2  207   11  219  216   13   17  229  G3N7B2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  432 : G3NAK0_GASAC        0.31  0.54    2  207   19  229  219   14   21  239  G3NAK0     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  433 : G3PMJ5_GASAC        0.31  0.53    2  207   19  229  219   12   21  239  G3PMJ5     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  434 : G5E170_9PIPI        0.31  0.45    8  204   12  172  203    8   48  183  G5E170     Putative uncharacterized protein (Fragment) OS=Pipa carvalhoi PE=2 SV=1
  435 : H2M8H5_ORYLA        0.31  0.54  220  400    2  192  202    8   32  234  H2M8H5     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
  436 : I3JD26_ORENI        0.31  0.54    3  207   23  225  214   10   20  234  I3JD26     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100698499 PE=4 SV=1
  437 : M3WFW2_FELCA        0.31  0.55    4  206   22  230  214   10   16  241  M3WFW2     Uncharacterized protein OS=Felis catus PE=4 SV=1
  438 : M4AAT8_XIPMA        0.31  0.57  238  433    1  198  207   11   20  484  M4AAT8     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=4 SV=1
  439 : Q5FW13_XENTR        0.31  0.58  217  431   29  240  223   11   19  594  Q5FW13     LOC548369 protein (Fragment) OS=Xenopus tropicalis GN=LOC548369 PE=2 SV=1
  440 : Q921A6_MOUSE1ZEA    0.31  0.56  217  423    1  210  219    8   21  241  Q921A6     Anti-CEA 79 single chain Fv (Fragment) OS=Mus musculus PE=1 SV=1
  441 : R4I3Y3_EPICO        0.31  0.57    3  207   20  231  219   12   21  245  R4I3Y3     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  442 : U5NFT0_GINCI        0.31  0.57  217  424   20  219  213    8   18  774  U5NFT0     Secreted IgW heavy chain OS=Ginglymostoma cirratum PE=2 SV=1
  443 : U5NFT4_GINCI        0.31  0.59  217  427   20  230  216    7   10  996  U5NFT4     Secreted IgW heavy chain OS=Ginglymostoma cirratum PE=2 SV=1
  444 : U5NFU0_GINCI        0.31  0.59  217  424   18  224  213    8   11  986  U5NFU0     Secreted IgW heavy chain (Fragment) OS=Ginglymostoma cirratum PE=2 SV=1
  445 : U5NG56_GINCI        0.31  0.58  217  424   20  221  213    9   16  595  U5NG56     Secreted IgW heavy chain OS=Ginglymostoma cirratum PE=2 SV=1
  446 : U5NGB9_GINCI        0.31  0.59  217  426   20  225  215    7   14  595  U5NGB9     Secreted IgW heavy chain OS=Ginglymostoma cirratum PE=2 SV=1
  447 : U5NGC9_GINCI        0.31  0.58  217  424   18  229  216    8   12  784  U5NGC9     Secreted IgW heavy chain (Fragment) OS=Ginglymostoma cirratum PE=2 SV=1
  448 : U5NJD0_GINCI        0.31  0.59  217  427   20  229  216    7   11  788  U5NJD0     Secreted IgW heavy chain OS=Ginglymostoma cirratum PE=2 SV=1
  449 : G1Q1W9_MYOLU        0.30  0.51  217  400    2  188  199   10   27  250  G1Q1W9     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  450 : G1Q427_MYOLU        0.30  0.54  217  399    1  193  198    8   20  233  G1Q427     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  451 : G3NAJ2_GASAC        0.30  0.55    2  207   21  230  218   13   20  240  G3NAJ2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  452 : G3NQA4_GASAC        0.30  0.53    2  207   16  224  217   12   19  234  G3NQA4     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  453 : G3P9Y1_GASAC        0.30  0.55    2  207   16  224  218   13   21  234  G3P9Y1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  454 : G3P9Y8_GASAC        0.30  0.54    2  207   22  230  218   12   21  239  G3P9Y8     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  455 : G3S323_GORGO        0.30  0.56  217  397    1  185  194    7   22  226  G3S323     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  456 : H2RQT3_TAKRU        0.30  0.54  220  399    4  188  195    8   25  248  H2RQT3     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
  457 : I3IV84_ORENI        0.30  0.55    3  207   22  230  217   13   20  239  I3IV84     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=LOC100702330 PE=4 SV=1
  458 : I3JD37_ORENI        0.30  0.55    2  206   19  229  218   13   20  240  I3JD37     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100695757 PE=4 SV=1
  459 : K7FDV6_PELSI        0.30  0.54  218  401    1  182  194    5   22  222  K7FDV6     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis PE=4 SV=1
  460 : L5LTW6_MYODS        0.30  0.54  217  407   20  211  204    9   25  219  L5LTW6     Ig heavy chain V-III region VH26 OS=Myotis davidii GN=MDA_GLEAN10002129 PE=4 SV=1
  461 : M4AE53_XIPMA        0.30  0.55    3  207   20  225  218   13   25  238  M4AE53     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
  462 : Q6IR66_XENLA        0.30  0.54  217  436   24  237  228   11   22  588  Q6IR66     MGC69066 protein OS=Xenopus laevis GN=MGC69066 PE=2 SV=1
  463 : R4I3X1_EPICO        0.30  0.56    3  207   20  230  217   12   18  244  R4I3X1     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  464 : R4I4T8_EPICO        0.30  0.56    3  207   20  228  218   11   22  242  R4I4T8     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
  465 : R4I4V7_EPICO        0.30  0.55    3  207   20  228  217   13   20  242  R4I4V7     Immmunoglobulin light chain OS=Epinephelus coioides PE=2 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    1 L D              0   0  100   77   31  DDDDEEQDDQEDDDDDD    D  D              QDD  D  DEDDQEEE     D QEDE DQQ
     2    2 L I        -     0   0    0   88   32  IIIVLLIIVISIIIIII    I  I         I    III  V  IIIIIIVI I   I IIVN VII
     3    3 L V        -     0   0   88   98   48  VVLLVVVKVVVQQKKQQ    R  Q         V    VQQ  V  QVQQVVVV R   Q VVVV VVV
     4    4 L M  E     -Q   25   0G  12  101   21  LMMMMMLMMLLMMMMML    M  M         L    MMM  M  MMMMMMLM M   M MMML LML
     5    5 L T  E     -Q   24   0G  80  101   14  TSTTTTTTTSTTTTTTT    T  T         T    TTT  T  TTTITTTT T   T TTTT TTT
     6    6 L Q  E     -Q   23   0G  19  101    5  QQQQQQQQQQQQQQQQQ    Q  Q         Q    QQQ  Q  QQQQQQQQ Q   Q QQQQ QQQ
     7    7 L S  E    S+Q   22   0G  57  101   57  SSTTSSSSTSSTTSSSS    S  S         S    SSS  S  SSTSSTTS S   S SSTS TST
     8    8 L P        -     0   0   47  148    6  PPPPPPPPPPPTTPPPP    P  P         P    PPP  P  PPPPPPPP P   P PPPP PPP
     9    9 L A  S    S-     0   0   79  156   68  ASLLLLASLAASSSSAA    A  P         L    ASS  L  SASSALLL S   S AALG LAE
    10   10 L S  E     -t  107   0H  78  168   57  SSSSSSISTIISSSSSS    S  S         S    TSS  S  STSSTSLS S   S TTST STS
    11   11 L L  E     -t  108   0H  34  204   48  LLLLLLMMLLMLLMMLL    L  L         L    LLL  L  LLVLLLLL F   L LLLL LLL
    12   12 L V  E     +t  109   0H  86  214   38  AAPPSSSYSSSSSYYSS    S  S         S    SSS  P  SSSSSPPP S   S SSPS SSS
    13   13 L V  E     -t  110   0H  17  216   57  VVVVVVAAVGAAAVAVA    A  A         V    LAA  V  ALAALVVV A   A LLVL ILV
    14   14 L S  E >   -t  111   0H  46  224   63  SSSSSSSSTFSSSSSSS    S  S         S    SSS  T  SSSSSTTT S   S SSTS ISV
    15   15 L L  T 3  S+     0   0   79  225   67  LVLLLLLLIPLLLLLVV    L  L         P    PVV  L  VPVVPPPL T   V PPPP PPP
    16   16 L G  T 3  S+     0   0   39  233    6  GGGGGGGGGGGGGGGGG    G  G         G    KGG  G  GGGGKGGG G   G KGGG GKG
    17   17 L Q    <   -     0   0   97  233   51  QEDDDDEEQEEDDEEEE    E  D         A    EDD  Q  DEDDEEEQ D   D EEEE EEE
    18   18 L R        -     0   0  152  233   63  RKQQQQRRPKKRRARTT    T  K         P    TKR  P  RRKRTPPP R   T TRPR MTT
    19   19 L A  E     - R   0  79G   2  233   43  AVAAAAVVAVVVVVVVV    V  V         A    AVV  A  VAVVAAAA V   V AAAA AAV
    20   20 L T  E     - R   0  78G  66  233   58  TTSSSSTTSTTTTTTTT    N  T         S    TTT  S  TTTTTSSS T   T TTST STT
    21   21 L I  E     - R   0  77G   0  233   23  IMIIIIMIIMMIIIIII    I  I         I    LII  I  ILIILIII I   I LVIL ILI
    22   22 L S  E     -QR   7  76G  36  233   53  SSSSSSTTSTSSSTTTT    E  T         S    STT  S  TSTTSSSS T   T SSSS SSN
    23   23 L a  E     -QR   6  75G   0  233    0  CCCCCCCCCCCCCCCCC    C  C         C    CCC  C  CCCCCCCC C   C CCCC CCC
    24   24 L R  E     -QR   5  74G 153  233   76  RKRRRRTKKRRSSKKRR    L  Q         R    RQR  R  RRRRRKRK R   R RRRR KRK
    25   25 L A  E     -Q    4   0G   6  233   70  ASSSSSAASAAGAAAAA    A  T         S    AAA  S  AAAAAAAS A   A AAAA SAA
    26   26 L S  S    S+     0   0   63  233   52  SSSSSSSSSSSSSSSSS    S  S         S    SSS  T  SSSSSSSS S   S SSSS SSS
    27   27 L E  S    S-     0   0  105  233   74  QQQQQQSQQSSQQQQEE    E  Q         Q    QQQ  Q  QQQQQQQQ Q   Q QQQQ QQS
    28   27AL S        -     0   0   29  233   75  SsssssSDsSRGGDDNN    D  N         S    SSN  s  SSGGSsss D   D SSsS sSs
    29   27BL V        +     0   0    0   70   75  Vlvvvv..l........    .  .         L    ...  v  .....liv .   . ..l. v.t
    30   27CL D  E     +Z   35   0I  45   97   81  SYHHHHV.H........    .  .         E    ...  Y  .....HHD .   . ..H. H.D
    31   27DL S  E >  S+Z   34   0I  15  133   82  TSSTTTT.S....I.II    I  .         S    ...  S  .....SST .   . ..S. S.D
    32   28 L Y  T 3  S-     0   0  173  140   87  SYNNNNS.N..I.Y.YY    Y  .         Y    ...  D  .....DDN .   . ..NL D.D
    33   29 L G  T 3  S+     0   0   81  224   59  TnGGGGSIGVVAISISS    S  I         S    VII  G  IVIIVGGG I   I VvGS GVl
    34   30 L K  E <  S-Z   31   0I 112  182   77  YkNNNN.KK...S.N..    .  N         Y    SSN  N  SSSSSNNN R   S SsNS KSa
    35   31 L S  E     -Z   30   0I   7  205   76  SNTTTT.STNNNN.S..    .  K         N    SSN  T  NSSSSTTT N   N SNTS TSD
    36   32 L F        +     0   0    5  218   67  YYYYYYYYYYYYYFYNY    D  Y         F    YWY  Y  DSWCYYYY Y   Y YYYY YYF
    37   33 L M  E     -U   94   0H   0  225   52  MLLLLLLLLMMLLLLLL    L  I         L    LLL  L  LLLLLLLL V   L LLLL LLL
    38   34 L H  E     -U   93   0H   0  229   82  HAEEHHHSNHYNNKSAA    A  A         S    AAN  N  AAAAAHHI A   A AANA NAA
    39   35 L W  E     -UV  92  52H   0  233    0  WWWWWWWWWWWWWWWWW    W  W         W    WWW  W  WWWWWWWW W   W WWWW WWW
    40   36 L Y  E     -UV  91  50H   0  233   14  YYYYYYYYLYYYYFFYY    Y  Y         Y    YYY  F  YYYYYFYF Y   F YYYY IYY
    41   37 L Q  E     -UV  90  49H   4  233   29  QQLLLLQQLQQQQQQQQ    Q  Q         Q    QQQ  Q  QQQQQRLH Q   Q QQLQ QQQ
    42   38 L Q  E     -U   89   0H  16  233   12  QQQQQQQQQQQQQKQQQ    Q  Q         Q    QQL  Q  QQQQQQQQ Q   Q QQQQ YQQ
    43   39 L K    >   -     0   0   47  233   62  KKKKKKKKRKKKKKKKK    K  K         K    KKK  R  KKKKKKKR K   K KKKK KKR
    44   40 L P  T 3  S+     0   0   81  233   36  PPPPPPPPPPSPPPPQQ    P  P         P    PPP  P  PPPPPPPP S   P PPPP PPP
    45   41 L G  T 3  S+     0   0   58  232   13  GGGGGGGWGGGDDGGGG    G  G         G    GGG  G  GGGGGGGG G   G GGGG GGG
    46   42 L Q  S <  S-     0   0  103  233   69  QQQQLLSKQSAGGKKKK    K  K         Q    QKK  Q  KQKKQQQQ K   K QQQQ QQQ
    47   43 L P        -     0   0   34  233   59  PSSSSSSSSSSTTPSSS    S  A         S    AAA  S  VAAAASSS A   A AASA SAA
    48   44 L P        -     0   0    5  233   10  PPPPPPPPPPPVVPPPP    P  P         P    PPP  P  PPPPPPPP P   P PPPP PPP
    49   45 L K  E     -V   41   0H  96  233   63  KKKKKKKKKKKKKKKQQ    Q  R         R    RKN  R  KRKKREQR K   K RRRR QRK
    50   46 L V  E     +V   40   0H  10  233   45  LLLLLLLTLPLLLTTLL    L  L         L    LPL  R  LLLLLGGR F   S LLRL GLL
    51   47 L L  E     +     0   0H   2  233   23  LLLLLLWLLWWLLLLLL    L  L         L    LLL  L  LLLLLLLL L   L LLLL LLL
    52   48 L I  E     -VW  39  58H   0  233   35  IIIIIIIIIIIIIIIVV    I  I         I    III  I  IIIIIIII I   I IIII III
    53   49 L Y  E  >  + W   0  57H  54  232   23  KYYYYYYYYYYYYYYYY    Y  G         Y    YYY  Y  YYYYYYYY Y   Y YYYY YYY
    54   50 L I  T >4 S-     0   0   10  233   88  YWKKIISYLAYYYHRAN    N  F         F    GKA  K  KGASGKKQ A   G GGKG QGG
    55   51 L A  T 34 S+     0   0    2  233   75  AALVVVTAVTTTTTAAA    A  T         A    AAA  V  AAAAAVVV A   A AAVV VAA
    56   52 L S  T 34 S+     0   0   73  233   63  SSSSSSSTSSSSSDNTK    N  S         T    SSS  S  SSSSSSSS S   S SSSS SSS
    57   53 L N  E <<  -W   53   0H  77  233   74  NTKNNNNSKKNSSRRNT    S  R         N    TSS  N  TSSSTNNK T   S TTNS NTT
    58   54 L L  E     -W   52   0H  63  233   66  LRRRRRLLLLLLLLLLL    L  L         K    RLL  R  LRLLRRRR L   L RRRR RRL
    59   55 L E    >   -     0   0   49  233   81  EEFFFFAAEAAHHMVAA    Q  V         A    AEQ  D  QVQQAFFD Q   Q AADA YAE
    60   56 L S  T 3  S+     0   0  107  233   40  SSSSSSSDSSPSSDDDD    N  S         S    TSS  S  STSSTSTS S   S TTST STD
    61   57 L G  T 3  S+     0   0   67  233   21  GGGGGGGGGGGGGGGGG    G  G         G    GGG  G  GGGGGGGG G   G GGGG GGG
    62   58 L V    <   -     0   0   17  233   47  VVVVVVVVVVVVVVVVV    V  I         V    IVV  V  VIVVIVVV V   V IIVI VII
    63   59 L P    >   -     0   0   62  233   27  PPPPPPPPPPPPPPPPP    P  P         P    PPP  P  PPPPPPPP P   Q PPPP SPP
    64   60 L A  T 3  S+     0   0   99  233   58  ADDDDDTSDAASSSSSS    S  S         D    ASS  D  SDSSADDD S   S AADD DAD
    65   61 L R  T 3  S+     0   0   30  233    8  RHRRRRRRRRRRRRRRR    R  R         R    RRR  R  RRRQRRRR R   K RRRR RRR
    66   62 L F  E <   -S   79   0G   7  233    1  FFFFFFFFFFFFFFFFF    F  F         F    FFF  F  FFFFFFFF F   F FFFF FFF
    67   63 L S  E     -S   78   0G  59  233   24  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS TSS
    68   64 L G  E     +S   77   0G  17  233   11  GGGGGGGGGGGGGGGGG    G  G         G    GGG  G  GGGGGGGG G   G GGGG GGG
    69   65 L S  E     +S   76   0G  48  233   40  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSS
    70   66 L G  E     -S   75   0G  35  233   77  GGGGGGGGGGGGGGGGR    G  G         G    GGG  G  GGGGGGGG G   G GGGG GGG
    71   67 L S  E >   +S   74   0G  68  232   24  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSS
    72   68 L R  T 3  S-     0   0  163  232   35  GGGGGGGGGGGGGGGGG    G  G         G    GGG  G  GGGGGGGG G   G GGGG GGG
    73   69 L T  T 3  S+     0   0   51  232   58  TTTTTTTQTTTTTQQTT    T  R         T    TTT  T  TTTTTTTT T   T TTTT TTT
    74   70 L D  E <   +RS  24  71G  77  232   64  DDDDDDSDDSSDHDDQQ    Q  D         D    DDD  D  DDDDDDDD D   D DDDD DDD
    75   71 L F  E     -RS  23  70G   0  232   81  FFFFFFYYFYYYYYYYF    Y  Y         F    FFF  F  FFFFFFFF F   F FFFF FFF
    76   72 L T  E     -RS  22  69G  33  232   61  TTTTTTSSTSSSSSSSS    S  S         T    TTT  T  TTTTTTTT T   T TTTT TTT
    77   73 L L  E     -RS  21  68G   0  232    4  LLLLLLLLLLLLLLLLL    L  F         L    LLL  L  LLLLLLLL L   L LLLL LLL
    78   74 L T  E     -RS  20  67G  28  232   48  NTKKKKTTKTTTTTTTK    K  S         K    TTT  K  TTTTTKRK T   T TTRT TTT
    79   75 L I  E     -RS  19  66G   0  232    4  IIIIIIIIIIIIIIIII    I  I         I    III  I  IIIIIIII I   I IIII III
    80   76 L D  S    S+     0   0   68  232   42  HSSSSSSSSSSSSNSNN    N  S         S    SSS  T  SSSSSSSS N   S SSSS SSS
    81   77 L P  S    S-     0   0   51  232   61  PSRRRRSSRRSNNSSSS    S  N         R    SSS  R  SSSSSRRR S   S SSRR RSR
    82   78 L V        +     0   0    0  232   50  VVVVVVMLVVVLLLLLL    L  V         V    LLL  V  LLLLLVVV L   L LLVL VLV
    83   79 L E    >   -     0   0   93  232   36  EKEEEEEEEEEEEEEQQ    Q  E         E    EQR  E  EQEEEEEE Q   Q EEEE QEE
    84   80 L A  G >  S+     0   0   22  232   55  EAAAAAASAAAPPCYSP    S  S         A    PPP  A  PPPPPAAA S   P PPAP APA
    85   81 L D  G 3  S+     0   0   58  232   28  EEEEEEEDEEEEEEEEE    E  E         E    EED  E  EEEEEDDE E   E EEDE EED
    86   82 L D  G <   +     0   0    1  232    0  DDDDDDDDDDDDDDDDD    D  D         D    DDD  D  DDDDDDDD D   D DDDD DDD
    87   83 L A    <   +     0   0   12  232   78  TLLLLLATLAAIIMMFF    V  I         A    FFF  V  FFFFFVVV F   F FFVF AFA
    88   84 L A  E    S- X   0 108H   8  232   20  AAGGGGAAGAAAAGGGG    A  A         G    AAA  G  AAAAAGGG A   A AAGA GAG
    89   85 L T  E     -UX  42 107H  35  233   69  TLVVVVTTVTTTTIISS    T  S         V    VTT  V  VTVVVVVV T   T VVVV VVD
    90   86 L Y  E     -UX  41 106H   0  233    4  YYYYYYYYYYYYYYYYY    Y  Y         Y    YYY  Y  YYYYYYYY Y   Y YYYY YYY
    91   87 L Y  E     -U   40   0H   9  233    6  YYYYFFYYYYYYYYYYY    F  Y         Y    YYY  F  YYYYYYYF Y   Y YYYY YYY
    92   88 L a  E     -U   39   0H   0  233    4  CCCCCCCCCCCCCCCCC    C  C         C    CCC  C  CCCCCCCC C   C CCCC CCC
    93   89 L Q  E     -UY  38 102H   1  233   79  QQFFSSHLLQQQQLLQQ    Q  L         Q    QQQ  M  QQQQQGYM Q   Q QQQQ YQQ
    94   90 L Q  E     +UY  37 101H   0  233   84  HQQQQQQQQQQQQQQHH    Q  Q         Q    QQQ  Q  QQQQQQQQ Q   Q QQQQ QQQ
    95   91 L N        +     0   0    0  206   57  SYGGVSYHAWLYYYYFH    Y  Y         K    YYS  G  YYYEYGNG Y   Y YEGY GYS
    96   92 L N  S    S+     0   0    1  213   78  WYSSTTHGTSSRSDDWS    N  D         S    SnY  T  SnSKSSTT y   K SvTg tSN
    97   93 L E  S    S-     0   0   48  212   78  ENLHHHREHSTYQEEGG    N  N         T    SaN  H  .aSNSSHY .   S SrHs .SE
    98   94 L D  S    S+     0   0   42  216   73  IYVVVVFSFNSLFFFTI    Y  S         V    WPI  W  sPWIWLaR .   Y wnaR .Wt
    99   95 L P  S    S-     0   0   26  119   74  PPPPPPPPPPPPPPPPP    P  P         P    PPP  P  sPPTPPpP p   P pvrP pPl
   100   96 L P        -     0   0    4  155   90  WLWRWGPYRLWWFLRFF    W  W         H    PTL  S  HTPVPYTP P   V TYTI PPT
   101   97 L T  E     -Y   94   0H  26  200   64  TTTTTTTTTTTTTTTTT    T  T         S    TVT  T  SVTTTTTT T   T TTNT TTH
   102   98 L F  E     -Y   93   0H  26  231   16  FFFFFFFFFFFFFFFFF    F  F         F    FFF  F  FFFFFFFL F   F FFFF FFF
   103   99 L G        -     0   0    3  233   17  GGGGGGGGGGGGGGGGG    G  G         G    GGG  G  GGGGGGSG G   G GGGG SWG
   104  100 L A        -     0   0   81  233   63  GAGGGGGSGAGGSGGGS    G  G         S    QQG  Q  QQQQKQQQ Q   Q QQQQ QPG
   105  101 L G        -     0   0   12  233   14  GGGGGGGGGGGGGGGGG    G  G         G    GGG  G  GGGGGGGG G   G GGGG GRG
   106  102 L T  E     - X   0  90H   0  233   14  TTTTTTTTTTSTTTTTT    T  T         T    TTT  T  TTTTTTTT T   T TTTT TDT
   107  103 L K  E     -tX  10  89H  74  233   53  NKKKKKKKKRKKKKKKK    K  K         K    KKN  K  KKKKKKKK R   K QKKR KQR
   108  104 L L  E     +tX  11  88H   2  232   22  LLLLLLLLLLLLLLLVL    L  L         V    LVV  L  LVLLVLLV V   L MLLL LVV
   109  105 L E  E     -t   12   0H  14  233   69  EDEEEEEEEEEEEEEGE    E  E         E    EEE  E  EEEEEEEE E   E EEED EEE
   110  106 L M  E     -t   13   0H   0  233   29  ILIIIIIIILIIILIII    L  L         P    III  I  IIIIIIII I   I IIII VII
   111  107 L R  E     +t   14   0H 126  233   86  KRKKKKKKKKKKKRKKK    K  K         K    KKK  K  KKKKKKKK T   K KKKK KKK
   112  108 L R        -     0   0   64  233   79  RRRRRRRRRRRRRRRRR    R  R         R    RRR  R  RRRRRRRR R   R RRRR RRL
   113  109 L A        -     0   0   71  221   67  AAAAAAAAAAAAAAAAA    A  A         A    AAT  T  AAAAANNT T   T AAST SAG
   114  110 L D        -     0   0   58  226   72  DDDDDDDDDDDDDDDDD    D  D         D    VVV  V  VVVVVDDV V   V VVDV DVg
   115  111 L A  B     -A  144   0J  19  225   58  AAAAAAAAAAAAAAAAA    A  A         A    AAA  A  AAAAAAAA A   A AAAA AAv
   116  112 L A        -     0   0   40  229   62  AAAAAAAAAAAAAAAAA    A  A         K    AAA  A  AAAAAQQA A   A AAQA EAK
   117  113 L P        -     0   0    9  229    4  PPPPPPPPPPPPPPPPP    P  P         P    PPP  P  PPPPPPPP P   P PPPP PPP
   118  114 L T  E     -B  141   0K  85  232   60  TTTTTTTTTTTTTTTTT    T  T         S    SSS  S  SSSSSSSS S   S SSSS SST
   119  115 L V  E     -B  140   0K   8  233   26  VVVVVVVVVVVVVVVVV    V  V         V    VVV  V  VVVVVVVV V   V VVVV VVV
   120  116 L S  E     -B  139   0K  17  233   67  SSSSSSSSSSSSSSSSS    S  S         F    FFF  F  FFFFFFFF F   F FFFF FFS
   121  117 L I  E     -B  138   0K  22  233   31  IIIIIIIIIIIIIIIII    I  I         I    III  I  IIIIIVLI I   I IILI LII
   122  118 L F  E     -B  137   0K   4  233    7  FFFFFFFFFFFFFFFFF    F  F         F    FFF  F  FFFFFFFF F   F FFFF FFF
   123  119 L P        -     0   0    5  233   25  PPPPPPPPPPPPPPPPP    P  P         P    PPP  P  PPPPPQQP P   P PPQP KPP
   124  120 L P        -     0   0    1  233    9  PPPPPPPPPPPPPPPPP    P  P         P    PPP  P  PPPPPPPP P   P PPPP PPP
   125  121 L S    >>  -     0   0    8  233   10  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSS
   126  122 L S  H 3> S+     0   0   78  233   64  SSSSSSSSSSSSSSSSS    T  T         K    EED  D  EEEEEPPD D   D EELD DEA
   127  123 L E  H 3> S+     0   0   76  233   30  EEEEEEEEEEEEEEEEE    E  E         E    DDE  E  DDDDDDDE E   E DDDE EDD
   128  124 L Q  H <4>S+     0   0    8  233   30  QQQQQQQQQQQQQQQQQ    Q  Q         Q    QQQ  Q  QQQQQEQQ Q   Q QQEQ QQQ
   129  125 L L  H ><5S+     0   0   29  233   22  LLLLLLLLLLLLLLLLL    L  L         L    VVL  L  VVVVVLLL L   L VVLL LVL
   130  126 L T  H 3<5S+     0   0  111  233   69  TTTTTTTTTTTTTTTTT    A  A         E    KKK  K  KKKKKHHK K   K KKHK KKK
   131  127 L S  T 3<5S-     0   0   83  233   68  SSSSSSSSSSSSSSSSS    T  T         T    SSS  S  SSSSSTTS S   S SSTS TSG
   132  128 L G  T < 5S+     0   0   34  233   54  GGGGGGGGGGGGGGGGG    G  G         Q    GGG  G  GGGGGGGG G   G GGGG GGG
   133  129 L G  E   < - C   0 186K  21  216   60  GGGGGGGGGGGGGGGGG    G  G         T    TTT  T  TTTTTSST T   T TTST TTT
   134  130 L A  E     - C   0 185K   0  225   19  AAAAAAAAAAAAAAAAA    A  A         V    AVA  A  AVAAAAAA A   A AAAA VAA
   135  131 L S  E     - C   0 184K   2  226   39  SSSSSSSSSSSSSSSSS    S  S         S    TSS  S  TSTTTSSS S   S TTSS STT
   136  132 L V  E     - C   0 183K   0  226   35  VVVVVVVVVVVVVVVVV    V  V         V    VVV  V  VVVVVVVV V   V VVIV VVV
   137  133 L V  E     -BC 122 182K   0  226   15  VVVVVVVVVVVVVVVVV    V  V         V    VVV  V  VVVVVVVV V   V VVVV VVV
   138  134 L b  E     -BC 121 181K   0  227    9  CCCCCCCCCCCCCCCCC    C  C         C    CCC  C  CCCCCCCC C   C CCCC CCC
   139  135 L F  E     -BC 120 180K   0  228   40  FFFFFFFFFFFFFFFFF    L  L         L    LLL  L  LLLLLLML L   L LLIL LLL
   140  136 L L  E     -BC 119 179K   0  228   49  LLLLLLLLLLLLLLLLL    M  M         L    LLL  L  LLLLLLLL L   L LLLL VLV
   141  137 L N  E     -B  118   0K   2  221   47  NNNNNNNNNNNNNNNNN    N  N         N    NNN  N  NNNNNNNN N   N NNNN NNN
   142  138 L N  E    S+     0   0K  49  225   49  NNNNNNNNNNNNNNNNN    N  N         S    GNN  N  GNGGGGGN N   N GGDN DGG
   143  139 L F  E     - C   0 177K   0  226   41  FFFFFFFFFFFFFFFFF    F  F         F    FFF  F  FFFFFFFF F   F FFFF FFF
   144  140 L Y  B    S+A  115   0J   9  226   46  YYYYYYYYYYYYYYYYY    Y  Y         F    YYY  Y  YYYYYYYY Y   Y YYYY YYY
   145  141 L P  S    S-     0   0   18  226   16  PPPPPPPPPPPPPPPPP    P  P         P    PPP  P  PPPPPPPP P   P PPPP PPP
   146  142 L K  S    S+     0   0   83  227   74  KKKKKKKKKKKKKKKKK    R  R         R    RRR  R  RRRRRRRR R   R RRKR KRG
   147  143 L D        +     0   0  116  228   78  DDDDDDDDDDDDDDDDD    D  D         E    DEE  E  DEDDDDEE E   E DDEE DDG
   148  144 L I        -     0   0   19  228   60  IIIIIIIIIIIIIIIII    I  I         V    AAA  A  AAAAAIVA A   A AAVA IAL
   149  145 L N  E     -E  201   0L  82  228   67  NNNNNNNNNNNNNNNNN    S  S         N    KSK  K  KSKKKNNK K   K KKNK NKN
   150  146 L V  E     -E  200   0L  27  228   12  VVVVVVVVVVVVVVVVV    V  V         V    VVV  V  VVVVVVVV V   V VVVV VVV
   151  147 L K  E     -E  199   0L  53  228   76  KKKKKKKKKKKKKKKKK    K  K         K    KKQ  Q  KKKKKKKQ Q   Q KKKQ KKA
   152  148 L W  E     +E  198   0L   3  228    3  WWWWWWWWWWWWWWWWW    W  W         W    WWW  W  WWWWWWWW W   W WWWW WWW
   153  149 L K  E     +EF 197 158L  76  229   45  KKKKKKKKKKKKKKKKK    K  K         K    KKK  K  KKKKKKKK K   K KKKK KKK
   154  150 L I  E    S-E  196   0L   0  229   68  IIIIIIIIIIIIIIIII    I  I         V    VVV  V  VVVVVVVV V   V VVVV VVK
   155  151 L D  S    S-     0   0   71  229   24  DDDDDDDDDDDDDDDDD    D  D         D    DDD  D  DDDDDDDD D   D DDDD DDD
   156  152 L G  S    S+     0   0   63  230   38  GGGGGGGGGGGGGGGGG    G  G         G    DGN  N  DGDDDGGN N   N DDGN GDT
   157  153 L S  S    S-     0   0   33  229   65  SSSSSSSSSSSSSSSSS    T  T         V    VVA  A  VVVVVEVA A   A VVVA VVT
   158  154 L E  B     -F  153   0L  85  229   76  EEEEEEEEEEEEEEEEE    E  E         V    VLL  L  VLVVVITL L   L VVVL TVT
   159  155 L R        -     0   0   69  231   75  RRRRRRRRRRRRRRRRR    R  R         Q    QKQ  Q  QKQQQQKQ Q   Q QQQQ QQA
   160  156 L Q        +     0   0  133  232   75  QQQQQQQQQQQQQQQQQ    R  R         S    STS  S  STSSSNNS S   S SSNS SST
   161  157 L N  S    S+     0   0  117  233   70  NNNNNNNNNNNNNNNNN    D  D         S    DGG  G  DGDDDTTG G   G DDKG SDT
   162  158 L G  S    S+     0   0   29  233   33  GGGGGGGGGGGGGGGGG    G  G         G    nNN  N  nNnnnGGN N   N nnGN snG
   163  159 L V  E     -D  183   0K  46   68   75  VVVVVVVVVVVVVVVVV    V  V         I    iSS  S  iSiiiIIS S   S iiIS fiV
   164  160 L L  E     -D  182   0K  16  212   47  LLLLLLLLLLLLLLLLL    L  L         L    QQQ  Q  QQQQQQLQ Q   Q QQQQ QQL
   165  161 L N  E     +D  181   0K  52  216   55  NNNNNNNNNNNNNNNNN    D  D         D    DEE  E  DEDDDEEE E   E DDEE NDT
   166  162 L S  E     -D  180   0K  12  224   49  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSS
   167  163 L W  E     -D  179   0K  99  224   71  WWWWWWWWWWWWWWWWW    V  V         V    IVV  V  IVIIIVVV V   V IITV FIT
   168  164 L T        -     0   0   24  225   66  TTTTTTTTTTTTTTTTT    T  T         T    TTT  T  TTTTTTTT T   T TTTT TTK
   169  165 L D        -     0   0   99  226   74  DDDDDDDDDDDDDDDDD    D  D         E    EEE  E  EEEEEEEE E   E EEEE DEQ
   170  166 L Q        -     0   0   18  229   76  QQQQQQQQQQQQQQQQQ    Q  Q         Q    QQQ  Q  QQQQQQQQ Q   Q QQQQ QQQ
   171  167 L D     >  -     0   0   48  229   61  DDDDDDDDDDDDDDDDD    D  D         D    DDD  D  DDDDDDDD D   D DDND DDD
   172  168 L S  T  4 S+     0   0   54  232   60  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSP
   173  169 L K  T  4 S+     0   0  180  232   58  KKKKKKKKKKKKKKKKK    K  K         K    KKK  K  KKKKKKKK K   K KKKK KKS
   174  170 L D  T  4 S-     0   0   57  232   39  DDDDDDDDDDDDDDDDD    D  D         D    DDD  D  DDDDDDDD D   D DDDD KDD
   175  171 L S     <  +     0   0    4  232   57  SSSSSSSSSSSSSSSSS    S  S         S    NNS  S  NNNNNSSS S   S NNSS SNH
   176  172 L T        -     0   0    5  232   72  TTTTTTTTTTTTTTTTT    T  T         T    TTT  T  TTTTTTTT T   T TTTT TTK
   177  173 L Y  E     -C  143   0K   7  226    4  YYYYYYYYYYYYYYYYY    Y  Y         Y    YYY  Y  YYYYYYYY Y   Y YYYY YYY
   178  174 L S  E     -     0   0K   1  226   72  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSS
   179  175 L M  E     -CD 140 167K   0  227   79  MMMMMMMMMMMMMMMMM    M  M         L    LLL  L  LLLLLLLL L   L LLLL LLL
   180  176 L S  E     -CD 139 166K   3  229    6  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSS
   181  177 L S  E     -CD 138 165K   0  229    4  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SSS
   182  178 L T  E     -CD 137 164K   2  230   72  TTTTTTTTTTTTTTTTT    T  T         T    TTT  T  TTTTTTTT T   T TTTT ITT
   183  179 L L  E     -CD 136 163K   0  231    1  LLLLLLLLLLLLLLLLL    L  L         L    LLL  L  LLLLLLLL L   L LLLL LLL
   184  180 L T  E     +C  135   0K  36  231   54  TTTTTTTTTTTTTTTTT    S  S         S    TTT  T  TTTTTTTT T   T TTTT TTT
   185  181 L L  E     -C  134   0K  16  231   14  LLLLLLLLLLLLLLLLL    L  L         L    LLL  L  LLLLLMML L   L LLML LLL
   186  182 L T  E  >  -C  133   0K  81  230   58  TTTTTTTTTTTTTTTTT    T  T         P    SSS  S  SSSSSSPS S   S SSSS PST
   187  183 L K  H >> S+     0   0   66  227   67  KKEKKKKKKKKKKKKKK    K  K         T    SSK  K  SSSSSSSK K   K SSSK SSK
   188  184 L D  H 3> S+     0   0  109  228   63  DDDDDDDDDDDDDDDDD    A  A         S    TTA  A  TTTTTTTA A   A TTTA STA
   189  185 L E  H >4 S+     0   0   53  228   49  EEEEEEEEEEEEEEEEE    D  D         Q    EDD  D  EDEEEEED D   D EEED EEE
   190  186 L Y  H X< S+     0   0    6  226   12  YYYYYYYYYYYYYYYYY    Y  Y         Y    YYY  Y  YYYYYYYY Y   Y YYYY YYY
   191  187 L E  H 3< S+     0   0   90  226   71  EEEEEEEEEEEEEEEEE    E  E         L    QQE  E  QQQQQQLE E   E QQQE QQD
   192  188 L R  T << S+     0   0  160  226   61  RRRRRRRRRRRRRRRRR    S  S         S    RSK  K  RSRRRSSK K   K RRSK SRS
   193  189 L H    <   -     0   0   24  224   55  HHHHHHHHHHHHHHHHH    H  H         H    HHH  H  HHHHHHHH H   H HHHH HHY
   194  190 L N  S    S+     0   0   97  224   71  NNNNNNNNNNNNNNNNN    N  N         N    NNK  K  NNNNNEEK K   K NNEK DNQ
   195  191 L S  E     + G   0 214L  37  224   71  SSSSSSSSSSSSSSSSS    L  L         L    VVV  V  VVVVVNKV V   V VVKV AVT
   196  192 L Y  E     +EG 154 213L   0  224   14  YYYYYYYYYYYYYYYYY    Y  Y         Y    YYY  Y  YYYYYYYY Y   Y YYFY YYY
   197  193 L T  E     -EG 153 212L   3  223   48  TTTTTTTTTTTTTTTTT    T  T         S    AAA  A  AAAAASSA A   A AASA TAT
   198  194 L b  E     -EG 152 211L   1  223    0  CCCCCCCCCCCCCCCCC    C  C         C    CCC  C  CCCCCCCC C   C CCCC CCC
   199  195 L E  E     -EG 151 210L  34  212   62  EEEEEEEEEEEEEEEEE    E  E         E    EEE  E  EEEEEEEE E   E EEEE EEE
   200  196 L A  E     -EG 150 209L   1  212   22  AAAAAAAAAAAAAAAAA    V  V         V    VVV  V  VVVVVVVV V   V VVVV VVV
   201  197 L T  E     +E  149   0L  36  212   35  TTTTTTTTTTTTTTTTT    V  V         T    TTT  T  TTTTTTTT T   T TTTT STT
   202  198 L H  E >   - G   0 205L  18  212   27  HHHHHHHHHHHHHHHHH    H  H         H    HHH  H  HHHHHHHH H   H HHHH HHH
   203  199 L K  T 3  S+     0   0  145  211   56  KKKKKKKKKKKKKKKKK    K  K         K    QQQ  Q  QQQQQKKQ Q   Q QQKQ KQE
   204  200 L T  T 3  S+     0   0   55  211   41  TTTTTTTTTTTTTTTTT    T  T         T    SGG  G  SGSSSSSG G   G SSSG SST
   205  201 L S  E <   -G  202   0L  45  187   83  SSSSSSSSSSSSSSSSS    S  S         L    LLL  L  LLLLLLLL L   L LLLL LL 
   206  202 L T  E    S+     0   0L 140  187   30  TTTTTTTTTTTTTTTTT    S  S         A    TSS  S  TSTTTPSS S   S TTAS TT 
   207  203 L S  E    S-     0   0L  82   90   51  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS TS 
   208  204 L P  E     -     0   0L  43   67   33  PPPPPPPPPPPPPPPPP    P  P         P    PPP  P  PPPPPTPP P   P PPTP TP 
   209  205 L I  E     -G  200   0L  46   67   29  IIIIIIIIIIIIIIIII    V  V         L    LVV  V  LVLLLLLV V   V LLLV LL 
   210  206 L V  E     +G  199   0L  70   63   53  VVVVVVVVVVVVVVVVV    V  V         V    TTT  T  TTTTTIVT T   T TTVT VT 
   211  207 L K  E     +G  198   0L  85   63   26  KKKKKKKKKKKKKKKKK    K  K         K    KKK  K  KKKKKKKK K   K KKKK KK 
   212  208 L S  E     -G  197   0L  67   63   28  SSSSSSSSSSSSSSSSS    S  S         S    SSS  S  SSSSSSSS S   S SSSS SS 
   213  209 L F  E     -G  196   0L  30   63   18  FFFFFFFFFFFFFFFFF    F  F         F    FFF  F  FFFFFFFF F   F FFFF FF 
   214  210 L N  E      G  195   0L  99   63   62  NNNNNNNNNNNNNNNNN    N  N         S    RNN  N  RNRRRQQN N   N RRNN SR 
   215  211 L R              0   0   82   54   19  RRRRRRRRRRRRRRRRR    R  R         R    KRR  R  KRKKKRRR R   R KKRR KK 
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  213   30                   EQEE QE EQEEEEEQE QQEE   EQ QE        E QEQ Q    Q   
   218    2 H V        +     0   0   30  215   38                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV L    V   
   219    3 H K  E     -A  241   0A 143  215   52                   KQHN QQ QQQQQQQQK QQQQ   QQ QQ        Q QKQ Q    Q   
   220    4 H L  E     -A  240   0A  11  231    3                   LLLL LL ILLLLLLLL LLLL   LL LL        L LLL L    L   
   221    5 H Q  E     -A  239   0A 120  231   74                   VMQV QV LQVVVVQQV QQQL   QL KV        H KEK Q    Q   
   222    6 H E  E     -A  238   0A   2  232   34                   EEQE QE EQEEEEQEE EQQQ   QQ QE        Q QEQ E    E   
   223    7 H S  E     +A  237   0A  48  232   22                   SSSS ST TSSSTSSSS SSSS   SS SS        S SSS A    S   
   224    8 H G        -     0   0   35  232   24                   GGGG GG GGGGGGGGG GGGG   GG GG        G GGG G    G   
   225    9 H P        -     0   0   50  232   51                   GPPG AG GAGGGGAPG PAAT   PP AG        P AGA P    P   
   226   10 H A  S    S+     0   0   30  232   54                   GGEG EG GEGGGGEGG GEEE   EE ED        E EGE R    G   
   227   11 H V  E     -d  334   0B  33  233   26                   LLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   228   12 H I  E     -d  335   0B   9  233   54                   VVVV AV VAVVVVVVV LVVV   VV VV        V VVV V    V   
   229   13 H K        -     0   0  104  233   49                   QQKQ RQ KKQQQKRKQ KKRR   KK KK        E RQK K    K   
   230   14 H P  S    S+     0   0   56  233   12                   PPPP PP PPPPPPPPP PPPP   TP PP        A PPP P    P   
   231   15 H S  S    S+     0   0   90  233   20                   GSGG GG GGGGKGGSG SGGG   GG GG        G GGG S    S   
   232   16 H Q  S    S-     0   0   76  233   60                   GEAG AR GSRRGGAEG ESSA   AA AG        A AGA E    E   
   233   17 H S        -     0   0   51  232   21                   STSS SS SSSSSSSTS TSSS   SS SS        S SSS T    T   
   234   18 H L  E     - B   0 300A   1  232   46                   LLVL VL LVMLLRVLL LVVV   VV VL        V VMV L    L   
   235   19 H S  E     - B   0 299A  64  233   50                   KSKR RK RKKKKKKSS SKKK   KK KR        K KKK S    S   
   236   20 H L  E     - B   0 298A   1  233   15                   LLML LL LILLLLLLL LILL   MI IL        L LLL L    L   
   237   21 H T  E     -AB 223 297A  29  233   34                   SISS SS SSSSSSSTS TSSS   SS SS        S SSS S    T   
   238   22 H c  E     -AB 222 296A   0  234    0                   CCCC CC CCCCCCCCC CCCC   CC CC        C CCC C    C   
   239   23 H I  E     -AB 221 295A  54  233   74                   ATKA KV AKAAAATTA AKKT   KR KV        K KVK T    .   
   240   24 H V  E     -A  220   0A   4  233   54                   AVTA AA TAAAAAAVT VATA   AA AA        A AAA V    .   
   241   25 H S  E     +A  219   0A  60  234    9                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    A   
   242   26 H G  S    S+     0   0   54  228    4                   GGGG GG GGGGGGGG. GGGG   GG GG        G GGG G    V   
   243   27 H F  S    S-     0   0   37  199   30                   FFYF YF FYFFFFFG. GYYF   YY YF        Y YFY G    S   
   244   28 H S    >   -     0   0   44  201   49                   TSTT TT NTTTSTNSG STTS   TA TT        T ITT S    G   
   245   29 H I  T 3  S+     0   0    2  232   27                   FLFF FF FFFFFFIIF IFFI   FF FF        F FFF M    G   
   246   30 H T  T 3   +     0   0   59  232   53                   STTT TS NTSSNSKST STTK   SS TS        G TSN S    S   
   247   31 H R  S X  S-     0   0  145  234   77                   SSED GS DSNDTDDGF GNSD   DK DS        D SNS G    I   
   248   32 H T  T 3  S+     0   0   72   68   71                   .... .. ........I ...S   .. ..        . ... S    S   
   249   33 H N  T 3  S+     0   0   16   73   70                   .... .. ........D G..L   .. ..        . ... S    S   
   250   34 H Y  E <   -E  317   0C  23  234   47                   YYYY YY YYYYNYSYY YYYL   YS YY        Y YSY F    Y   
   251   35 H d  E     -EF 316 270C   0  224   90                   TNTY GW FDGNAGLYY GDY.   YW YY        Y WWI Y    Y   
   252   35AH W  E     -EF 315 269C   1  222   46                   MVIM VM MVMMMMMWM WII.   MM IM        V IMM W    W   
   253   35BH H  E     -EF 314 268C   0  231   72                   SHHS SY NSAANHHSS GHNH   HN ND        H HNH G    S   
   254   36 H W  E     +EF 313 267C   1  233    1                   WWWW WW WWWWWWWWW WWWW   WW WW        W WWW W    W   
   255   37 H I  E     -EF 312 265C   0  233   13                   IVMV VI VIVVVVVIF IIVV   VV VV        V VVV I    I   
   256   38 H R  E     -EF 311 264C  10  234   15                   RRKR KR RKRRRRKRR RKKM   KK KR        K KRK R    R   
   257   39 H Q  E     -EF 310 263C  22  233    3                   QQQQ QQ QQQQQQQQQ QQQQ   QR QQ        Q QQQ Q    Q   
   258   40 H A    >   -     0   0   14  233   59                   TPSP RA ATAAAARPP PQRR   SR RA        S RSR A    T   
   259   41 H P  T 3  S+     0   0   99  234   20                   PPHP TP PTPPPPPAP PPPP   HP PP        H SPP P    P   
   260   42 H G  T 3  S+     0   0   94  234   11                   EGGG GG GGKKGEEGG GGGE   GG GG        G GEG G    G   
   261   43 H K  S <  S-     0   0  140  234   34                   KKKK QK KQKKKKQKK KNQQ   KK QK        K QKQ R    K   
   262   44 H G        -     0   0   20  234   23                   RGSA GG GGGGGGGGA GGGG   SG GG        S GGG G    R   
   263   45 H L  E     -F  257   0C  10  234    6                   LLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   264   46 H E  E     -F  256   0C  79  234   10                   EEEE EE EEEEEEEEE EEEE   EE EQ        D EEE E    E   
   265   47 H W  E     +F  255   0C  13  234    9                   WWWW WW WYWWWWWWW WWWW   WW WW        W WWW W    W   
   266   48 H M  E     -     0   0C   3  234   31                   VMIL VV VIVVVVIIL IIII   II IL        I IVI I    I   
   267   49 H G  E     -FG 254 277C   0  234   42                   AGGG GS VGAAAAGGG GGGG   GG GS        G AAG G    G   
   268   50 H R  E     -FG 253 276C  10  234   92                   YVGF ES QYYTRYWRL SWHW   YR KE        N RQY S    N   
   269   51 H I  E     -FG 252 275C   3  234   20                   IMII II IIIIIIIII IIII   II II        I IIF I    F   
   270   52 H d  E >   -F  251   0C   0  234   84                   SWFR YN RNSIRNDYR YYYD   YF GS        Y YRS D    H   
   271   53 H Y  T 3  S+     0   0   47  234   85                   Dspn PT nTYYsSPTn PPPP   PP PS        P Plp Y    Y   
   272   54 H E  T 3  S-     0   0   63  232   61                   g.nt gd ngddageSn tgge   ng gs        n gan R    S   
   273   55 H G  S <  S+     0   0   25  185   36                   ggG. gg Yggs.tgGy gggg   gg gs        g g.D G    G   
   274   56 H S        -     0   0   42  200   70                   SND. NS GGYR.TEST NNYE   GD SS        G S.D N    S   
   275   57 H I  E     -G  269   0C  71  215   54                   TTTT TT TITTTITTM TTTT   NT TT        N TTT T    T   
   276   58 H Y  E     -G  268   0C  70  222   77                   YDTE YY YYYYYYKNE YKEK   GH YY        D YHK Y    N   
   277   59 H Y  E     -G  267   0C  41  227   14                   YYYY YY YYYYYYYYY YYYY   YY YY        Y YYC Y    D   
   278   60 H S    >>  -     0   0   11  231   57                   PNNS SP ATRRAAANS NNNV   NS NA        N NAN N    N   
   279   61 H P  T 34 S+     0   0   76  234   56                   DSQA ED EEDDDDPPA PQEP   QG ED        Q EEE P    P   
   280   62 H S  T 34 S+     0   0   79  234   55                   TAKS KS SKPSSTKSS SKKK   KK KA        K KSK S    S   
   281   63 H I  T X4 S+     0   0    4  234   43                   LLFV FV LFVVVVFLL LFFF   FF FV        F FVF L    L   
   282   64 H K  G >< S+     0   0  133  234   33                   KKKK KK EKKKKKQKK KNKQ   KQ KK        K KKK K    K   
   283   65 H S  G 3  S+     0   0  116  234   31                   GSVG GG GGGGDGDSG SGGD   GG GG        G GGG S    S   
   284   66 H R  G <  S+     0   0   51  234   16                   RRRR KR RKRRRRKRR RKKK   KK KR        K KRK R    R   
   285   67 H S  E <   -C  300   0A  11  234   54                   FLAF AF VAFFFFAVF AAAA   AA AF        A AFA V    L   
   286   68 H T  E     -C  299   0A  67  220   24                   TSTT TT TTTTTTTTT TTTT   TK TT        T TTT T    T   
   287   69 H I  E     +C  298   0A   3  220   25                   VILI LI ILIIIIIMI ILLL   LL LI        L LIL I    M   
   288   70 H S  E     -C  297   0A  56  234   45                   SSTS TS STSSSSTSS STTT   TT TS        T TST S    S   
   289   71 H R  E     -C  296   0A  71  234   70                   RRVR TR RVRRRRAVR TASA   VA AR        V ARA V    A   
   290   72 H D  E >>> -C  295   0A  55  234   18                   DDGD DD DDDDDDDDD DDDA   DD DD        D DDD D    D   
   291   73 H T  T 345S+     0   0   78  233   60                   NTRN KN DKNNDNTTN TKTT   KK KN        K KDK T    T   
   292   74 H S  T 345S+     0   0  105  233   44                   ASSS SA SSAASASSS SSSS   SS SA        A SSS S    S   
   293   75 H L  T <45S-     0   0  103  234   70                   KKSQ SE KSKKQKSKQ KSSS   SS SK        S SKS R    K   
   294   76 H N  T  <5 +     0   0   29  234   47                   NNSS SN SSNSSNNNS NSSN   SV SN        S SSS N    N   
   295   77 H K  E   < -BC 239 290A  51  234   64                   TQTI TT STTTMTTQI QTTT   TT TT        T TRT Q    Q   
   296   78 H F  E     -BC 238 289A   1  234   61                   LVAL AV VALLLLAFV FAAA   AA AL        A ALA F    L   
   297   79 H F  E     -BC 237 288A  50  234   27                   YFYY YY YFYYYFYSY SYYY   YF YY        Y FYY S    S   
   298   80 H I  E     -BC 236 287A   4  234    5                   LLML ML LMLLLLLLL LMML   ML ML        M MLM L    L   
   299   81 H Q  E     -BC 235 286A  73  234   36                   QKDQ HQ QQQQQQQKH KQQQ   EQ QQ        E QQE N    R   
   300   82 H L  E     -BC 234 285A   3  234   23                   MMLM LM VLMMMMLLM LLLL   LL LM        L LML L    L   
   301   82AH I        +     0   0   70  234   62                   SNRN SN TSDDNTSSN NSRS   RT SN        R SSS R    R   
   302   82BH S  S    S-     0   0   59  234   35                   SSSA SS SSSSNSSST SSSS   SS SS        S SSS S    S   
   303   82CH V        -     0   0    0  234   13                   LLLL LL FLLLLLLVL VLLL   LL LL        L LLL V    V   
   304   83 H T    >   -     0   0   65  234   62                   KQTR TR RTRRKRTTT TTTT   TT TR        T KRT T    T   
   305   84 H N  G >  S+     0   0  120  234   65                   SSSA SS PPSSTSSAA ASSS   SS SA        S SAS A    A   
   306   85 H E  G 3  S+     0   0  160  234   25                   EEEE EE EEEEEEEAE AEEG   EE EE        E EEE A    A   
   307   86 H D  G <  S+     0   0    0  234    1                   DDDD DD DDDDDDDDD DDND   DD DD        D DDD D    D   
   308   87 H T    <   +     0   0   30  234   32                   TASS ST TTTTTTTTS TSST   SS ST        S STS T    T   
   309   88 H A  E    S- H   0 333C   3  234    4                   ATAA AA AAAAAAAAA AAAA   AA AA        A AGA A    A   
   310   89 H M  E     -EH 257 332C  43  234   58                   MTVT VT IVTTMMIVT VVIT   VV VV        V VIV V    V   
   311   90 H Y  E     -EH 256 331C   2  234    0                   YYYY YY YYYYYYYYY YYYY   YY YY        Y YYY Y    Y   
   312   91 H Y  E     -E  255   0C   1  234    3                   YYYY FY YYYYYYYYY FFFY   YF FY        Y FYY F    Y   
   313   92 H c  E     +E  254   0C   0  234    1                   CCCC CC CCCCCCCCC CCCC   CC CC        C CCC C    C   
   314   93 H S  E     -EI 253 327C   0  234   30                   AAVA AA TTTAVAAAA AAAL   AA AA        A ATA A    A   
   315   94 H R  E     -EI 252 326C  20  233   44                   .RRR RK RRTTKRRRR RRRF   RR RR        R YNR S    R   
   316   95 H E  E     -EI 251 324C   0  233   77                   .END SG SDDNEENGV DDTY   GD SG        G GAG P    V   
   317   96 H N  E  >> -E  250   0C   6  233   90                   .GYR SG RGRRGLLRD HYGG   YS GP        N YMY G    A   
   318   97 H H  T  45S+     0   0    0  233   93                   .YGR YE PTYWQWLFY SFGY   ID YW        V DDY G    K   
   319   98 H M  T  45S+     0   0   73  234   93                   IPSS YY YRYLLLYTG DDYD   SY DQ        I AYV L    L   
   320   99 H Y  T  45S+     0   0  159  234   92                   NYSS SY YIGLGRGYT YGDD   YG YC        Y LWF I    F   
   321  100 H E  T  <5 -     0   0   54  234   90                   FYYy Yg gMYLPRGFN hYGg   yD DD        y YGD s    g   
   322  100AH T      < +     0   0    0  139   91                   Y.Gt Dy n.NHY...Y d..d   h. ..        q ... g    y   
   323  100BH Y  S    S-     0   0   10  161   90                   G.YS LP Y.WYY.Y.D A.YY   YY WN        Y ... Y    G   
   324  100CH F  E     +I  316   0C   0  185   48                   MFFF FF F.FFFIY.Y F.FF   FF FF        F ... F    M   
   325  101 H D  E     +     0   0C  42  205   40                   DNDA AD DDTDDDDD. DDDD   DD AD        D ... D    D   
   326  102 H V  E     -I  315   0C  35  212   66                   SYVY YY YAYYYYYY. FYYY   YD YY        N ..Y Y    V   
   327  103 H W  E     -I  314   0C  28  221    8                   WWWW WW WWWWWWWWW WWWW   WW WW        W W.W W    W   
   328  104 H G        -     0   0    3  229    7                   GGGG GG GGGGGGGGG GGGG   GG GG        G G.G G    G   
   329  105 H Q        -     0   0  100  223   52                   QQAQ QQ QQQQQQQQQ QQQQ   QQ QQ        Q QQQ Q    Q   
   330  106 H G        -     0   0    3  228    7                   GGGG GG GGGGGGGGG GGGG   GG GG        G GGG G    G   
   331  107 H T  E     -H  311   0C  27  233   39                   TVTT TV VTTVTTTTT LVTT   TA TT        T TTT T    T   
   332  108 H T  E     -H  310   0C  48  234   79                   SMTL LM MSLMTTTLT RMTT   TT LL        T PST L    T   
   333  109 H V  E     -H  309   0C   0  234   19                   VVVV VV VVVVIIIVL VVII   IV VV        I IVI V    V   
   334  110 H T  E     -d  227   0B  16  234   41                   TTTT TT TTSTTTTTT TTTT   TT TT        T TTT T    I   
   335  111 H V  E     +d  228   0B   2  234    9                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   336  112 H S        -     0   0   18  234   31                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    S   
   337  113 H S  S    S+     0   0   99  234   19                   SSSA AS SSSSSSSSS SSSS   SS AS        S SSS S    S   
   338  114 H A  S    S-     0   0   31  234   51                   AAAA AA AAAAAAAAA AAAA   AA AA        A AAA A    A   
   339  115 H K        -     0   0  143  234   66                   KEKK KE EEEEKKKSK SEKK   KK KS        K KKK S    S   
   340  116 H T        -     0   0   44  234   72                   TTTT TT TTTTTTTTT TTTT   TT TT        T TTT T    T   
   341  117 H T  B     -J  370   0D  35  234   73                   TTTT TT TTTTTTTKT KTTT   TT TT        T TTT K    K   
   342  118 H P        -     0   0   60  234   66                   PAPP PA AAAAAPAGA GAAP   AP AA        A AAA G    G   
   343  119 H P        -     0   0   13  234   17                   PPPP PP PPPPPPPPP PPPP   PP PP        P PPP P    P   
   344  120 H S  E     -K  367   0E  51  234   57                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    S   
   345  121 H V  E     -K  366   0E   6  234   25                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   346  122 H Y  E     -K  365   0E  27  234   14                   YYYY YY YYYYYYYFY FYYY   YY YF        Y YYY F    F   
   347  123 H P  E     -K  364   0E  15  234   27                   PPPP PP PPPPPPPPP PPPP   PP PP        P PPP P    P   
   348  124 H L  E     +K  363   0E   4  234   22                   MLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   349  125 H A        -     0   0   10  234   68                   AAAA AA AAAAAAAAA AAAA   AA AA        A AAA A    A   
   350  126 H P        -     0   0   24  234   77                   PPPP PP PPPPPPPPP PPPP   PP PP        P PPP P    P   
   351  127 H G  S    S-     0   0   16  234   65                   GGGG GG GGGGVGVSV SGVG   VG VS        V VVV S    S   
   352  128 H S  S    S+     0   0   99  234   67                   STSS ST TTTTCCCSC STCC   CC CC        C CCC S    S   
   353  129 H A        +     0   0   52  234   79                   AAAA AA AAAAGGGKG RAGG   GG GG        G GGG K    K   
   354  130 H A        +     0   0   70  145   76                   ALAA AL LLLLDDDSD SLDD   DD GS        G DDD S    S   
   355  133 H Q        +     0   0  178  219   82                   QKQQ QK KKKKTTTTT TKTT   TT TT        T TTT T    T   
   356  134 H T    >   -     0   0   64  231   47                   TSTT TS SSSSTTTST SSTT   TT TS        T TTT S    S   
   357  135 H N  T 3  S-     0   0  146  232   60                   NNNN NN NNNNGGGGG ENGG   GG GG        G GGG G    G   
   358  136 H S  T 3  S+     0   0   63  232   58                   SSSS SS SSSSSSSGS SSSS   SS SS        S SSS G    G   
   359  137 H M  E <   - L   0 408E  83  232   79                   MMMM MM MMMMSSSTS TMSS   SS ST        S SSS T    T   
   360  138 H V  E     - L   0 407E  15  233   38                   VVVV VV VVVVVVVAV AVVV   VV VV        V VVV A    A   
   361  139 H T  E     + L   0 406E  15  234   68                   TTTT TT TTTTTTTAT ATTT   TT TA        T TTT A    A   
   362  140 H L  E     + L   0 405E   0  234   26                   LLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   363  141 H G  E     -KL 348 404E   0  234   28                   GGGG GG GGGGGGGGG GGGG   GG GA        G GGG G    G   
   364  142 H e  E     -KL 347 403E   1  234    1                   CCCC CC CCCCCCCCC CCCC   CC CC        C CCC C    C   
   365  143 H L  E     -KL 346 402E   2  234   12                   LLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   366  144 H V  E     -KL 345 401E   1  234   46                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   367  145 H K  E     -KL 344 400E  38  231   68                   KKKK KK KKKKKKKKK KKKK   KK KS        K KKK K    K   
   368  146 H G  E    S+     0   0E  19  234   40                   GGGG GG GGGGGGGDG DGGG   GG GG        G GGG D    D   
   369  147 H Y  E     - L   0 399E   0  234    5                   YYYY YY YYYYYYYYY YYYY   YY YY        Y YYY Y    Y   
   370  148 H F  B     +J  341   0D   3  234   40                   FFFF FF FFFFFFFFF FFFF   FF FF        F FFF F    F   
   371  149 H P  S    S-     0   0    0  234   15                   PPPP PP PPPPPPPPP PPPP   PP PP        P PPP P    P   
   372  150 H E  S    S+     0   0   53  231   47                   EEEE EE EEEEEEEEE EEEE   EE EE        E EEE E    E   
   373  151 H P        +     0   0   59  232   52                   PPPP PP PPPPPSPPP PPPS   PS PP        P PPP P    P   
   374  152 H V        -     0   0   20  233   39                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   375  153 H T  E     +N  422   0F  83  234   67                   ATTT TT TTTTTTTTT TTTT   TT TT        T TTT T    T   
   376  154 H V  E     +N  421   0F  23  234   44                   VVVV VV VVVVLVLVL VVLV   LV LV        L LLL V    V   
   377  156 H T  E     -N  420   0F  48  234   51                   TTTT TT TTTTTTTST STTT   TT TS        T TTT S    S   
   378  157 H W  E > >S-NO 419 383F   2  234    0                   WWWW WW WWWWWWWWW WWWW   WW WW        W WWW W    W   
   379  162 H N  G > 5S-     0   0   38  234   61                   NNNN NN NNNNNNNNN NNNN   NN NN        N NNN N    N   
   380  163 H S  G 3 5S-     0   0   91  234   63                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    S   
   381  164 H G  G < 5S+     0   0   39  234   50                   GGGG GG GGGGGGGGG GGGG   GG GG        G GGG G    G   
   382  165 H S  T < 5 +     0   0   93  234   53                   SASS SA AAAASSPAS SASS   SS SS        S SSS A    A   
   383  166 H L  B   < +O  378   0F  43  228   74                   LLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   384  167 H S        +     0   0   88  231   64                   SSSS SS SSSSSSSTS TSSS   SS ST        S SSS T    T   
   385  168 H S  S    S+     0   0  101  231   73                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    S   
   386  169 H G  S    S+     0   0   32  226   40                   GGGG GG GGGGGSGGG GGGS   GS GG        G GGG G    G   
   387  171 H V        +     0   0   48  232   57                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   388  172 H H  E     -M  404   0E  17  233   79                   HHHH HH HHHHHHHHH HHHH   HH HH        H HHH H    H   
   389  173 H T  E     -M  403   0E  69  233   67                   TTTT TT TTTTTTTTT TTTT   TT TT        T TTT T    T   
   390  174 H F  E     -M  402   0E   1  233   11                   FFFF FF FFFFFFFFF FFFF   FF FF        F FFF F    F   
   391  175 H P  E     -     0   0E  65  232   17                   PPPP PP PPPPPPPPP PPPP   PP PP        P PPP P    P   
   392  176 H A  E     -     0   0E  19  233   53                   AAAA AA AAAAAAAAA AAAA   AA AS        A VAA A    A   
   393  177 H V  E     -M  400   0E  42  233   54                   VVVV VV VVVVVLVVV VVVL   VL LV        L VVV V    V   
   394  178 H L  E     -M  399   0E  77  233   51                   LLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   395  179 H Q  S    S-     0   0   83  233   65                   QQQQ QQ QQQQQQQQQ QQQQ   QQ QQ        Q QQQ Q    Q   
   396  180 H S  S    S-     0   0  116  233   55                   SSSS SS SSSSSSSsS sSSS   SS Ss        S SSS s    s   
   397  183 H D  S    S+     0   0   90  226   21                   DGDD DG GGGGDGDgD gGDG   DG Gg        G DDD g    g   
   398  184 H L        -     0   0   53  224   74                   LLLL LL LLLLLLLLL LLLL   LL LL        L LLL L    L   
   399  185 H Y  E     -LM 369 394E  36  230    2                   YYYY YY YYYYYYYYY YYYY   YY YY        Y YYY Y    Y   
   400  186 H T  E     +LM 367 393E   5  228   48                   TTTT TT TTTTTTTST STTT   TT TS        T TTT S    S   
   401  187 H L  E     -L  366   0E  11  225   53                   LLLL LL LLLLLMLLL LLLM   LM LL        L LLL L    L   
   402  188 H S  E     -LM 365 390E   5  225   25                   STSS ST TTTTSSSSS STSS   SS SS        S SSS S    S   
   403  189 H S  E     -LM 364 389E   2  225    1                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    S   
   404  190 H S  E     -LM 363 388E   0  225   78                   SSSS SS SSSSSSSVS VSSS   SS SM        S SSS V    V   
   405  191 H V  E     -L  362   0E   0  225   27                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   406  192 H T  E     +L  361   0E  48  225   41                   TTTT TT TTTTTTTTT TTTT   TT TT        T TTT T    T   
   407  193 H V  E     -L  360   0E  14  224   29                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   408  194 H P  E  >  -L  359   0E  56  223   43                   PPPP PP PPPPTPTPT PPTP   TP TP        T TTT P    P   
   409  195 H S  T  4 S+     0   0   49  222   51                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    S   
   410  196 H S  T  4 S+     0   0   66  222   64                   SSSS SS SSSSSSSSS SSSS   SS NS        N SSS S    S   
   411  198 H P  T  > S+     0   0   31  222   70                   TTTT TT TTTTTTTST STTT   TT TR        T TTT S    S   
   412  199 H R  T  < S+     0   0   16  222   99                   WWWW WW WWWWWWWLW LWWW   WW WW        W WWW L    L   
   413  200 H P  T  4 S+     0   0   80  223   71                   PSPP PP PSPSPPPGP GSPP   PP PP        P PPP G    G   
   414  202 H S  T  4 S+     0   0  111  221   68                   SSSS SS SSSSSSSTS TSSS   SS SS        S SSS T    T   
   415  203 H E  S  < S-     0   0  128  221   75                   EQEQ EQ QQQQQQQQQ QQQQ   QQ QE        Q QQQ Q    Q   
   416  204 H T        -     0   0   83  221   71                   TATT TT TATASTSTS TAST   ST TT        T SSS T    T   
   417  205 H V        +     0   0    4  217   60                   VVVV VV VVVVIVIYI YVIV   IV IF        I III Y    Y   
   418  206 H T  E     - P   0 433F  23  217   76                   TTTT TT TTTTTTTIT VTTT   TT TT        T TTT I    I   
   419  208 H e  E     -NP 378 432F   0  220    1                   CCCC CC CCCCCCCCC CCCC   CC CC        C CCC C    C   
   420  209 H N  E     -NP 377 431F   4  220   59                   NNNN NN NNNNNSNNN NNNS   NS NN        N NNN N    N   
   421  210 H V  E     -NP 376 430F   1  220   24                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V    V   
   422  211 H A  E     -NP 375 429F  14  220   74                   AAAA AA AAAAAAANA NAAA   AA AA        A AAA N    N   
   423  212 H H  E > > - P   0 428F   1  220   17                   HHHH HH HHHHHHHHH HHHH   HH HH        H HHH H    H   
   424  213 H P  G > 5S+     0   0   77  209   81                   PPPP PP PPPPPPPKP KPPP   PP PP        P PPP K    K   
   425  214 H A  G 3 5S+     0   0   40  203   65                   AAAA AA AAAAAAAPA PAAA   AA AA        A AAA P    P   
   426  215 H S  G < 5S-     0   0   32  202   63                   SSSS SS SSSSSSSSS SSSS   SS SS        S SSS S    S   
   427  216 H S  T < 5 +     0   0  111  199   72                   SSSS SS SSSSSSSNS NSSS   SS SK        S SSS N    N   
   428  217 H T  E   < +P  423   0F  35  196   63                   TTTT TT TTTTTTTTT TTTT   TT TT        T TTT T    T   
   429  218 H K  E     +P  422   0F 135  196   50                   KKKK KK KKKKKTKKK KKKT   KT KK        K KKK K    R   
   430  219 H V  E     -P  421   0F  38  140   32                   VVVV VV VVVVVVVVV VVVV   VV VV        V VVV V        
   431  220 H D  E     -P  420   0F  97  140   36                   DDDD DD DDDDDDDDD DDDD   DD DD        D DDD D        
   432  221 H K  E     -P  419   0F  51  127   45                   KKKK KK KKKKKKKKK KKKK   KK KK        K KKK K        
   433  222 H K  E     -P  418   0F 121  127   48                   KKKK KK KKKKKKKKK RKKK   KK KP        K KKK R        
   434  223 H I        -     0   0    4  123   30                   IIII II IIIIILIVI VIIL   IL IV        I III V        
   435  224 H V        -     0   0   79  112   59                   VVVV VV VVVVEEEEE EVEE   EE EP        E EEE E        
   436  225 H P              0   0   73  103   61                   PPPP PP PPPPPPPPP IPPP   PP PK        P PPP P        
   437  226 H R              0   0  167   89   21                   RRRR RR RRRRR RKR KRR    R  RR        R RRR K        
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1    1 L D              0   0  100   77   31   E DD  E   D  D D D          DD                                       
     2    2 L I        -     0   0    0   88   32   I VI  I   V  V I I          II                                       
     3    3 L V        -     0   0   88   98   48   V VV  V   V  V Q E          EQ    V                                  
     4    4 L M  E     -Q   25   0G  12  101   21   L LM  L   L  L M M          VM    V                                  
     5    5 L T  E     -Q   24   0G  80  101   14   T TT  T   T  T T T          TI    T                                  
     6    6 L Q  E     -Q   23   0G  19  101    5   Q QQ  Q   Q  Q Q Q          QQ    Q                                  
     7    7 L S  E    S+Q   22   0G  57  101   57   S TT  S   T  T S H          SS    S                                  
     8    8 L P        -     0   0   47  148    6   P PP  P   P  P P L          PP    P                                  
     9    9 L A  S    S-     0   0   79  156   68   G LP  A   L  L S L          YS    S                                  
    10   10 L S  E     -t  107   0H  78  168   57   T SS  T   S  S S S          SS    S                                  
    11   11 L L  E     -t  108   0H  34  204   48   L LL  L   L  L L L          LL    L                                  
    12   12 L V  E     +t  109   0H  86  214   38   S SS  S   S  S F P          AS    S                                  
    13   13 L V  E     -t  110   0H  17  216   57   F VV  L   V  V A V          VA    A                                  
    14   14 L S  E >   -t  111   0H  46  224   63   S IS  S   I  I S P          SS    S                                  
    15   15 L L  T 3  S+     0   0   79  225   67   P PP  P   P  P V P          LV    L                                  
    16   16 L G  T 3  S+     0   0   39  233    6   G GR  G   G  G G G          GG    G                                  
    17   17 L Q    <   -     0   0   97  233   51   E EE  E   E  E D E          ED    D                                  
    18   18 L R        -     0   0  152  233   63   R TT  R   T  T R P          TR    R                                  
    19   19 L A  E     - R   0  79G   2  233   43   A VA  A   V  V V A          VV    V                                  
    20   20 L T  E     - R   0  78G  66  233   58   T TS  T   T  S T S          TT    S                                  
    21   21 L I  E     - R   0  77G   0  233   23   L II  L   I  I I I          LI    I                                  
    22   22 L S  E     -QR   7  76G  36  233   53   S SS  S   S  S T S          ST    T                                  
    23   23 L a  E     -QR   6  75G   0  233    0   C CC  C   C  C C C          CC    C                                  
    24   24 L R  E     -QR   5  74G 153  233   76   R KK  R   K  K R R          RR    Q                                  
    25   25 L A  E     -Q    4   0G   6  233   70   A SA  A   S  S A S          AA    A                                  
    26   26 L S  S    S+     0   0   63  233   52   S TS  S   T  T S S          SS    S                                  
    27   27 L E  S    S-     0   0  105  233   74   Q QQ  Q   Q  Q Q Q          QQ    Q                                  
    28   27AL S        -     0   0   29  233   75   T ss  I   s  s D s          sG    S                                  
    29   27BL V        +     0   0    0   70   75   . kl  .   k  k I l          s.    .                                  
    30   27CL D  E     +Z   35   0I  45   97   81   . YH  .   Y  Y E H          N.    .                                  
    31   27DL S  E >  S+Z   34   0I  15  133   82   . SS  .   S  S S S          Q.    .                                  
    32   28 L Y  T 3  S-     0   0  173  140   87   . DD  .   D  N I D          S.    .                                  
    33   29 L G  T 3  S+     0   0   81  224   59   v GG  v   G  G S G          II    I                                  
    34   30 L K  E <  S-Z   31   0I 112  182   77   s KN  s   K  R . N          SS    D                                  
    35   31 L S  E     -Z   30   0I   7  205   76   S TT  A   T  T . T          NS    T                                  
    36   32 L F        +     0   0    5  218   67   H YY  Y   Y  Y . Y          WC    K                                  
    37   33 L M  E     -U   94   0H   0  225   52   L LL  L   L  F . L          LL    L                                  
    38   34 L H  E     -U   93   0H   0  229   82   A QD  A   Q  F N D          HA    A                                  
    39   35 L W  E     -UV  92  52H   0  233    0   W WW  W   W  W W W          WW    W                                  
    40   36 L Y  E     -UV  91  50H   0  233   14   Y FY  Y   F  L Y Y          FY    G                                  
    41   37 L Q  E     -UV  90  49H   4  233   29   Q QL  Q   Q  Q Q L          QQ    Q                                  
    42   38 L Q  E     -U   89   0H  16  233   12   Q HQ  Q   H  H Q Q          HQ    Q                                  
    43   39 L K    >   -     0   0   47  233   62   R KK  K   K  K K K          PK    K                                  
    44   40 L P  T 3  S+     0   0   81  233   36   P PP  P   P  P P P          PP    P                                  
    45   41 L G  T 3  S+     0   0   58  232   13   G GG  G   G  G G G          GG    G                                  
    46   42 L Q  S <  S-     0   0  103  233   69   Q QQ  Q   Q  Q T Q          QK    K                                  
    47   43 L P        -     0   0   34  233   59   A SS  A   S  S V S          AA    A                                  
    48   44 L P        -     0   0    5  233   10   P PP  P   P  P L P          PP    P                                  
    49   45 L K  E     -V   41   0H  96  233   63   R RQ  R   R  Q K Q          RK    K                                  
    50   46 L V  E     +V   40   0H  10  233   45   L LL  L   L  S P L          LL    L                                  
    51   47 L L  E     +     0   0H   2  233   23   L LL  L   L  L L L          LL    L                                  
    52   48 L I  E     -VW  39  58H   0  233   35   I II  M   I  I I I          II    I                                  
    53   49 L Y  E  >  + W   0  57H  54  232   23   Y YY  F   W  Y Y Y          YY    Y                                  
    54   50 L I  T >4 S-     0   0   10  233   88   G QL  G   Q  E E T          LR    A                                  
    55   51 L A  T 34 S+     0   0    2  233   75   A IV  S   I  V A I          AA    V                                  
    56   52 L S  T 34 S+     0   0   73  233   63   S SS  S   S  S S S          SS    P                                  
    57   53 L N  E <<  -W   53   0H  77  233   74   S NN  S   N  K K N          SN    R                                  
    58   54 L L  E     -W   52   0H  63  233   66   R RR  R   R  R L K          LL    S                                  
    59   55 L E    >   -     0   0   49  233   81   A YF  A   N  N Q F          HE    P                                  
    60   56 L S  T 3  S+     0   0  107  233   40   T TT  T   T  T S Y          ST    S                                  
    61   57 L G  T 3  S+     0   0   67  233   21   G GG  G   G  G G G          GG    W                                  
    62   58 L V    <   -     0   0   17  233   47   I VV  I   V  V V V          VV    F                                  
    63   59 L P    >   -     0   0   62  233   27   P PS  P   P  P P P          PP    P                                  
    64   60 L A  T 3  S+     0   0   99  233   58   D DD  D   D  S S N          AS    S                                  
    65   61 L R  T 3  S+     0   0   30  233    8   R RR  R   R  R R K          RR    Q                                  
    66   62 L F  E <   -S   79   0G   7  233    1   F FF  F   F  F F F          FF    F                                  
    67   63 L S  E     -S   78   0G  59  233   24   S TS  S   T  T S S          SS    S                                  
    68   64 L G  E     +S   77   0G  17  233   11   G GG  G   G  G S G          GG    G                                  
    69   65 L S  E     +S   76   0G  48  233   40   S SS  S   S  S S S          SS    S                                  
    70   66 L G  E     -S   75   0G  35  233   77   G GG  G   G  G G R          GG    G                                  
    71   67 L S  E >   +S   74   0G  68  232   24   S SS  S   S  S S S          SF    F                                  
    72   68 L R  T 3  S-     0   0  163  232   35   G EG  G   E  E G G          GG    G                                  
    73   69 L T  T 3  S+     0   0   51  232   58   T TT  T   T  T A T          TS    A                                  
    74   70 L D  E <   +RS  24  71G  77  232   64   D DD  D   D  D D G          DG    D                                  
    75   71 L F  E     -RS  23  70G   0  232   81   F FF  F   F  F F F          FT    F                                  
    76   72 L T  E     -RS  22  69G  33  232   61   T TT  T   T  T T T          SD    T                                  
    77   73 L L  E     -RS  21  68G   0  232    4   L LL  L   L  L L L          LF    L                                  
    78   74 L T  E     -RS  20  67G  28  232   48   T TR  T   T  T T K          TT    T                                  
    79   75 L I  E     -RS  19  66G   0  232    4   I II  I   I  I I F          IL    I                                  
    80   76 L D  S    S+     0   0   68  232   42   T SS  S   S  S T S          SS    S                                  
    81   77 L P  S    S-     0   0   51  232   61   R SR  R   S  S S K          AS    S                                  
    82   78 L V        +     0   0    0  232   50   L VV  L   V  V L V          VL    L                                  
    83   79 L E    >   -     0   0   93  232   36   E QE  E   Q  Q Q E          EE    K                                  
    84   80 L A  G >  S+     0   0   22  232   55   P AA  P   A  A P A          PP    A                                  
    85   81 L D  G 3  S+     0   0   58  232   28   E EN  E   E  E E E          QE    D                                  
    86   82 L D  G <   +     0   0    1  232    0   D DD  D   D  D D D          DD    D                                  
    87   83 L A    <   +     0   0   12  232   78   F AT  F   A  A A E          IF    I                                  
    88   84 L A  E    S- X   0 108H   8  232   20   A GG  A   G  G A G          GA    A                                  
    89   85 L T  E     -UX  42 107H  35  233   69   V VV  V   V  V I F          LV    T                                  
    90   86 L Y  E     -UX  41 106H   0  233    4   Y YY  Y   Y  Y Y L          YY    Y                                  
    91   87 L Y  E     -U   40   0H   9  233    6   F YY  Y   Y  Y Y F          CY    Y                                  
    92   88 L a  E     -U   39   0H   0  233    4   C CC  C   C  C C S          CC    C                                  
    93   89 L Q  E     -UY  38 102H   1  233   79   Q LG  Q   L  S Q K          SQ    Q                                  
    94   90 L Q  E     +UY  37 101H   0  233   84   Q QQ  Q   Q  Q N T          LQ    Q                                  
    95   91 L N        +     0   0    0  206   57   Y RE  Y   R  G Y I          VY    D                                  
    96   92 L N  S    S+     0   0    1  213   78   G Sn  g   s  s L E          kS    h                                  
    97   93 L E  S    S-     0   0   48  212   78   T D.  .   .  . . S          nS    n                                  
    98   94 L D  S    S+     0   0   42  216   73   s S.  .   .  . . s          hW    c                                  
    99   95 L P  S    S-     0   0   26  119   74   s Pp  q   p  p . w          vP    v                                  
   100   96 L P        -     0   0    4  155   90   L HH  G   H  Y . W          YP    N                                  
   101   97 L T  E     -Y   94   0H  26  200   64   T TS  T   T  T . T          TT    T                                  
   102   98 L F  E     -Y   93   0H  26  231   16   F FF  F   F  F . F          FF    F                                  
   103   99 L G        -     0   0    3  233   17   G GG  G   G  G G G          GN    G                                  
   104  100 L A        -     0   0   81  233   63   G QQ  P   Q  Q S Q          DP    Q                                  
   105  101 L G        -     0   0   12  233   14   G GG  G   G  G S G          GR    G                                  
   106  102 L T  E     - X   0  90H   0  233   14   T TT  T   T  T P T          TT    T                                  
   107  103 L K  E     -tX  10  89H  74  233   53   R KK  K   K  K T K          QK    K                                  
   108  104 L L  E     +tX  11  88H   2  232   22   V VL  V   V  V V L          LV    V                                  
   109  105 L E  E     -t   12   0H  14  233   69   E EE  D   E  E L E          EE    E                                  
   110  106 L M  E     -t   13   0H   0  233   29   I II  I   I  I Q I          II    I                                  
   111  107 L R  E     +t   14   0H 126  233   86   K KK  K   K  K I K          KK    K                                  
   112  108 L R        -     0   0   64  233   79   R RR  R   R  R R R          RR    R                                  
   113  109 L A        -     0   0   71  221   67   T SN  T   S  S T T          SA    S                                  
   114  110 L D        -     0   0   58  226   72   V DD  V   D  D V V          VV    D                                  
   115  111 L A  B     -A  144   0J  19  225   58   A AA  A   A  A A A          AA    A                                  
   116  112 L A        -     0   0   40  229   62   A EQ  A   E  E A A          TA    E                                  
   117  113 L P        -     0   0    9  229    4   P PP  P   P  P P P          PP    P                                  
   118  114 L T  E     -B  141   0K  85  232   60   S SA  S   S  S S S          SS    S                                  
   119  115 L V  E     -B  140   0K   8  233   26   V VV  V   V  V V V          AV    V                                  
   120  116 L S  E     -B  139   0K  17  233   67   F FY  F   F  F F F          FF    F                                  
   121  117 L I  E     -B  138   0K  22  233   31   I LL  I   L  L I I          II    L                                  
   122  118 L F  E     -B  137   0K   4  233    7   F FF  F   F  F F F          FF    F                                  
   123  119 L P        -     0   0    5  233   25   P KQ  P   K  K P P          QP    K                                  
   124  120 L P        -     0   0    1  233    9   P PP  P   P  P P P          PP    P                                  
   125  121 L S    >>  -     0   0    8  233   10   S SS  S   S  S S S          SS    S                                  
   126  122 L S  H 3> S+     0   0   78  233   64   D DP  D   D  D E D          PE    D                                  
   127  123 L E  H 3> S+     0   0   76  233   30   E ED  E   E  E D E          ED    E                                  
   128  124 L Q  H <4>S+     0   0    8  233   30   Q QQ  Q   Q  Q Q Q          QQ    Q                                  
   129  125 L L  H ><5S+     0   0   29  233   22   L LL  L   L  L V L          LV    L                                  
   130  126 L T  H 3<5S+     0   0  111  233   69   K KH  K   K  K K K          QK    K                                  
   131  127 L S  T 3<5S-     0   0   83  233   68   S TT  S   T  T S S          TS    T                                  
   132  128 L G  T < 5S+     0   0   34  233   54   G GG  G   G  G G G          GG    G                                  
   133  129 L G  E   < - C   0 186K  21  216   60   T TS  T   T  T T T          ST    T                                  
   134  130 L A  E     - C   0 185K   0  225   19   A VA  A   V  V A A          AA    V                                  
   135  131 L S  E     - C   0 184K   2  226   39   S SS  S   S  S T S          ST    S                                  
   136  132 L V  E     - C   0 183K   0  226   35   V VV  V   V  V V V          LV    V                                  
   137  133 L V  E     -BC 122 182K   0  226   15   V VV  V   V  V V V          VV    V                                  
   138  134 L b  E     -BC 121 181K   0  227    9   C CC  C   C  C C C          CC    C                                  
   139  135 L F  E     -BC 120 180K   0  228   40   L LL  L   L  L L L          LL    L                                  
   140  136 L L  E     -BC 119 179K   0  228   49   L VL  L   V  V L L          VL    V                                  
   141  137 L N  E     -B  118   0K   2  221   47   N NN  N   N  N N N          NN    N                                  
   142  138 L N  E    S+     0   0K  49  225   49   N DS  N   D  D G N          NG    D                                  
   143  139 L F  E     - C   0 177K   0  226   41   F FF  F   F  F F F          FF    F                                  
   144  140 L Y  B    S+A  115   0J   9  226   46   Y YY  Y   Y  Y Y Y          YY    Y                                  
   145  141 L P  S    S-     0   0   18  226   16   P PP  P   P  P P P          PP    P                                  
   146  142 L K  S    S+     0   0   83  227   74   R KK  R   K  K R R          KR    K                                  
   147  143 L D        +     0   0  116  228   78   E DD  E   D  D D E          ED    D                                  
   148  144 L I        -     0   0   19  228   60   A II  A   I  I A A          AA    I                                  
   149  145 L N  E     -E  201   0L  82  228   67   K NN  K   N  N K K          SK    N                                  
   150  146 L V  E     -E  200   0L  27  228   12   V VV  V   V  V V V          VV    V                                  
   151  147 L K  E     -E  199   0L  53  228   76   Q KK  Q   K  K K Q          VK    K                                  
   152  148 L W  E     +E  198   0L   3  228    3   W WW  W   W  W W W          WW    W                                  
   153  149 L K  E     +EF 197 158L  76  229   45   K KK  K   K  K K K          KK    K                                  
   154  150 L I  E    S-E  196   0L   0  229   68   V VV  V   V  V V V          VV    V                                  
   155  151 L D  S    S-     0   0   71  229   24   D DD  D   D  D D D          DD    D                                  
   156  152 L G  S    S+     0   0   63  230   38   N GG  N   G  G D N          ND    G                                  
   157  153 L S  S    S-     0   0   33  229   65   A VV  A   V  V V V          AV    V                                  
   158  154 L E  B     -F  153   0L  85  229   76   L TI  L   T  T V L          VV    T                                  
   159  155 L R        -     0   0   69  231   75   Q QQ  Q   Q  Q Q Q          KQ    Q                                  
   160  156 L Q        +     0   0  133  232   75   S SD  S   S  S S S          NS    S                                  
   161  157 L N  S    S+     0   0  117  233   70   G ST  G   S  S D G          TD    S                                  
   162  158 L G  S    S+     0   0   29  233   33   N sG  N   s  s n N          Gn    s                                  
   163  159 L V  E     -D  183   0K  46   68   75   S f.  S   f  f i S          Ii    f                                  
   164  160 L L  E     -D  182   0K  16  212   47   Q QI  Q   Q  Q Q Q          SQ    Q                                  
   165  161 L N  E     +D  181   0K  52  216   55   E NQ  E   N  N D E          TD    N                                  
   166  162 L S  E     -D  180   0K  12  224   49   S SE  S   S  S S S          SS    S                                  
   167  163 L W  E     -D  179   0K  99  224   71   V FS  V   F  F I V          VI    F                                  
   168  164 L T        -     0   0   24  225   66   T TV  T   T  T T T          TT    T                                  
   169  165 L D        -     0   0   99  226   74   E DT  E   D  D E E          EA    D                                  
   170  166 L Q        -     0   0   18  229   76   Q QE  Q   Q  Q Q Q          QA    Q                                  
   171  167 L D     >  -     0   0   48  229   61   D DQ  D   D  D D D          D     D                                  
   172  168 L S  T  4 S+     0   0   54  232   60   S SD  S   S  S S S          S     S                                  
   173  169 L K  T  4 S+     0   0  180  232   58   K KK  K   K  K K K          K     K                                  
   174  170 L D  T  4 S-     0   0   57  232   39   D KD  D   K  K D D          D     K                                  
   175  171 L S     <  +     0   0    4  232   57   S SS  S   S  S N N          N     S                                  
   176  172 L T        -     0   0    5  232   72   T TT  T   T  T T T          T     T                                  
   177  173 L Y  E     -C  143   0K   7  226    4   Y YY  Y   Y  Y Y Y          Y     Y                                  
   178  174 L S  E     -     0   0K   1  226   72   S SS  S   S  S S S          S     S                                  
   179  175 L M  E     -CD 140 167K   0  227   79   L LL  L   L  L L L          L     L                                  
   180  176 L S  E     -CD 139 166K   3  229    6   S SS  S   S  S S S          S     S                                  
   181  177 L S  E     -CD 138 165K   0  229    4   S SS  S   S  S S S          S     S                                  
   182  178 L T  E     -CD 137 164K   2  230   72   T IT  T   I  I T T          T     I                                  
   183  179 L L  E     -CD 136 163K   0  231    1   L LL  L   L  L L L          L     L                                  
   184  180 L T  E     +C  135   0K  36  231   54   T TT  T   T  T T T          A     T                                  
   185  181 L L  E     -C  134   0K  16  231   14   L LM  L   L  L L L          L     L                                  
   186  182 L T  E  >  -C  133   0K  81  230   58   S PS  S   P  P S S          S     P                                  
   187  183 L K  H >> S+     0   0   66  227   67   K SS  K   S  S S K          A     S                                  
   188  184 L D  H 3> S+     0   0  109  228   63   A ST  A   S  S T A          N     S                                  
   189  185 L E  H >4 S+     0   0   53  228   49   D EE  D   E  E E E          D     E                                  
   190  186 L Y  H X< S+     0   0    6  226   12   Y YY  Y   Y  Y Y Y          Y     Y                                  
   191  187 L E  H 3< S+     0   0   90  226   71   E QL  E   Q  Q Q E          N     Q                                  
   192  188 L R  T << S+     0   0  160  226   61   K SS  K   S  S R K          N     S                                  
   193  189 L H    <   -     0   0   24  224   55   H HH  H   H  H H H          H     H                                  
   194  190 L N  S    S+     0   0   97  224   71   K DE  K   D  D N K          E     D                                  
   195  191 L S  E     + G   0 214L  37  224   71   V AL  V   A  A V A          T     A                                  
   196  192 L Y  E     +EG 154 213L   0  224   14   Y YY  Y   Y  Y Y Y          Y     Y                                  
   197  193 L T  E     -EG 153 212L   3  223   48   A TS  A   T  T A A          S     T                                  
   198  194 L b  E     -EG 152 211L   1  223    0   C CC  C   C  C C C          C     C                                  
   199  195 L E  E     -EG 151 210L  34  212   62   E EE  E   E  E E E          E     E                                  
   200  196 L A  E     -EG 150 209L   1  212   22   V VI  V   V  V V V          I     V                                  
   201  197 L T  E     +E  149   0L  36  212   35   T ST  T   S  S T T          I     S                                  
   202  198 L H  E >   - G   0 205L  18  212   27   H HH  H   H  H H H          H     H                                  
   203  199 L K  T 3  S+     0   0  145  211   56   Q KK  Q   K  K Q Q          Q     K                                  
   204  200 L T  T 3  S+     0   0   55  211   41   G SS  G   S  S S G          S     S                                  
   205  201 L S  E <   -G  202   0L  45  187   83   L LL  L   L  L L L          L     L                                  
   206  202 L T  E    S+     0   0L 140  187   30   S TP  S   T  T T S          P     T                                  
   207  203 L S  E    S-     0   0L  82   90   51   S TS  S   T  T S S          S     T                                  
   208  204 L P  E     -     0   0L  43   67   33   P TT  P   T  T P P          P     A                                  
   209  205 L I  E     -G  200   0L  46   67   29   V LL  V   L  L L V          L     L                                  
   210  206 L V  E     +G  199   0L  70   63   53   T VI  T   V  V T T          V     V                                  
   211  207 L K  E     +G  198   0L  85   63   26   K KK  K   K  K K K          K     K                                  
   212  208 L S  E     -G  197   0L  67   63   28   S SS  S   S  S S S          S     S                                  
   213  209 L F  E     -G  196   0L  30   63   18   F FF  F   F  F F F          F     F                                  
   214  210 L N  E      G  195   0L  99   63   62   N SQ  N   S  S R N          Q     S                                  
   215  211 L R              0   0   82   54   19   R KR  R   K  K K R          R     K                                  
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  213   30  Q E  QE ED  EQ E E EQQEQEEEEE  EEEE QEQQEQQ EEEEEEEEEEQQQQQQQQQEEEEEEE
   218    2 H V        +     0   0   30  215   38  L V  VV VV  VV V V EVVVVVVVVV  VEEE VVAVVVV VVVEEEEEIEVVVVVVVVVEEEEEEE
   219    3 H K  E     -A  241   0A 143  215   52  Q Q  QQ QQ  QQ Q Q KQQQHQQQQQ  QNKK QQQQQHQ QQQKKKKKQEQRQQQQHQHKKKKKKK
   220    4 H L  E     -A  240   0A  11  231    3  L L  LL LL  LL L L LLLLLLLLLL  LLLL LLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   221    5 H Q  E     -A  239   0A 120  231   74  Q V  QV LV  LV V V VVVVVVLLVV  VVVV VLVVLVVEVVVVVVVVVVVVQMVVVVVVVVVVVV
   222    6 H E  E     -A  238   0A   2  232   34  E E  EE EEE EE E E EEEEQEEEEE  EEEE QEEEEQEEEEEEEEEEEEQEEQQQQQQEEEEEEE
   223    7 H S  E     +A  237   0A  48  232   22  S S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   224    8 H G        -     0   0   35  232   24  G G  GG GGE GG G G GGGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGEGGGGGGG
   225    9 H P        -     0   0   50  232   51  P G  PG GGG GG G G GGGGAGGGGG  GGGG AGGGGAGGGGGGGGGGGGAGPPAASSSGGGGGGG
   226   10 H A  S    S+     0   0   30  232   54  G G  GG DGG GG G G GGGGEGGGGG  GGGG EGSGGEGGGGGGGGGGGGENGEEEEEEGGGGGGG
   227   11 H V  E     -d  334   0B  33  233   26  L L  LL LLL LV L L LVVLVLLLLL  LLLL VLVLLVVVLLLLLLLLLLLVLVVVVLVLLLLLLL
   228   12 H I  E     -d  335   0B   9  233   54  V V  VV VAF VV V V VVVVKVVVVV  VVVV KVVVAKVVVVVVVVVVVVKVVKEKKKKVVVVVVV
   229   13 H K        -     0   0  104  233   49  K K  KQ QQK QQ Q Q QQQKKQQQQQ  QQQQ KQQKQKQQQQQQQQQQQKRQKKKKKKKQQQQQQQ
   230   14 H P  S    S+     0   0   56  233   12  S P  PP PPP PP P P PPPPPPPPPP  PPPP PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP
   231   15 H S  S    S+     0   0   90  233   20  A G  SG GGT GG G G GGGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG
   232   16 H Q  S    S-     0   0   76  233   60  E G  QR GGD GR G G GRKGAGGGGG  GGGG AGRGGARKGGGGGGGGGEAMQSSSAAAGGGGGGG
   233   17 H S        -     0   0   51  232   21  T S  TS SST SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSS
   234   18 H L  E     - B   0 300A   1  232   46  L L  LL LLL LL L L LLVLVLLLLL  LLLL VLLLLVLLLLLLLLLLLLVLLMVVVVVLLLLLLL
   235   19 H S  E     - B   0 299A  64  233   50  S R  SR RRT RR R R RRRRKKRRRR  RRRR KRRRRKRRRRRRRRRRRRTRSKKRKKKRRRRRRR
   236   20 H L  E     - B   0 298A   1  233   15  L L  LL LLL LL L L LLLLVLLLLL  LLLL VLLLLVLLLLLLLLLLLLILLVVVVVVLLLLLLL
   237   21 H T  E     -AB 223 297A  29  233   34  T S  TS SST SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSS
   238   22 H c  E     -AB 222 296A   0  234    0  C C  CC CCC CC C C CCCCCCCCCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   239   23 H I  E     -AB 221 295A  54  233   74  S A  AA AAT TA T T VTAATAAATT  TVVV EAIAAKVTTTTVVVVVAARTTKKKQKQVVVVVVV
   240   24 H V  E     -A  220   0A   4  233   54  V A  IA AAV AA G G GAAAAAAAGG  GGGG VAAAAAAAGGGGGGGGAAAGVAAAAAAGGGGGGG
   241   25 H S  E     +A  219   0A  60  234    9  P S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   242   26 H G  S    S+     0   0   54  228    4  D G  GG GGG GG G G GGGGGGGGGG  GGGG GGGGGGQGGGGGGGG.GGGGGGGGGGGGGGGGGG
   243   27 H F  S    S-     0   0   37  199   30  G F  DF FFF FF F F FFFFYFFFFF  FFFF HFFFFYFFFFFFFFF.FFYFGGDGYYYFFFFFFF
   244   28 H S    >   -     0   0   44  201   49  Y T  ST TTS TA T T TTDTPTSTTT  TTTT TTSSSTTITTTMRTDGTTSSSTTTPTPDTTTTDT
   245   29 H I  T 3  S+     0   0    2  232   27  L F  VF FFL FF F F GFFFFVFFFF  FFFF LFFFFFFFFFFFFFFFFFFFILFFFFFFFFFFFG
   246   30 H T  T 3   +     0   0   59  232   53  S S  SD SSS SS S S SKSSTNSSSS  SSSS TRSSSTSSSSSSSSSRSRSEGRSRTTTSNSSSSS
   247   31 H R  S X  S-     0   0  145  234   77  D N  SD TNS ND S S SNTSNNNSSS  SSSS ENGDTSSDSSSRDSDNSSTTSSKNRTRDSSDSRS
   248   32 H T  T 3  S+     0   0   72   68   71  S .  N. ..N .. . . ......SN..  .... ..S.Q.SF...T...T....G.........S...
   249   33 H N  T 3  S+     0   0   16   73   70  S .  S. ..A .. . . ......AA..  .... ..A.A.GG...D...N....D.........E...
   250   34 H Y  E <   -E  317   0C  23  234   47  S A  AY YYI YY Y Y TYYYHYMMYY  YTYY LYMYMYMMYYYIYYYIFFYYYYYYYYYYTTLYTY
   251   35 H d  E     -EF 316 270C   0  224   90  Y W  TA AY. AA Y Y YAASFWSSYY  YYPE SA.YAGHHYYY.TAAYENHAFSAAIPIAYY.EYP
   252   35AH W  E     -EF 315 269C   1  222   46  W M  WM MM. MM M M IMMMIMW.MM  MIII RM.M.V.WMMM.FVFIMMIMWIIIMMMFII.III
   253   35BH H  E     -EF 314 268C   0  231   72  G S  NH SSS TH Y Y NHHNNHV.YY  YNDS HNHI.S.VYYYKSSSNNNHHSSNSNNNSNNISNG
   254   36 H W  E     +EF 313 267C   1  233    1  W W  WW WWW WW W W WWWWWRRWWW  WWWW WWWWWWW.WWWWWWWWWWWWWWWWWWWWWWWWWW
   255   37 H I  E     -EF 312 265C   0  233   13  I V  IV VVV VV V V VVVVVVQVVV  VVVV VVLIVVV.VVVVVVVVVVVVIVVVVVVVVVVVVV
   256   38 H R  E     -EF 311 264C  10  234   15  R R  RR RRR RR R R RRRRRRARRR  RRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
   257   39 H Q  E     -EF 310 263C  22  233    3  Q Q  QQ QQQ QQ Q Q QQQQQQ.QQQ  QQQQ QQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
   258   40 H A    >   -     0   0   14  233   59  P A  SA AAA AA A A AASAAA.AAA  AAAA AAIAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   259   41 H P  T 3  S+     0   0   99  234   20  P P  PP PPP PP P P PPPPPPQPPP  PPPP PPPQPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP
   260   42 H G  T 3  S+     0   0   94  234   11  G G  SG GGG RG G G GAGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   261   43 H K  S <  S-     0   0  140  234   34  Q K  RK KKN KK K K KKRKQKKKKK  KKKK KKKKKQKKKKKKKKKKKKQKRQQQQQQKKKKKKK
   262   44 H G        -     0   0   20  234   23  G G  GG GGG GG G G GGRGSGGGGG  GGGG GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG
   263   45 H L  E     -F  257   0C  10  234    6  L L  LL LLL LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   264   46 H E  E     -F  256   0C  79  234   10  E E  EE EEE EE E E EEEEEVEEEE  EEEE EEEEEEEEEEEEEEEEEEEEEEDEEEEEEEEEEE
   265   47 H W  E     +F  255   0C  13  234    9  W W  WW WWW WW W W WWWWWWWWWW  WWWW WWWWWWWSWWWWWWWWWWWWWWWWWWWWWWWWWS
   266   48 H M  E     -     0   0C   3  234   31  I V  LV VVI VV V V LVVVMVVVVV  VLLL MVVLVMVVVVWLLLVLLIMLMMMMMMMVLLLLLL
   267   49 H G  E     -FG 254 277C   0  234   42  G G  GS SSG SA S S AAASGSSSSS  SAAA GSASSGGASSVAAAAASAGAGGGGGGGAAAAAAA
   268   50 H R  E     -FG 253 276C  10  234   92  T R  RG GYA AV A A TTVSWLAGAA  ATGV GGVYAWVTAASAAGAQYFITYGGGWWWAGAATRS
   269   51 H I  E     -FG 252 275C   3  234   20  V I  TI III II I I IIIFIMFVII  IIII FIIIIIVIIIAIMIIIIIMIITIVIIIIIIIIII
   270   52 H d  E >   -F  251   0C   0  234   84  S K  YS GSG GS N N SSSSNRSSNN  NSSS DSSSGSSWNNISSYASTNNSYIIIDDDAASSTSD
   271   53 H Y  T 3  S+     0   0   47  234   85  Y s  yW DGS Gh T T TyYsTDGNTT  TTfT PSYNgaFSTTsdaStsRSpFYpppTTTtrSTTVs
   272   54 H E  T 3  S-     0   0   63  232   61  S d  nn sdS sq g g sqeegdssgg  ggds esdsdnddgggtdsdgsrddSgthknkdssSsds
   273   55 H G  S <  S+     0   0   25  185   36  G g  .g hsG hA g g g.g.gsgggg  ggGv gvndEGssggi.GsG.nn.gG...gggGGgGggG
   274   56 H S        -     0   0   42  200   70  T T  .S SYS SE S S S.K.NESDSS  SDSG ENHMGDKNSSNSSSSTTESSSRTTNNNSSSTGSN
   275   57 H I  E     -G  269   0C  71  215   54  P T  .I IIA IS T T T.Q.TTTTTT  TTTT TTKTSTTETTTTTTTAVKKKTATTPPPTSTTTTT
   276   58 H Y  E     -G  268   0C  70  222   77  Y D  DA YYY YY W W Y.HYKAYYWW  WSYY VYLYYNYKWWYYYYYYYYTIYSTNTTTYYYSYFY
   277   59 H Y  E     -G  267   0C  41  227   14  Y Y  YY YYY YY Y Y YYYYYYYYYY  YYYY YYYHYFYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   278   60 H S    >>  -     0   0   11  231   57  T A  AA AAA GA T T AAAASAAATT  TAAA AASAAAAATTPAAAAAAGAANAAVAAAAAAAAAA
   279   61 H P  T 34 S+     0   0   76  234   56  P A  QD DDS DN D D DDDDQEDDDD  DDDD QDDDEQDDDDDDDDDDDEQRPQQEQQQDDDDDDD
   280   62 H S  T 34 S+     0   0   79  234   55  S P  SS SSW SS S S SSSSKFSSSS  SSSS TSSSSKSSSSSSSSSSSSTSSKRRAAASSSSSFS
   281   63 H I  T X4 S+     0   0    4  234   43  L V  VV VVA VV V V VVVVFVVVVV  VVVV FVVVLFAVVVMVVVVVLVFVLFFFFFFVVVVVVV
   282   64 H K  G >< S+     0   0  133  234   33  K K  QK KKK KK K K KKKKQQKKKK  KKKK QKKKKQKTKKKKLTKKQKQKEQQQTTTKKKKKRK
   283   65 H S  G 3  S+     0   0  116  234   31  S G  NG GGS GG G G GGGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG
   284   66 H R  G <  S+     0   0   51  234   16  R R  RR RRR RR R R RRRRRRRRRR  RRRR RRRRRRRRRRQRRRRRRRRRRRRRRRRRRRRRRR
   285   67 H S  E <   -C  300   0A  11  234   54  L F  IF FFS FF F F FCAFVFFFFF  FFFF VFFFLLFFFFFFLFFFFFMFLVVIFFFFFFFFFF
   286   68 H T  E     -C  299   0A  67  220   24  T T  ST TTT TS T T TTTTTTTATT  TTTT TTTTTTTATTTTTTTTTTTVSTTTVVVTTTTTTT
   287   69 H I  E     +C  298   0A   3  220   25  I I  II III II I I IFIIIIIIII  IIIS MIILIVIIIIIIVIIIIIMVIIIIFFFIIIIIII
   288   70 H S  E     -C  297   0A  56  234   45  H S  NS SST SS S S SSSSTSSSSS  SSSS TSSSSTSSSSSSSSSSSSTSSTTTSSSSSSSSSS
   289   71 H R  E     -C  296   0A  71  234   70  V R  PR RRR RR K K RRRRRRRRKK  KRRK EGRRRTRRKKRRSRSRRRRRIAAALLLSRRRRRS
   290   72 H D  E >>> -C  295   0A  55  234   18  D D  DD DDN DD E E DDDDDDDDEE  EDDD DDDDDDDDEEDDDDDDDDDDDDDDDDDDDDDDDD
   291   73 H T  T 345S+     0   0   78  233   60  P D  TN NNT NT N N NNNNTNNNNN  NNDN TINNNTNNNNTNNNDNNNTNTEKETTTDNNNNND
   292   74 H S  T 345S+     0   0  105  233   44  S S  SG SAN SS A A SSSAWASSAA  ASSS SSSTSSSSAATSSSSWAASTSASSSSSSSSSSSS
   293   75 H L  T <45S-     0   0  103  234   70  K K  KK KKL NK K K QQNKTKKKKK  KQQQ TTKKKTKKKKKQQQQQRDTNKTTTVVVQRQQQQQ
   294   76 H N  T  <5 +     0   0   29  234   47  S N  NN NNN NN N N NDKNTNNNNN  NNNN DNSKNNNNNNNNNNNNNNSSNSNSSSSNNNNNNN
   295   77 H K  E   < -BC 239 290A  51  234   64  Q T  QS TST TT T T TTTSTTTTTT  TTTT TTLSTTTMTTSTTTMTSSTTQTTTTTTMTTTTTT
   296   78 H F  E     -BC 238 289A   1  234   61  I L  FL LLV LI L L ALVLALLLLL  LAAA ALLLVALLLLLAAAVALLVLFAAAAAAVDAAAAV
   297   79 H F  E     -BC 237 288A  50  234   27  F Y  SY YYT YY Y Y YYSYYFYYYY  YYYY YYFSYYYYYYYYYYYYYFFFSFYYYYYYYYFYYY
   298   80 H I  E     -BC 236 287A   4  234    5  L L  LL LLL LL L L LLLLMLLLLL  LLLL MLLLLMLLLLLLLLLLLLMLLMMMLLLLLLLLLL
   299   81 H Q  E     -BC 235 286A  73  234   36  N Q  QQ QQK QQ Q Q QQQQDQQQQQ  QQQQ DQHQQEQHQQQQQQQQQQEQREEEQQQQQQQQQQ
   300   82 H L  E     -BC 234 285A   3  234   23  L M  LM MMM MM M M MLLMLLMMMM  MMMM LMVMMLMMMMMMIMMMMMLMLLLLIIIMMMMMMM
   301   82AH I        +     0   0   70  234   62  T N  NN NNT NN D D NNSNSSNNDD  DNNN SHNHDRTDDDNNYNNNNSNNNSRSNSNNNNKNNT
   302   82BH S  S    S-     0   0   59  234   35  S S  SS SSS TS S S SSGSSSSSSS  SSSR NSSNRSSNSSSSSSSSSSSSSSSSRSNSSSSSSS
   303   82CH V        -     0   0    0  234   13  V L  VL LLL LL L L LLLLLLLLLL  LLLV LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLQLLL
   304   83 H T    >   -     0   0   65  234   62  T K  TR RRT RR R R RRSRRRRRRR  RRRR RRTRRRRRRRRKRRRRRRKRTSRRKKKRRRRRRR
   305   84 H N  G >  S+     0   0  120  234   65  A T  PA AAA AP A A TPTASAAAAA  ATTT SASAASVAAAVTTTTAAVSTASFSAAATTTTTTT
   306   85 H E  G 3  S+     0   0  160  234   25  A E  EE EEA EE E E EEEEEEEEEE  EEEE DDANDDDEEEEEEEEEEDGNAEDEEEEEEEEEEE
   307   86 H D  G <  S+     0   0    0  234    1  D D  DD DDD DD D D DDDNDDDDDD  DDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
   308   87 H T    <   +     0   0   30  234   32  T T  MT TTT TT T T TTTTTTTTTT  TTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
   309   88 H A  E    S- H   0 333C   3  234    4  A A  AA AAA AA A A AAGAAAAAAA  AAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   310   89 H M  E     -EH 257 332C  43  234   58  V V  VL VVT VV V V RVVVVVVVVV  VRRR VVIVIMVVVVVRRRRHVIVTVVVVVVVRRRRQRR
   311   90 H Y  E     -EH 256 331C   2  234    0  Y Y  YY YYY YY Y Y YYYYYYYYYY  YYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYCYY
   312   91 H Y  E     -E  255   0C   1  234    3  Y Y  YY YYF YY Y Y YYYYWYYYYY  YYYY YYYYFYYYYYYYYYWYYYYYFFYYFYFYYYYYYY
   313   92 H c  E     +E  254   0C   0  234    1  C C  CC CCC CC C C CCCCCCCCCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   314   93 H S  E     -EI 253 327C   0  234   30  V T  AA ATA AA A A AAAAAAAAAA  AAAA AAAATAAAAAMVGATTAATAAAAATTTAAAATVV
   315   94 H R  E     -EI 252 326C  20  233   44  R T  RK TRR AR K K SRRRRRRNKK  KRRR TRRRKRTRKKRRRRIRRRRKRRRRTTTMRRRRTG
   316   95 H E  E     -EI 251 324C   0  233   77  H N  DE GDD GR D D YPDDDGVTDD  DGGG GADGIGGDDDDGGGGGQGDEGASSLLLAGWYGDC
   317   96 H N  E  >> -E  250   0C   6  233   90  G P  TI STT SG T T RVFLAGTLTT  TRGP VDFMDPGATTTDGPGDNKRNVGTRSSSGVSYGLS
   318   97 H H  T  45S+     0   0    0  233   93  G P  VG QCQ QD H Q SRLGPFGWQQ  HAGR YYHTWDGDQQVIWAAYEWSSGPYYGGGASDDIDG
   319   98 H M  T  45S+     0   0   73  234   93  Y D  RA WDC WY F G ASPWQGGTVR  PSIY DRSGSYRMRSRRSMVNHVGALIYYYYYVYLDAVC
   320   99 H Y  T  45S+     0   0  159  234   92  S Y  GH PYD PS T H VRLFGNWVRW  WSGS VDKFIEFIGTRFAVAETPRGGAYYSSSACLHIWD
   321  100 H E  T  <5 -     0   0   54  234   90  f y  sn GFY Gs F e awsGvFSgPl  gYPG lyttRsstgqsdyliLsaalTaddaaafyvgaGs
   322  100AH T      < +     0   0    0  139   91  a y  dy ... .e . w tdy.t..g.g  n..Y swseGpykyswygld.sndt.yyywwwpydyy.t
   323  100BH Y  S    S-     0   0   10  161   90  Y G  AG ... .N . Y SAA.Y..G.L  NI.G RYASTWGGGAYSASA.FWAVAEGGPPPHAAGP.D
   324  100CH F  E     +I  316   0C   0  185   48  F M  FM ..F .F . F MFLLF..FQF  FI.L FFMFFFMMLSFMMMM.FFFFFMMMEEEMLMIM.M
   325  101 H D  E     +     0   0C  42  205   40  P D  DD DDN DQ K D DHDDDDDDTS  SS.D DDDDDDDDDPDNDDD.DDDADDDDDDDDDDED.D
   326  102 H V  E     -I  315   0C  35  212   66  F V  FV YYI YH F L LIVYYQYYFF  FS.L YVTLNYVVSFLLLLL.YPIFIVVVYYYLLLLL.L
   327  103 H W  E     -I  314   0C  28  221    8  W W  WW WWW WW W W WWWWWWWWWW  WW.W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW.W
   328  104 H G        -     0   0    3  229    7  G G  GG GGG GG G G GGGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG.G
   329  105 H Q        -     0   0  100  223   52  Q Q  QQ QQP QQ Q P PQQQQQQQQQ  QR.P QRRQRQQQQQPPPPPPQQQQQQQQQQQPPPPPPP
   330  106 H G        -     0   0    3  228    7  G G  GG GGG GG G G GGGGGGGGGG  GG.G GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   331  107 H T  E     -H  311   0C  27  233   39  A T  LT TTT TT A T VTTTTTTTAA  AVVV TTTTTTTTVATVVVVVITTTTTTTTTTVVVVVIV
   332  108 H T  E     -H  310   0C  48  234   79  P T  RT LLL VL L P EMALLLLLLL  LEEE QLTMLLTTVLPEDEEELLKDVTTTLLLEEEEEKE
   333  109 H V  E     -H  309   0C   0  234   19  V V  VV VVV VV V I VVVVVVVVVV  VVVV VVVVVVVVVVIVVVVVVVVVVVVVVVVVVVVVVV
   334  110 H T  E     -d  227   0B  16  234   41  T T  TT TTT TA T T VTITTTTTTT  TTVV TSITTTSITTTVVVVVTTTSTTTTTTTVVVVVAV
   335  111 H V  E     +d  228   0B   2  234    9  V V  VV VVV VV V I VVVVVVVVVV  VVVV VVVVVVVVVVIVVVVVVIVVVVVVVVVVVVVVVV
   336  112 H S        -     0   0   18  234   31  S S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSYSSSSSSSSSSSSSS
   337  113 H S  S    S+     0   0   99  234   19  S S  SS SSS SS S S SSSSSSSSSS  SSSS SASSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   338  114 H A  S    S-     0   0   31  234   51  A A  AA AAG AA A A AAAAAAAAAA  AAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
   339  115 H K        -     0   0  143  234   66  S S  SS SSQ SS S S PSSSSSSSSS  SPPP SSSSSSSSSSSPPPPPSSSSSSSSSSSPPYPYPP
   340  116 H T        -     0   0   44  234   72  T T  TT TTP TT T T KTTTTTTTTT  TKKK TTTTTTTTTTTKKKKKTTTTPTTTTTTKKNKNKK
   341  117 H T  B     -J  370   0D  35  234   73  K K  KK KKK KK K K TKKKKKKKKK  KTTT KKKKKKKKKKKTTTTTKKKKTKKKKKKTTTTTTT
   342  118 H P        -     0   0   60  234   66  G G  GG GGA GG G G AGGGGGGGGG  GAAA GGGGGGGGGGGAAAAAGGGGSGGGGGGAAAAAAA
   343  119 H P        -     0   0   13  234   17  P P  PP PPP PP P P PPPPPPPPPP  PPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   344  120 H S  E     -K  367   0E  51  234   57  S S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSKSSSSSSSSSSSLS
   345  121 H V  E     -K  366   0E   6  234   25  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV
   346  122 H Y  E     -K  365   0E  27  234   14  F F  FF FFF FF F F YFFFFFFFFF  FYYY FFFFFFFFFFFYYYYYFFFFFFFFFFFYYYYYYY
   347  123 H P  E     -K  364   0E  15  234   27  P P  PP PPP PP P P PPPPPPPPPP  PPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   348  124 H L  E     +K  363   0E   4  234   22  L L  LL LLL LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   349  125 H A        -     0   0   10  234   68  A A  AA AAA AA A A AAAAAAAAAA  AAAA AAAAAAAAAAAAAAAAAAAASAAAAAAAAAAAAA
   350  126 H P        -     0   0   24  234   77  P P  PP PPP PP P P PPPPPPPPPP  PPPP PPPPPPPPPPPPPPPPPPPPLPPPPPPPPPPPPP
   351  127 H G  S    S-     0   0   16  234   65  C S  SS SCC SS S S CSCCCSSSSS  SCCC CSSSSSSSSSSCCCCCSSSSDSSSSSSCCCCCCC
   352  128 H S  S    S+     0   0   99  234   67  S S  SS SSC SS S S SSSSSSSSSS  SSGS SSSSSSSSSSSSGGSGSSSSSSSSSSSGSGGGGG
   353  129 H A        +     0   0   52  234   79  R K  RK KTG KK R R RKRRRKKKRR  RRRR RKKKKKKKRRRRRRRRKKKKTKKKKKKRRRRRRR
   354  130 H A        +     0   0   70  145   76  S S  SS SSD SS S S DSSSSSSSSS  SDDD SSSSSSSSSSSDDDDDSSSS.SSSSSSDDDDDDD
   355  133 H Q        +     0   0  178  219   82  T T  TT TTT TT T T TTTTTTTTTT  TTTT TTTTTTTTTTTTVTTVTTTTPTTTTTTTTVVTTT
   356  134 H T    >   -     0   0   64  231   47  S S  SS SSP SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSQSSSSSSSSSSSSS
   357  135 H N  T 3  S-     0   0  146  232   60  E G  EG GES GG E E GGEEGGGGEE  EGGG GGGGGGGGEEEGGGGGGGGGDGGGGGGGGDGGGG
   358  136 H S  T 3  S+     0   0   63  232   58  S G  SG GGS GG S S PGSSGGGGSS  SPPP GGGGGGGGSSSPPPPPGGGGGGGGGGGPPHPPPP
   359  137 H M  E <   - L   0 408E  83  232   79  T T  TT TTT TT T T NTTTTTTTTT  TNNN TTTTTTTTTTTNNNNNTTTTNTTTTTTNNNNNNN
   360  138 H V  E     - L   0 407E  15  233   38  A A  AA AAV AA A A VAAVAAAAAA  AVVV AAAAAAAAAAAVVVVVAAAAVAAAAAAVVVVVVV
   361  139 H T  E     + L   0 406E  15  234   68  A A  AA AAT AA A A AAAAAAAAAA  AAAA AAAAAAAAAAAAAAAAAAAAVAAAAAAAAAAAAA
   362  140 H L  E     + L   0 405E   0  234   26  L L  LL LLL LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLLL
   363  141 H G  E     -KL 348 404E   0  234   28  G G  GG GGG GG G G GGGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGAGGGGGGGGGGGGG
   364  142 H e  E     -KL 347 403E   1  234    1  C C  CC CCC CC C C CCCCCCCCCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
   365  143 H L  E     -KL 346 402E   2  234   12  L L  LL LLL LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
   366  144 H V  E     -KL 345 401E   1  234   46  V V  VV VVV VV V V AVVVVVVVVV  VAAA VVVVVVVVVVVVAAAAVVVVVVVVVVVAAVAVAA
   367  145 H K  E     -KL 344 400E  38  231   68  K K  KK KKK KK K K SKKKKKKKKK  KSSS KKKKKKKKKKKSSSSSKKKKQKKKKKKSSSSSSS
   368  146 H G  E    S+     0   0E  19  234   40  D D  DD DDG DD D D SDDDDDDDDD  DSSS DDDDDDDDDDDSSSSSDDDDGDDDDDDSSSSSSS
   369  147 H Y  E     - L   0 399E   0  234    5  Y Y  YY YYY YY Y Y YYYYYYYYYY  YYYY YYYYYYYYYYYYYYYYYYYYFYYYYYYYYYYYYY
   370  148 H F  B     +J  341   0D   3  234   40  F F  FF FFL FF F F FFFFFFFFFF  FFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   371  149 H P  S    S-     0   0    0  234   15  P P  PP PPP PP P P PPPPPPPPPP  PPPP PPPPPPPPPPPPPPPPLPPPpPPPPPPPPPPPPP
   372  150 H E  S    S+     0   0   53  231   47  E E  EE EEE EE E E EEEEEEEEEE  EEEE EEEEEEEEEEEEEEEEEEEEeEEEEEEEEEEEEE
   373  151 H P        +     0   0   59  232   52  P P  PP PPP PP P P PPPPPPPPPP  PPPP PPPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPP
   374  152 H V        -     0   0   20  233   39  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVVVVVVVVVVVVVVVVVVVLVVVVVVVVVVVVV
   375  153 H T  E     +N  422   0F  83  234   67  T T  TT TTT TT T T TTTTTTTTTT  TTTT TTTTTTTTTTTTTTTTTTTTSTTTTTTTTTTTTT
   376  154 H V  E     +N  421   0F  23  234   44  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVVVVVVVVVVVVMVVVVVVVVVVVVVMVVVVVV
   377  156 H T  E     -N  420   0F  48  234   51  S S  SS SST SS S S TSSSSSSSSS  STTT SSSSSSSSSSSTTTTTSSSSTSSSSSSTTTTTTT
   378  157 H W  E > >S-NO 419 383F   2  234    0  W W  WW WWW WW W W WWWWWWWWWW  WWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW
   379  162 H N  G > 5S-     0   0   38  234   61  N N  NN NNN NN N N NNNNNNNNNN  NNNN NNNNNNNNNNNNNNNNNNNNSNNNNNNNNNNNNN
   380  163 H S  G 3 5S-     0   0   91  234   63  S S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSESSSSSSSSSSSSS
   381  164 H G  G < 5S+     0   0   39  234   50  G G  GG GGG GG G G GGGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG
   382  165 H S  T < 5 +     0   0   93  234   53  A A  SA AAT AA S S AAAAAAAASS  SAAA AAAAAAAASSSAAAAAAAAAGAAAAAAAAAAAAA
   383  166 H L  B   < +O  378   0F  43  228   74  L L  LL LLL LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLQLLLLLLLLLLLLL
   384  167 H S        +     0   0   88  231   64  T T  TT TTT TT T T STTTTTTTTT  TSTS TTTTTTTTTTTTTTSTTTTTNTTTTTTTSSTSTT
   385  168 H S  S    S+     0   0  101  231   73  S S  SS SRN SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSVSSSSSSSSRSRSS
   386  169 H G  S    S+     0   0   32  226   40  G G  GG GGG GG G G GGGGGGGGGG  GGGG GGGGGGGGGGGGGGGGGGGGTGGGGGGGGVGVGG
   387  171 H V        +     0   0   48  232   57  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVVVVVVVVVVVVVVVVVVVAVVVVVVVVVVVVV
   388  172 H H  E     -M  404   0E  17  233   79  H H  HH HHR HH H H HHHHHHHHHH  HHHH HHHHHHHHHHHHHHHHHHHHRHHHHHHHHHHHHH
   389  173 H T  E     -M  403   0E  69  233   67  T T  TT TTT TT T T TTTTTTTTTT  TTTT TTTTTTTTTTTTTTTTTTTTNTTTTTTTTTTTTT
   390  174 H F  E     -M  402   0E   1  233   11  F F  FF FFF FF F F FFFFFFFFFF  FFFF FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF
   391  175 H P  E     -     0   0E  65  232   17  P P  PP PPP PP P P PPPPPPPPPP  PPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
   392  176 H A  E     -     0   0E  19  233   53  A A  AA AAS AA A A SAAAAAAAAA  ASSS AAAAAAAAAAASSSSSAAAAPAAAAAASSSSSSS
   393  177 H V  E     -M  400   0E  42  233   54  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVVVVVVVVVVVVVVVVVVVSVVVVVVVVVVVVV
   394  178 H L  E     -M  399   0E  77  233   51  L L  LL LLR LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLQLLLLLLLLLLLLL
   395  179 H Q  S    S-     0   0   83  233   65  Q Q  QQ QQQ QQ Q Q QQQQQQQQQQ  QQQQ QQQQQQQQQQQQQQQQQQQQDQQQQQQQQQQQQQ
   396  180 H S  S    S-     0   0  116  233   55  s s  ss sss ss s s psssssssss  sppp ssssssssssspppppssssassssssppppppp
   397  183 H D  S    S+     0   0   90  226   21  g g  gg ggg gg g g gggggggggg  gggg gggggggggggggggggggggggggggggggggg
   398  184 H L        -     0   0   53  224   74  L L  LL LLL LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLlLLLLLLLLLLLLL
   399  185 H Y  E     -LM 369 394E  36  230    2  Y Y  YY YYY YY Y Y YYYYYYYYYY  YYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   400  186 H T  E     +LM 367 393E   5  228   48  S S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSS
   401  187 H L  E     -L  366   0E  11  225   53  L L  LL LLL LL L L LLLLLLLLLL  LLLL LLLLLLLLLLLLLLLLLLLLTLLLLLLLLLLLLL
   402  188 H S  E     -LM 365 390E   5  225   25  S S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   403  189 H S  E     -LM 364 389E   2  225    1  S S  SS SSS SS S S SSSSSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
   404  190 H S  E     -LM 363 388E   0  225   78  V V  VV VVV VV V V MVVVVVVVVV  VMMM VVVVVVVVVVVMMMMMVVVVQVVVVVVMMMMMMM
   405  191 H V  E     -L  362   0E   0  225   27  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVVVVVVVVVVVVVVVVVVVLVVVVVVVVVVVVV
   406  192 H T  E     +L  361   0E  48  225   41  T T  TT TTS TT T T TTTTTTTTTT  TTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTITITT
   407  193 H V  E     -L  360   0E  14  224   29  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVVVVVVVVVVVVVVVVVVVLVVVVVVVVVVVVV
   408  194 H P  E  >  -L  359   0E  56  223   43  P P  PP PPT PP P P PPPTPPPPPP  PPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAPAPP
   409  195 H S  T  4 S+     0   0   49  222   51  S S  SS SC. SS S S ASSSSSSSSS  SAAA SSSSSSSSSSSAAAAASSSSASSSSSSAAAAAAA
   410  196 H S  T  4 S+     0   0   66  222   64  S S  SS SS. SS S S SSSSSSSSSS  SSRS SSSSSSSSSSSHSSSSSSSSTSSSSSSSSSSSSS
   411  198 H P  T  > S+     0   0   31  222   70  S S  SS SS. SS S S SSNNSSSSSS  SSSS SSSSSSSSSSSSSSSSSSSSQSSSSSSSSSSSSS
   412  199 H R  T  < S+     0   0   16  222   99  L L  LL LWS LL L L LLFFLLLLLL  LLSL LLLLLLLLLLLLLLLLLLLLCLLLLLLLLLLLLL
   413  200 H P  T  4 S+     0   0   80  223   71  G G  GG GGS GG G G SGGGGGGGGG  GSSS GGGGGGGGGGGSSSSSGGGGPGGGGGGSSSSSSS
   414  202 H S  T  4 S+     0   0  111  221   68  T T  TT TTS TT T T STTTTTTTTT  TSRS TTT TTTTTTTSSSSSTTTTD TTTTTSSTSTSS
   415  203 H E  S  < S-     0   0  128  221   75  K Q  QQ QQQ QQ Q Q KQQQQQQQQQ  QKKK QQQ QQQQQQQKKKKKQQQQG QQQQQKKLKLKK
   416  204 H T        -     0   0   83  221   71  T T  TT TTP TT T T STTTTTTTTT  TSCS TTT TTTTTTTRSSSSTTTTk TTTTTSSSSSSS
   417  205 H V        +     0   0    4  217   60  Y Y  YY YYV YY Y Y YYYYYYYYYY  YYFY YYY YYYYYYYYYYYYYYYYv YYYYYYYYYYYY
   418  206 H T  E     - P   0 433F  23  217   76  T I  VI ITT II V V TITTTIIIVV  VTTT TII IIIIVVVTTTTTIIIIT IIIIITTTTTTT
   419  208 H e  E     -NP 378 432F   0  220    1  C C  CC CCC CC C C CCCCCCCCCC  CCCC CCC CCCCCCCCCCCCCCCCC CCCCCCCCCCCC
   420  209 H N  E     -NP 377 431F   4  220   59  N N  NN NNN NN N N NNNNNNNNNN  NNNN NNN NNNNNNNNNNNNNNNNH NNNNNNNNNNNN
   421  210 H V  E     -NP 376 430F   1  220   24  V V  VV VVV VV V V VVVVVVVVVV  VVVV VVV VVVVVVVVVVVVVVVVV VVVVVVVVVVVV
   422  211 H A  E     -NP 375 429F  14  220   74  D N  NN NDA NN N N NNDDNNNNNN  NNNN NNN NNNNNNNNNNNNNNNNK NNNNNNNYNYNN
   423  212 H H  E > > - P   0 428F   1  220   17  H H  HH HHH HH H H HHHHHHHHHH  HHHH HHH HHHHHHHHHHHHHHHHH HHHHHHHHHHHH
   424  213 H P  G > 5S+     0   0   77  209   81  K K  KK KKP KK K K PKKKKKKKKK  KPPP KKK KKKKKKKPPPPPKKKK  KKKKKPPPPPPP
   425  214 H A  G 3 5S+     0   0   40  203   65  P P  PP PPA PP P P APPPPPPPPP  PAAA PPP PPPPPPPAAAAAPPPP  PPPPPAAAAAAA
   426  215 H S  G < 5S-     0   0   32  202   63  S S  SS SST SS S S TSSSSSSSSS  STTT SSS SSSSSSSTTTTTSSSS  SSSSSTTTTTTT
   427  216 H S  T < 5 +     0   0  111  199   72  N N  NN NNN NN N N TNNNNNNNNN  NTTT NNN NNNNNNNKTTTTNNNN  NNNNNTTNTNTT
   428  217 H T  E   < +P  423   0F  35  196   63  T T  TT TTT TT T T TTTTTTTTTT  TTTT TTT TTTTTTTTTTTTTTTT  TTTTTTTTTTTT
   429  218 H K  E     +P  422   0F 135  196   50  K K  KK KKK KK K K KKKKKKKKKK  KKKK KKK KKKKKKKKKKKKKKKK  KKKKKKKKKKKK
   430  219 H V  E     -P  421   0F  38  140   32  V V  VV VVV V  V V VVVVVV VVV  VVVV VVV VV VVVVVVVVVVVVV  VVVVVVVVVVVV
   431  220 H D  E     -P  420   0F  97  140   36  D D  DD DDD D  D D DDDDDD DDD  DDDD DDD DD DDDDDDDDDDDDD  DDDDDDDDDDDD
   432  221 H K  E     -P  419   0F  51  127   45  K K  KK KKK K  K K KKKKKK KKK  KK K KKK KK KKKK KKKKKKKK  KKKKKKKKKKKK
   433  222 H K  E     -P  418   0F 121  127   48  R K  RR RRT R  R R RKTTRK RRR  RR R RKK RR KRRR RRRRRKKK  RRRRRRRRRRRR
   434  223 H I        -     0   0    4  123   30  V V  VV VVV V  V V VVVVVV VVV  VV V VVV VV VVVV VVVVVVVV  VVVVVVVVVVVV
   435  224 H V        -     0   0   79  112   59  E E  EE EGA E  E E GEEEEE EEE  EG G EEE EE EEEE GGG EEEE  EEEEEGGDGDGG
   436  225 H P              0   0   73  103   61  S P  IP PEP P  I I TPRRLP PII  IT T LPP PP PIII  TT PPPP  PPPPPTT   TR
   437  226 H R              0   0  167   89   21  K K  KK KR  K  K K KKKKKK KKK  KK K KKK KK KKKK  KK KKKK  KKKKKKK   K 
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1    1 L D              0   0  100   77   31      Q          Q  Q Q              E         Q       Q       Q        
     2    2 L I        -     0   0    0   88   32      I          I  I I              T         I       S       S        
     3    3 L V        -     0   0   88   98   48      V          V  V V              I         T       V       V        
     4    4 L M  E     -Q   25   0G  12  101   21      I          L  L L              V         V       L       M        
     5    5 L T  E     -Q   24   0G  80  101   14      T          T  T T              T         T       T       T        
     6    6 L Q  E     -Q   23   0G  19  101    5      Q          Q  Q Q              Q         Q       Q       Q        
     7    7 L S  E    S+Q   22   0G  57  101   57      T          S  S S              S         S       P       R        
     8    8 L P        -     0   0   47  148    6      P          P  P P              L         P      P.   P PPPP      P
     9    9 L A  S    S-     0   0   79  156   68      A          D  D D              A         S      PP   P PPSP      P
    10   10 L S  E     -t  107   0H  78  168   57      S          Y  Y Y              L         S      SS   S SSAS      S
    11   11 L L  E     -t  108   0H  34  204   48      L          V  V V            V L  V   VV K      VV   V VASV      V
    12   12 L V  E     +t  109   0H  86  214   38      H          S  S S            S S  S   SS S      SS   S SSGS   SS S
    13   13 L V  E     -t  110   0H  17  216   57      V          V  V V            VVA  A   VV V      GG   V GGTG   VV V
    14   14 L S  E >   -t  111   0H  46  224   63      N          S  S S            SAA  AS SSSSL      AA   A ATPSSSSSS A
    15   15 L L  T 3  S+     0   0   79  225   67      P          L  P P            PPP  SP PPPPP      PP   P PP.LPPPPP P
    16   16 L G  T 3  S+     0   0   39  233    6      G          G  G G            GGG  GG GGGGG      GG   G GGGGGGGGG G
    17   17 L Q    <   -     0   0   97  233   51      D          E  E E            QQD  QQ QQQQE      QQ   Q QQQQQQQQQ Q
    18   18 L R        -     0   0  152  233   63      R          T  T T            PTK  TS SPPSS      GR   T TRRRSSSTT T
    19   19 L A  E     - R   0  79G   2  233   43      V          V  V A            AAV  AV VAAVI      VV   A VVVVVVVAA A
    20   20 L T  E     - R   0  78G  66  233   58      T          T  T T            SRT  RT TSSTT      TT   R TTTTTTTSS R
    21   21 L I  E     - R   0  77G   0  233   23      I          L  I L            III  II IIIII      II   I IIIIIIIII I
    22   22 L S  E     -QR   7  76G  36  233   53      Q          T  T T            TTT  TS STTST      SS   T SSSSSSSTT S
    23   23 L a  E     -QR   6  75G   0  233    0      C          C  C C            CCC  CC CCCCC      CC   C CCCCCCCCC C
    24   24 L R  E     -QR   5  74G 153  233   76      K          K  K K            SGK  GT TSSTR      TT   G TSSTTTTSS S
    25   25 L A  E     -Q    4   0G   6  233   70      A          A  A A            GGA  GG GGGGT      GG   G GGGGGGGGG E
    26   26 L S  S    S+     0   0   63  233   52      S          S  S S            DNS  DT TDDTS      SS   N SSSSTTTDD N
    27   27 L E  S    S-     0   0  105  233   74      S          S  S S            KDQ  NS SKKSS      SS   N SSSSSSSKK N
    28   27AL S        -     0   0   29  233   75      S          s  s S            FID  IS SFFSS      SS   I TSSSSSSLL I
    29   27BL V        +     0   0    0   70   75      .          v  a .            ...  .. .....      ..   . ......... .
    30   27CL D  E     +Z   35   0I  45   97   81      .          Y  D .            ...  .D D..D.      ..   . ...NDDD.. .
    31   27DL S  E >  S+Z   34   0I  15  133   82      .          S  S .            ...  .I I..I.      NN   . NNNIIII.. .
    32   28 L Y  T 3  S-     0   0  173  140   87      .          D  D .            ...  .G G..G.      II   . IIIGGGG.. .
    33   29 L G  T 3  S+     0   0   81  224   59      M          G  G V            GGI  GG GGGGV      gg   G gGGGGGGGG G
    34   30 L K  E <  S-Z   31   0I 112  182   77      S          D  D S            NND  SY YNNYN      gg   S gNSGYYYDD T
    35   31 L S  E     -Z   30   0I   7  205   76      N          S  N N            AKD  KN NAANG      YY   K YNNNNNNEE K
    36   32 L F        +     0   0    5  218   67      D          L  R W            YYD  NR RYYRY      GD   S AYFGRRRYY S
    37   33 L M  E     -U   94   0H   0  225   52      M          I  I L            AVM  VV VAAVM      VV   V VVVVVVVAA V
    38   34 L H  E     -U   93   0H   0  229   82      A          F  A A            YYN  HS SYYSH      HH   H HYYGSSSYY H
    39   35 L W  E     -UV  92  52H   0  233    0      L          W  W W            WWW  WW WWWWF      WW   W WWWWWWWWW W
    40   36 L Y  E     -UV  91  50H   0  233   14      Y          F  Y Y            YYY  YY YYYYH      YY   Y YYYYYYYYY Y
    41   37 L Q  E     -UV  90  49H   4  233   29      Q          Q  Q Q            QQQ  QQ QQQQQ      QQ   Q QQQRQQQQQ Q
    42   38 L Q  E     -U   89   0H  16  233   12      F          Q  Q Q            QQQ  QQ QQQQQ      QQ   Q QQQQQQQQQ Q
    43   39 L K    >   -     0   0   47  233   62      I          K  K K            KKK  KH HKKHK      LL   K FLLIHHHKK K
    44   40 L P  T 3  S+     0   0   81  233   36      L          S  S S            PPP  PP PPPPP      PP   P PPPPPPPPP S
    45   41 L G  T 3  S+     0   0   58  232   13      G          G  G G            GGG  AG GGGGG      GG   G GGGGGGGGG G
    46   42 L Q  S <  S-     0   0  103  233   69      Q          K  Q Q            QQE  QK KQQKQ      TT   Q ATTSKKKQQ Q
    47   43 L P        -     0   0   34  233   59      K          A  A A            VAT  AA AVVAK      AA   A AAAAAAASS A
    48   44 L P        -     0   0    5  233   10      P          P  P P            PPL  PP PPPPP      PP   P PPPPPPPPP P
    49   45 L K  E     -V   41   0H  96  233   63      K          K  K K            VVM  VK KVVKR      KR   V KKKKKKKVV V
    50   46 L V  E     +V   40   0H  10  233   45      L          T  L L            LLL  LL LLLLL      LL   L VLLTLLLLL L
    51   47 L L  E     +     0   0H   2  233   23      L          L  L L            VVI  VM MVVML      LL   V LLLLMMMVV V
    52   48 L I  E     -VW  39  58H   0  233   35      I          I  I I            III  II IIIII      II   V IIIIIIIII V
    53   49 L Y  E  >  + W   0  57H  54  232   23      H          Y  Y Y            YYR  YY YYYYY      SY   Y YYYYYYYYY Y
    54   50 L I  T >4 S-     0   0   10  233   88      D          W  Y G            KEE  AE EKKES      NG   D GSSNEEEQQ G
    55   51 L A  T 34 S+     0   0    2  233   75      A          A  A A            NDA  DV VNNVT      NN   D NNDSVVVDD D
    56   52 L S  T 34 S+     0   0   73  233   63      T          T  N S            SST  SS SSSSS      SS   S YNNNSSSSS S
    57   53 L N  E <<  -W   53   0H  77  233   74      S          R  S T            NNT  KK KNNKN      NN   D NQQNKKKKK D
    58   54 L L  E     -W   52   0H  63  233   66      R          R  R R            RRR  RR RRRRR      RR   R RRRRRRRRR R
    59   55 L E    >   -     0   0   49  233   81      F          H  H H            PPL  PP PPPPF      PP   P PPPPPPPPP P
    60   56 L S  T 3  S+     0   0  107  233   40      T          T  T T            SSS  SS SSSSS      SS   S SSSSSSSSS S
    61   57 L G  T 3  S+     0   0   67  233   21      G          G  G G            GGG  GG GGGGG      GG   G GGGGGGGGG G
    62   58 L V    <   -     0   0   17  233   47      T          T  T T            IIV  IV VIIVV      VV   I VVVVVVVII I
    63   59 L P    >   -     0   0   62  233   27      P          P  P P            PPP  PS SPPSS      PP   P PPPPSSSPP P
    64   60 L A  T 3  S+     0   0   99  233   58      D          E  E E            EES  ED DEEDN      DD   E DVDDDDDEE E
    65   61 L R  T 3  S+     0   0   30  233    8      H          R  R R            RRR  RR RRRRR      RR   R RRRRRRRRR R
    66   62 L F  E <   -S   79   0G   7  233    1      F          I  I I            FFF  FF FFFFF      FF   F FFFFFFFFF F
    67   63 L S  E     -S   78   0G  59  233   24      S          S  S S            SST  SS SSSSS      SS   S SSSSSSSSS S
    68   64 L G  E     +S   77   0G  17  233   11      G          G  G G            GGG  GG GGGGG      GG   G GGGGGGGGG G
    69   65 L S  E     +S   76   0G  48  233   40      S          S  S S            SSS  SS SSSSS      SS   S SSSSSSSSS S
    70   66 L G  E     -S   75   0G  35  233   77      Y          G  G G            NNG  NK KNNKG      KK   N KKKRKKKNN N
    71   67 L S  E >   +S   74   0G  68  232   24      S          S  S S            SS.  SS SSSSS      SS   S SSSSSSSSS S
    72   68 L R  T 3  S-     0   0  163  232   35      G          G  G G            GG.  GG GGGGG      GG   G GGGGGGGGG G
    73   69 L T  T 3  S+     0   0   51  232   58      T          T  T T            NN.  NN NNNNT      TT   N TTTNNNNNN N
    74   70 L D  E <   +RS  24  71G  77  232   64      D          D  D D            TT.  TT TTTTD      SS   T SSSTTTTTT T
    75   71 L F  E     -RS  23  70G   0  232   81      F          F  F F            AA.  AA AAAAY      AA   A AAAAAAAAA A
    76   72 L T  E     -RS  22  69G  33  232   61      T          T  T T            TT.  TS STTSS      SS   T SSSTSSSTT T
    77   73 L L  E     -RS  21  68G   0  232    4      F          L  L L            LL.  LL LLLLF      LL   L LLLLLLLLL L
    78   74 L T  E     -RS  20  67G  28  232   48      T          T  T T            TT.  TT TTTTT      AA   T AAATTTTTT T
    79   75 L I  E     -RS  19  66G   0  232    4      I          I  I I            II.  II IIIII      II   I IIIIIIIII I
    80   76 L D  S    S+     0   0   68  232   42      S          S  S S            SS.  SS SSSSS      AT   S TSSSSSSSS S
    81   77 L P  S    S-     0   0   51  232   61      G          R  R R            GA.  RG GGGGN      GG   R GGGSGGGGG R
    82   78 L V        +     0   0    0  232   50      V          M  M M            VV.  VL LVVLV      LL   V LLLLLLLTT V
    83   79 L E    >   -     0   0   93  232   36      R          E  E E            EE.  EQ QEEQQ      QQ   D QRRQQQQQQ E
    84   80 L A  G >  S+     0   0   22  232   55      P          A  A A            AA.  AA AAAAT      AA   A ASSGAAAAA A
    85   81 L D  G 3  S+     0   0   58  232   28      E          E  E E            GG.  GE EGGEE      EE   G EDEEEEEMM G
    86   82 L D  G <   +     0   0    1  232    0      D          D  D D            DD.  DD DDDDD      DD   D DDDDDDDDD D
    87   83 L A    <   +     0   0   12  232   78      A          A  A A            EE.  EE EEEEA      EE   E EEEEEEEEE D
    88   84 L A  E    S- X   0 108H   8  232   20      A          A  A A            AA.  AA AAAAG      AA   A AAAAAAAAA A
    89   85 L T  E     -UX  42 107H  35  233   69      E          D  D D            DDP  DD DDDDD      DD   D DDDDDDDDD D
    90   86 L Y  E     -UX  41 106H   0  233    4      Y          Y  Y Y            YYG  YY YYYYY      YY   Y YYYYYYYYY Y
    91   87 L Y  E     -U   40   0H   9  233    6      Y          Y  Y Y            YYF  YY YYYYY      YY   Y YYYYYYYYY F
    92   88 L a  E     -U   39   0H   0  233    4      C          C  C C            CCC  CC CLSCC      CC   C CCCCCCCCC C
    93   89 L Q  E     -UY  38 102H   1  233   79      G          M  Q Q            AQS  QS SNFSQ      QQ   Q QAAASSSQQ Q
    94   90 L Q  E     +UY  37 101H   0  233   84      Q          Q  Q Q            TVV  VS SILSQ      SS   L STTTSSSAA V
    95   91 L N        +     0   0    0  206   57      G          D  G Y            SWR  WY YKYYG      YY   W YWWYYYYWW W
    96   92 L N  S    S+     0   0    1  213   78      y          F  W w            yda  da adeay      dd   d dddeaaadd a
    97   93 L E  S    S-     0   0   48  212   78      .          Q  E p            cha  cs scqsv      sg   d ssstvgvss h
    98   94 L D  S    S+     0   0   42  216   73      .          S  L L            YCY  YL LYCLW      lV   H VllWLLLLL L
    99   95 L P  S    S-     0   0   26  119   74      p          P  P .            ...  .C C..C.      g.   P .rgH...CC .
   100   96 L P        -     0   0    4  155   90      F          Y  L T            .W.  .Y Y.VYY      R.   V .PPG...YY V
   101   97 L T  E     -Y   94   0H  26  200   64      T          T  N H            IV.  II IILIT      VM   V .VVV...VV I
   102   98 L F  E     -Y   93   0H  26  231   16      F          F  F F            FFF  FF FFFFF      FF   F FFFFFFFFF F
   103   99 L G        -     0   0    3  233   17      G          G  G G            GGL  GG GGGGG      GG   G GGGGGGGGG G
   104  100 L A        -     0   0   81  233   63      A          G  K G            AGQ  AA AAGAK      GG   G AGGSGGGTT G
   105  101 L G        -     0   0   12  233   14      P          G  G G            GGG  GG GGGGG      GG   G GGGGGGGGG G
   106  102 L T  E     - X   0  90H   0  233   14      T          T  T T            TTT  TT TTTTT      TT   T TTTTTTTTT T
   107  103 L K  E     -tX  10  89H  74  233   53      K          R  R R            RKM  RR RRRRK      RK   K KKKTRRRKK K
   108  104 L L  E     +tX  11  88H   2  232   22      L          V  V V            LLP  LL LLLLL      LL   L VLLLLLLVV L
   109  105 L E  E     -t   12   0H  14  233   69      M          E  E E            TTE  TT TTTTR      TT   T TTTTTTTTT T
   110  106 L M  E     -t   13   0H   0  233   29      V          I  I I            VVS  VV VVVVV      VV   V VVVVVVVVV V
   111  107 L R  E     +t   14   0H 126  233   86      K          K  K K            LLK  LL LLLLK      LL   L LLLLLLLLL L
   112  108 L R        -     0   0   64  233   79      Q          R  R R            GGR  GG GGGGS      SG   G GGSGGGGGG S
   113  109 L A        -     0   0   71  221   67      R          A  N A            QQN  QQ QQQQG      QQ   Q QQQQQQQQQ Q
   114  110 L D        -     0   0   58  226   72      d          D  D D            ppV  pp ppppt      pp   p ppppppppp p
   115  111 L A  B     -A  144   0J  19  225   58      a          A  A A            aaA  aa aaaat      aa   a aaasaaaaa a
   116  112 L A        -     0   0   40  229   62      A          I  K I            SKK  SS SSASA      AA   A NAAPAAANN A
   117  113 L P        -     0   0    9  229    4      P          P  P P            PPP  PP PPPPP      PP   P PPPPPPPPP P
   118  114 L T  E     -B  141   0K  85  232   60      S          V  A V            TTS  TT TTSTS      SS   S TSSSSSSTT S
   119  115 L V  E     -B  140   0K   8  233   26      A          V  V V            VVT  VV VVVVV      VV   V VVVVVVVVV V
   120  116 L S  E     -B  139   0K  17  233   67      S          F  F F            TTF  TT TTTTS      TT   T TTTTTTTTT T
   121  117 L I  E     -B  138   0K  22  233   31      I          I  I I            LLI  LL LLLLL      LL   L LLLLLLLLL L
   122  118 L F  E     -B  137   0K   4  233    7      F          F  F F            FFF  FF FFFFL      FF   F FFFFFFFFF F
   123  119 L P        -     0   0    5  233   25      P          K  K K            PPP  PP PPPPP      PP   P PPPPPPPPP P
   124  120 L P        -     0   0    1  233    9      P          P  P P            PPP  PP PPPPP      PP   P PPPPPPPPP P
   125  121 L S    >>  -     0   0    8  233   10      S          S  S S            SSS  SS SSSSS      SS   S SSSSSSSSS S
   126  122 L S  H 3> S+     0   0   78  233   64      Q          E  D E            SSQ  SS SSSSS      SS   S SSSTSSSSS S
   127  123 L E  H 3> S+     0   0   76  233   30      E          E  E E            EEQ  EE EEEED      EE   E EEEEEEEEE E
   128  124 L Q  H <4>S+     0   0    8  233   30      Q          Q  Q Q            EEQ  EE EEEEE      EE   E EEEEEEEEE E
   129  125 L L  H ><5S+     0   0   29  233   22      L          V  V V            LLL  LL LLLLL      LL   L LLLLLLLLL L
   130  126 L T  H 3<5S+     0   0  111  233   69      K          K  K K            QQQ  QQ QQQQA      QQ   Q QQQNQQQQQ Q
   131  127 L S  T 3<5S-     0   0   83  233   68      T          E  E E            AAT  AA AAAAE      AA   A AAAGAAAAA A
   132  128 L G  T < 5S+     0   0   34  233   54      N          G  G G            NNG  NN NNNNn      NN   N NNNNNNNNN N
   133  129 L G  E   < - C   0 186K  21  216   60      S          N  N N            KKK  KK KKKKk      KK   K KKKKKKKKK K
   134  130 L A  E     - C   0 185K   0  225   19      A          P  P P            AAA  AA AAAAA      AA   A AAAAAAAAA A
   135  131 L S  E     - C   0 184K   2  226   39      T          T  T T            TTS  TT TTTTT      TT   T TTTTTTTTT T
   136  132 L V  E     - C   0 183K   0  226   35      M          A  A A            LLV  LL LLLLL      LL   L LLLLLLLLL L
   137  133 L V  E     -BC 122 182K   0  226   15      V          V  V V            VVV  VV VVVVV      VV   V VVVVVVVVV V
   138  134 L b  E     -BC 121 181K   0  227    9      C          C  C C            CCC  CC CCCCC      CC   C CCCCCCCCC C
   139  135 L F  E     -BC 120 180K   0  228   40      L          L  L L            LLL  LL LLLLM      LL   L LLLLLLLLL L
   140  136 L L  E     -BC 119 179K   0  228   49      V          I  I I            IIL  II IIIII      II   I IIIIIIIII I
   141  137 L N  E     -B  118   0K   2  221   47      T          N  N N            SSN  SS SSSSN      SS   S SSSSSSSSS S
   142  138 L N  E    S+     0   0K  49  225   49      G          N  N N            DDG  DD DDDDN      DD   D DDDDDDDDD D
   143  139 L F  E     - C   0 177K   0  226   41      F          F  F F            FFF  FF FFFFF      FF   F FFFFFFFFF F
   144  140 L Y  B    S+A  115   0J   9  226   46      Y          Y  F Y            YYY  YY YYYYY      YY   Y YYYYYYYYY Y
   145  141 L P  S    S-     0   0   18  226   16      P          P  P P            PPP  PP PPPPP      PP   P PPPPPPPPP P
   146  142 L K  S    S+     0   0   83  227   74      S          R  R R            GGR  GG GGGGE      GG   G GGGGGGGGG G
   147  143 L D        +     0   0  116  228   78      D          S  D S            VAE  VV VVAVD      AA   A AAASAAAAA A
   148  144 L I        -     0   0   19  228   60      L          V  L V            VVI  VV VVVVV      VV   V VVVVVVVVV V
   149  145 L N  E     -E  201   0L  82  228   67      N          T  T T            KTN  KK KKEKE      TT   T TTTTEEETT T
   150  146 L V  E     -E  200   0L  27  228   12      V          I  V I            VVV  VV VVVVV      VV   V VVVVVVVVV V
   151  147 L K  E     -E  199   0L  53  228   76      A          K  T K            AAK  AA AAAAE      AA   A AAAVAAAAA A
   152  148 L W  E     +E  198   0L   3  228    3      W          W  W W            WWW  WW WWWWW      WW   W WWWWWWWWW W
   153  149 L K  E     +EF 197 158L  76  229   45      K          K  K K            KKK  KK KKKKR      KK   K KKKKKKKKK K
   154  150 L I  E    S-E  196   0L   0  229   68      A          V  V V            AAV  AA AAAAM      AA   A AAAAAAAAA A
   155  151 L D  S    S-     0   0   71  229   24      D          D  D D            DDD  DD DDDDD      DD   D DDDDDDDDD D
   156  152 L G  S    S+     0   0   63  230   38      G          G  S G            GGG  GG GGGGK      SS   S GSSGGGGGG S
   157  153 L S  S    S-     0   0   33  229   65      K          Q  Q Q            SSV  SS SSSST      SS   S SSSSSSSSS S
   158  154 L E  B     -F  153   0L  85  229   76      A          D  D D            APV  AA AAAAL      PP   P PPPTAAAPP P
   159  155 L R        -     0   0   69  231   75      V          V  V V            VVQ  VV VVVVV      VV   V VVVIVVVVV V
   160  156 L Q        +     0   0  133  232   75      T          I  S I            NKT  NN NNNNS      KK   K KKKTNNNKK K
   161  157 L N  S    S+     0   0  117  233   70      G          A  S A            AAN  AA AAAAK      AA   A AAARAAAAA A
   162  158 L G  S    S+     0   0   29  233   33      D          S  S S            GGG  GG GGGGG      GG   G GGGNGGGGG G
   163  159 L V  E     -D  183   0K  46   68   75      .          D  D D            ..I  .. .....      ..   . ......... .
   164  160 L L  E     -D  182   0K  16  212   47      V          I  V I            VVQ  VV VVVVV      VV   V VVVVVVVVV V
   165  161 L N  E     +D  181   0K  52  216   55      Q          K  K K            EEN  EE EEEEQ      EE   E EEEEEEEEE E
   166  162 L S  E     -D  180   0K  12  224   49      T          N  T N            TTS  TT TTTTT      TT   T TTTTTTTTT T
   167  163 L W  E     -D  179   0K  99  224   71      S          S  S S            TTA  TT TTTTS      TT   T TTTTTTTTT T
   168  164 L T        -     0   0   24  225   66      S          D  D D            TTT  TT TTKTA      TT   T KTTRKKKTT T
   169  165 L D        -     0   0   99  226   74      A          Y  F Y            PPE  PP PPPPS      PP   P PPPAPPPPP P
   170  166 L Q        -     0   0   18  229   76      A          M  M M            SSQ  SS SSSSL      SS   S SSSSSSSSS S
   171  167 L D     >  -     0   0   48  229   61      S          Q  Q Q            KKN  KK KKKKK      KK   K KKKKKKKKK K
   172  168 L S  T  4 S+     0   0   54  232   60      E          E  E E            QQS  QQ QQQQE      QQ   Q QQQQQQQQQ Q
   173  169 L K  T  4 S+     0   0  180  232   58      A          S  S S            SSK  SS SSSSS      SS   S SSSSSSSSS S
   174  170 L D  T  4 S-     0   0   57  232   39      D          D  D D            NND  NN NNNNN      NN   N NNNNNNNNN N
   175  171 L S     <  +     0   0    4  232   57      K          N  S N            NNN  NN NNNNG      NN   N NNNSNNNNN N
   176  172 L T        -     0   0    5  232   72      T          T  T T            KKT  KK KKKKL      KK   K KKKKKKKKK K
   177  173 L Y  E     -C  143   0K   7  226    4      Y          Y  Y Y            YYY  YY YYYYY      YY   Y YYYYYYYYY Y
   178  174 L S  E     -     0   0K   1  226   72      K          S  S S            AAS  AA AAAAS      AA   A AAAAAAAAA A
   179  175 L M  E     -CD 140 167K   0  227   79      L          Q  Q Q            AAL  AA AAAAA      AA   A AAAAAAAAA A
   180  176 L S  E     -CD 139 166K   3  229    6      S          S  S S            SSS  SS SSSSN      SS   S SSSSSSSSS S
   181  177 L S  E     -CD 138 165K   0  229    4      S          S  S S            SSS  SS SSSSS      SS   S SSSSSSSSS S
   182  178 L T  E     -CD 137 164K   2  230   72      T          M  M M            YYI  YY YYYYI      YY   Y YYYYYYYYY Y
   183  179 L L  E     -CD 136 163K   0  231    1      L          L  L L            LLL  LL LLLLL      LL   L LLLLLLLLL L
   184  180 L T  E     +C  135   0K  36  231   54      T          T  T T            SST  SS SSSST      SS   S SSSSSSSSS S
   185  181 L L  E     -C  134   0K  16  231   14      L          L  L L            LLL  LL LLLLL      LL   L LLLLLLLLL L
   186  182 L T  E  >  -C  133   0K  81  230   58      S          T  T T            TTS  TT TTTTS      TT   T TTTTTTTTT T
   187  183 L K  H >> S+     0   0   66  227   67      R          K  K K            SPS  SS SSSSS      PP   P PPPSSSSPP P
   188  184 L D  H 3> S+     0   0  109  228   63      D          D  D D            DES  DD DDDDS      EE   E EEESDDDEE E
   189  185 L E  H >4 S+     0   0   53  228   49      E          K  K K            QQE  QQ QQQQE      QQ   Q QQQDQQQQQ Q
   190  186 L Y  H X< S+     0   0    6  226   12      Y          W  W W            WWY  WW WWWWW      WW   W WWWWWWWWW W
   191  187 L E  H 3< S+     0   0   90  226   71      N          D  D D            KKK  KK KKKKT      KK   K KKKKKKKKK K
   192  188 L R  T << S+     0   0  160  226   61      S          K  K K            SSS  SS SSSSS      SS   S SSSSSSSSS S
   193  189 L H    <   -     0   0   24  224   55      H          S  A S            HHH  HH HHHHH      HH   H HHHKHHHHH H
   194  190 L N  S    S+     0   0   97  224   71      D          E  D E            KRN  KK KKKKS      RR   R RRKGKKKKK R
   195  191 L S  E     + G   0 214L  37  224   71      T          K  K K            SSV  SS SSSST      SS   S SSSSSSSSS S
   196  192 L Y  E     +EG 154 213L   0  224   14      Y          F  F F            YYY  YY YYYYY      YY   Y YYYYYYYYY Y
   197  193 L T  E     -EG 153 212L   3  223   48      D          E  E E            SSA  SS SSSSS      SS   S SSSSSSSSS S
   198  194 L b  E     -EG 152 211L   1  223    0      C          C  C C            CCC  CC CCCCC      CC   C CCCCCCCCC C
   199  195 L E  E     -EG 151 210L  34  212   62      E          L  L L            QQE  QQ QQQQN      QQ   Q Q QEQQQQQ Q
   200  196 L A  E     -EG 150 209L   1  212   22      V          V  V V            VVI  VV VVVVV      VV   V V VVVVVVV V
   201  197 L T  E     +E  149   0L  36  212   35      T          Q  K Q            TTT  TT TTTTK      TT   T T TTTTTTT T
   202  198 L H  E >   - G   0 205L  18  212   27      H          H  H H            HHH  HH HHHHH      HH   H H HHHHHHH H
   203  199 L K  T 3  S+     0   0  145  211   56      K          K  K K            EEQ  EE EEEEE      EE   E E EEEEEEE E
   204  200 L T  T 3  S+     0   0   55  211   41      T          T  T T            GGS  GG GGGGS      GG   G G GGGGGGG G
   205  201 L S  E <   -G  202   0L  45  187   83      L                            SSL  SS SSSSS      SS   S S SSSSSSS S
   206  202 L T  E    S+     0   0L 140  187   30      T                            TTN  TT TTTTQ      TT   T T TTTTTTT T
   207  203 L S  E    S-     0   0L  82   90   51      K                              S         S                        
   208  204 L P  E     -     0   0L  43   67   33      P                              A         P                        
   209  205 L I  E     -G  200   0L  46   67   29      L                              F         V                        
   210  206 L V  E     +G  199   0L  70   63   53      V                              V         S                        
   211  207 L K  E     +G  198   0L  85   63   26      K                              K         D                        
   212  208 L S  E     -G  197   0L  67   63   28      S                              S         S                        
   213  209 L F  E     -G  196   0L  30   63   18      F                              F         F                        
   214  210 L N  E      G  195   0L  99   63   62      R                              N         E                        
   215  211 L R              0   0   82   54   19      R                              R         R                        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  213   30  EEQQ EEEEEEEEEE DD Q E EQEDEEQDEE   EQ  Q     QQQDQQ  DEQ Q           
   218    2 H V        +     0   0   30  215   38  EVLV EVEEEEEEEE IV V E EVEVVVVVVV   VV  I     VVIVVV  VVV V         V 
   219    3 H K  E     -A  241   0A 143  215   52  KKQQ KKKNKKRKKK QQ Q K KQKQQQQQQQ   QQ  T     TTTQHT  QQQ Q         L 
   220    4 H L  E     -A  240   0A  11  231    3  LLLL VLLLVLLLLL LL L LLVLLLLLLLLL   LL  L     LLLLLL  LLL L         L 
   221    5 H Q  E     -A  239   0A 120  231   74  VVQV VVVVVVVVVV VQ V VQVRVQVVQDVV   QV  D     KKDAKK  AVV K         T 
   222    6 H E  E     -A  238   0A   2  232   34  EEEQ EEEEEEEEEE QE Q EEEEEEEEEQEE   EE  Q     EEQQEG  QEQ E         E 
   223    7 H S  E     +A  237   0A  48  232   22  SSSS SSSSSSSSSS SS S SSSSSSSSSSSS   SS  P     SSPSTS  SSS S         S 
   224    8 H G        -     0   0   35  232   24  GGGG GGGGGGGGGG GG G GGGGGGGGGEGG   GG  G     GGGEGG  EGG G         G 
   225    9 H P        -     0   0   50  232   51  RGPA GGGGGGGGGG AP A GPGPGPGGPSGG   PG  S     PPSPPP  SGA P         G 
   226   10 H A  S    S+     0   0   30  232   54  GGGE GGGGGGGGGG ED E GGGSGGGGGVGG   GG  A     GGAVGG  VGE D         D 
   227   11 H V  E     -d  334   0B  33  233   26  LLLV LLLLLLLLLL VL V LTLLLLLLLVLL   LV  V     IIVVLI  VLV L         I 
   228   12 H I  E     -d  335   0B   9  233   54  VVVK VVVVVVVVVV KV K VVVVVVVVVIVV   VV  V     LLVIVL  IVK V         K 
   229   13 H K        -     0   0  104  233   49  QQKK QQQQQQQQQQ RK K QKQKEKQQRKQQ   KL  N     QQNKAQ  KQK A         K 
   230   14 H P  S    S+     0   0   56  233   12  PPPP PPPPPPPPPP PP P PPPPPPPPPPPP   PP  P     PPPPPP  PPT P         P 
   231   15 H S  S    S+     0   0   90  233   20  GGSA GGGGGGGGGG GS G GSGSGSGGSGGG   SG  S     SSSGSS  GGG S         G 
   232   16 H Q  S    S-     0   0   76  233   60  GGES GGGGGGGGGG EQ S GEGQGQGGEGGG   QG  G     QQGGQQ  GGA Q         E 
   233   17 H S        -     0   0   51  232   21  SSTS SSSSSSSSSS SS . SSSTSSSSTSSS   SS  T     TTTSST  SSS S         S 
   234   18 H L  E     - B   0 300A   1  232   46  LLLV LLLLLLLLLL LL . LLLLLLLLLHLL   LL  L     LLLHLL  HLV L         L 
   235   19 H S  E     - B   0 299A  64  233   50  RRSK RKRRRRRRRS RS S RRRSRSRRSKRR   SR  K     SSKKSS  KRK S         M 
   236   20 H L  E     - B   0 298A   1  233   15  LLLV LLLLLLLLLL IL V LLLLLLLLLLLL   LL  L     LLLLIL  LLV I         L 
   237   21 H T  E     -AB 223 297A  29  233   34  SSTS SSSSSSSSSS ST R ATSTSTSSTSSS   TS  S     TTSSTT  SSS T         S 
   238   22 H c  E     -AB 222 296A   0  234    0  CCCC CCCCCCCCCC CC V CCCCCCCCCCCC   CC  C     CCCCCC  CCC C         C 
   239   23 H I  E     -AB 221 295A  54  233   74  VVTK GVVVVVVVVV KT S VTVTVSAAATAA   SA  K     SSKTTS  TAK T         K 
   240   24 H V  E     -A  220   0A   4  233   54  GGVA GGGGGGGGGG GV C GVGAGVAAVAAA   VA  V     VFVAVF  AAA V         A 
   241   25 H S  E     +A  219   0A  60  234    9  SSSS SSSSSSSSSS ST R SSSSSTSSSSSS   TS  S     SSSSSS  SSS S         S 
   242   26 H G  S    S+     0   0   54  228    4  GGGG GGGGGGGGGG GG A .GGGGGGGGGGG   GG  .     GG.GGG  GGG G         D 
   243   27 H F  S    S-     0   0   37  199   30  FFGG FYFIFFLFFI YY S .FFFFYFFYFFF   YF  .     FF.FFF  FFY F         V 
   244   28 H S    >   -     0   0   44  201   49  DTST TIDTDTDDTT TS G .ETSRSTTSKTT   SR  .     SS.TSS  TTS A         N 
   245   29 H I  T 3  S+     0   0    2  232   27  FFVF LFFFFFFFFF FI G GLFLFIFFIFFF   IF  V     LLVFLL  FVI L         F 
   246   30 H T  T 3   +     0   0   59  232   53  SNSG SSSSSSSKSS TT A FRSSSTNSSSSS   TR  S     TSSSTS  SSS T         N 
   247   31 H R  S X  S-     0   0  145  234   77  RTNT RSDRDYDKSS DS L RSTSGSSSSSSN   SD  V     TTVTDT  DND S         S 
   248   32 H T  T 3  S+     0   0   72   68   71  S.R. D...T.H... .. A N...........   ..  S     FYS..Y  ... .         . 
   249   33 H N  T 3  S+     0   0   16   73   70  T.N. A...A.A... .G N I....G..G...   S.  S     GGS..G  ... .         . 
   250   34 H Y  E <   -E  317   0C  23  234   47  HYYY VVYYFYFYYY YY Y NYTYYYYYYYYY   YY  A     LIQSYM  YYN Y         Y 
   251   35 H d  E     -EF 316 270C   0  224   90  .NYA .GAS.E.AEA WG A VSYGPYAAWWAY   RD  P     GGHWGC  YGY A         H 
   252   35AH W  E     -EF 315 269C   1  222   46  IMWI .MFV.I.VIV IW I IMIIIWMMWMMM   WM  W     VVWMVV  MII I         M 
   253   35BH H  E     -EF 314 268C   0  231   72  NIGS STSTSSSTST GH S NDNNGNDDSNDS   NH  G     GGANHG  NHH S         E 
   254   36 H W  E     +EF 313 267C   1  233    1  WWWW WWWWWWWWWW WW W WWWWWWWWWWWW   WW  W     WWWWWW  LWW W         W 
   255   37 H I  E     -EF 312 265C   0  233   13  VVIV VVVVVVVVVV VI V IIVVVIVVIVVT   IV  I     IIIVVI  VVV V         V 
   256   38 H R  E     -EF 311 264C  10  234   15  RRRR RRRRRRRRRR RR R RRRRRRRRRRRR   RR  W     RRWRRR  RRR R         R 
   257   39 H Q  E     -EF 310 263C  22  233    3  QQQQ QQQQQQQQQQ QQ Q QQQQQQQQQQQQ   KQ  Q     QQQQQQ  QQQ Q         Q 
   258   40 H A    >   -     0   0   14  233   59  AVPA AAAAAAAAAA MF A APAASFAAPDAA   FS  A     PPAAPS  AAA P         H 
   259   41 H P  T 3  S+     0   0   99  234   20  PPPP PPPPPPPPPP PP P PPPPPPPPPPPP   PP  P     SSPPPS  PPP P         S 
   260   42 H G  T 3  S+     0   0   94  234   11  GGGG GGGGGGGGGG GG G GGGGGGGGGDGG   GG  G     GGGGGG  GGG G         G 
   261   43 H K  S <  S-     0   0  140  234   34  KKKK KKKKKKKKKK KN Q KKKKRNKKKKKK   NE  K     KKKKKK  KKQ K         K 
   262   44 H G        -     0   0   20  234   23  GGGG GGGGGGGGGG GK G GGGAGKGGGRGG   KG  G     GGGGGG  GGG G         G 
   263   45 H L  E     -F  257   0C  10  234    6  LLLL LLLLLLLLLL LL L LLLLPLLLLLLL   LL  L     LLLLLL  LLL L         L 
   264   46 H E  E     -F  256   0C  79  234   10  EEEE EEEEEEEEEE EE E EEEEEEEEEQEE   EE  V     EEEQEE  QEE E         E 
   265   47 H W  E     +F  255   0C  13  234    9  WGWW WWSWWWWWWW LW W WWWCWWWWWWWW   WW  D     WWYWWW  WWW W         W 
   266   48 H M  E     -     0   0C   3  234   31  LLIM LLLLLLLLLL MM M LILLLMVVIVVV   MV  M     LLIVLL  VIM L         I 
   267   49 H G  E     -FG 254 277C   0  234   42  AAGG AAAAAAAAAA GG G AGAAAGSSGSSS   GA  G     AAGSIA  SSA G         A 
   268   50 H R  E     -FG 253 276C  10  234   92  SYSG GCGGVASGTG MY A TLACMYYYYRAY   YL  Y     HHYYVN  RFW V         E 
   269   51 H I  E     -FG 252 275C   3  234   20  IIII IIIVTSMVII II I FVIIIIIIIIII   II  L     IILIII  ILI I         V 
   270   52 H d  E >   -F  251   0C   0  234   84  SGYI WSWDGGGGTD DS I NYSTQNNNYTSN   NW  S     WWHSWW  SSR W         E 
   271   53 H Y  T 3  S+     0   0   47  234   85  tyYp nGsrTcRTTs pY p SStGsYYYHNGY   SY  s     WWsSSW  DyP T         N 
   272   54 H E  T 3  S-     0   0   63  232   61  ddNk ggssgsSsss nS r gIdGeDnnSdtn   Ad  p     DNpdDN  gdq G         D 
   273   55 H G  S <  S+     0   0   25  185   36  ..E. .g.GgGGtgG SG . gGSG.GggGdgg   Gt  .     DD.gGD  g.g G         G 
   274   56 H S        -     0   0   42  200   70  ..NQ .T.RDRGTGS GS T GSAN.SSSSISS   SK  .     EN.SSD  STG V         D 
   275   57 H I  E     -G  269   0C  71  215   54  T.TS TTTTTTTTTA TN T TTDTTNTTTTTT   TT  .     KK.TPK  TIT T         I 
   276   58 H Y  E     -G  268   0C  70  222   77  Y.YT FYYDYYYHYY KN D FSYAKNYYYYYY   NY  .     HY.YNY  VHV N         Y 
   277   59 H Y  E     -G  267   0C  41  227   14  YYYY YYYYYYYYYY YY Y YIAYYYYYYYYY   YY  .     YY.YYY  YYS Y         Y 
   278   60 H S    >>  -     0   0   11  231   57  AASA AVAATVAAAA NN A AAANSNAANNAA   NS  A     NNAANN  AAA N         A 
   279   61 H P  T 34 S+     0   0   76  234   56  DDPQ EDEDEDDDDD RP Q DDDPDPDDPDDD   PD  P     PTPDPP  DDE S         P 
   280   62 H S  T 34 S+     0   0   79  234   55  SSSK SSSSSSSSSS SS K SSFASSSSSSSS   SS  S     AASSAS  SSK A         S 
   281   63 H I  T X4 S+     0   0    4  234   43  VVLF VVVVVVVVVV FL F VLVLVLVVLFVV   LV  F     LLFVLL  VVF L         V 
   282   64 H K  G >< S+     0   0  133  234   33  KKKR KKKKKKKKKK EK R KKRKRKKKKKKK   KK  Q     KKQRKK  KKQ K         Q 
   283   65 H S  G 3  S+     0   0  116  234   31  GGSG GGGGGGGGGG GS G GNGSGNGGSGGG   SG  S     SSSGSN  GGG S         G 
   284   66 H R  G <  S+     0   0   51  234   16  RRRR RRRRRRRRRR HR R RRRRRRRRRRRR   RR  R     RRRRRR  RRR R         R 
   285   67 H S  E <   -C  300   0A  11  234   54  FFLV FFFFFFFFFF II V FVFLFIFFAFFF   IL  V     LLVFLL  FFV L         F 
   286   68 H T  E     -C  299   0A  67  220   24  TTTT TTTTTTTTTT TS T TTTNTSTTTTTT   ST  T     TTTTST  TTT S         A 
   287   69 H I  E     +C  298   0A   3  220   25  VIII IVIIIIIIII II I IIFIIIIIIIII   IV  F     IIFIII  III I         I 
   288   70 H S  E     -C  297   0A  56  234   45  SSFT SSSSSSSSSS ST S STSTSTSSSSSS   TS  T     SSTSSS  SST S         S 
   289   71 H R  E     -C  296   0A  71  234   70  RRVA RRRRRKSRRR AR A KKKKRRRRARRR   RR  G     KKRRKK  RRI K         R 
   290   72 H D  E >>> -C  295   0A  55  234   18  DDDD DDDDFDDDDD DD D VDDDDDDDDDDD   DD  D     DDDDDD  DDD D         D 
   291   73 H T  T 345S+     0   0   78  233   60  NNTE NNDDDNDNND MT E DNDKNTNNTNNN   TN  T     TTANNT  NNT N         V 
   292   74 H S  T 345S+     0   0  105  233   44  SSSS SSSSSSSSSS SS S SGSSSSAASNAA   SY  S     SSSNPS  NAS S         S 
   293   75 H L  T <45S-     0   0  103  234   70  QEKT QLQQQQQQQQ IK R QKQKQKKKKKKK   KK  K     INKNKN  NKL K         S 
   294   76 H N  T  <5 +     0   0   29  234   47  NNNN NNNNKNNNNN SN S NKNSGNNNNNNN   NN  N     NNNNSN  NNN S         S 
   295   77 H K  E   < -BC 239 290A  51  234   64  TTHT TTTTTTTTTT TQ T TQTQTQSSQNSS   QT  E     QQEKQQ  KST Q         M 
   296   78 H F  E     -BC 238 289A   1  234   61  AAFA AAAAAAVAAA AF A AVAVSFLLFLLL   FL  I     VVILVA  LLA V         L 
   297   79 H F  E     -BC 237 288A  50  234   27  YYSY YWYYYYFYYY YF Y YYYSYFYYSYYY   FY  Y     LFHYFF  YYY F         Y 
   298   80 H I  E     -BC 236 287A   4  234    5  LLLM LLLLLLLLLL LL M LLLLLLLLLLLL   LL  L     LLLLLL  LLM L         L 
   299   81 H Q  E     -BC 235 286A  73  234   36  QQRE QQQQQQQQQQ QQ E QQQSQKQQRQQQ   QE  E     KKQQKK  QQE K         Q 
   300   82 H L  E     -BC 234 285A   3  234   23  MMLL MMMMMMMMMM WL L MMMLMLMMLMMM   VM  M     IIIMMI  MML M         M 
   301   82AH I        +     0   0   70  234   62  NNTN NNNNNNNSNT TN N NTDSNNNNSNNS   NK  T     AATNNT  NNT N         N 
   302   82BH S  S    S-     0   0   59  234   35  SSSG SSSSSSSGSS SS S SGSSNSSSSNSG   SS  S     SSSNSN  NSS S         N 
   303   82CH V        -     0   0    0  234   13  LLVL LLLLLLLLLL LV L LMLVLVLLVLLL   VL  M     VVMLLM  LLL L         L 
   304   83 H T    >   -     0   0   65  234   62  RRTS RRRRRRRRRR KT R RERTRTRRTQRK   TG  K     DDKQQD  QRK Q         K 
   305   84 H N  G >  S+     0   0  120  234   65  TTAL TTTTTTTTTT AT S TVTTSTAAATAT   TA  S     TTSTTT  TDS T         V 
   306   85 H E  G 3  S+     0   0  160  234   25  EEAE EEEEEEEEEE SE D EKEEEEEEAEEE   EE  E     AAAEDA  EED N         E 
   307   86 H D  G <  S+     0   0    0  234    1  DDDD DDDDDDDDDD DD D DDDDEDDDDDDD   DD  D     DDDDDD  DDD D         D 
   308   87 H T    <   +     0   0   30  234   32  TTTT TTTTTTTTTT ST T TTTTSTTTTTTT   TT  S     TTSTTT  TTT T         T 
   309   88 H A  E    S- H   0 333C   3  234    4  AAAA AAAAAAAAAA AA A AAAAAAAAAAAA   AA  G     AAGAAA  AGA A         A 
   310   89 H M  E     -EH 257 332C  43  234   58  RRVV RRRRRRRRQR IT V HMRTRTVVVVVV   TV  T     RTTVMT  VFL R         T 
   311   90 H Y  E     -EH 256 331C   2  234    0  YYYF YYYYYYYYCY YY Y YYYYYYYYYYYY   YY  Y     YYYYYY  YYY Y         Y 
   312   91 H Y  E     -E  255   0C   1  234    3  FYYY YYFYYYYYYF YY Y YYFYYYYYYYYY   YY  Y     YYYYYY  YYY Y         Y 
   313   92 H c  E     +E  254   0C   0  234    1  CCCC CCCCCCCCCC CC C CCCCCCCCCCCC   CC  C     CCCCCC  CCC C         C 
   314   93 H S  E     -EI 253 327C   0  234   30  AAVA TAAAVAASTA AA A TATAVAAAAGAT   AA  A     AAAAAA  TVA A         A 
   315   94 H R  E     -EI 252 326C  20  233   44  RRRT STGGSRRRRG RR R KRRKRSRRGRKR   RR  I     QRRSRR  TRR R         R 
   316   95 H E  E     -EI 251 324C   0  233   77  GNHL TNCCMPGGGC LY H KGGYGRDDHDGH   ED  D     IMGTGG  ESG D         N 
   317   96 H N  E  >> -E  250   0C   6  233   90  RYVI SLYIFYVLGY RE R SPPSLGTTSTQT   SQ  T     PAVLGC  GAH S         P 
   318   97 H H  T  45S+     0   0    0  233   93  GFEA YGRTKDYNIG LG A WLPTSYVVEWEV   PG  Q     IDAAEN  GAS N         Q 
   319   98 H M  T  45S+     0   0   73  234   93  CAGV SCWSYSVCAA SN V LTADISRRGFRR   SY  H     YSGGGS  NGD Y         S 
   320   99 H Y  T  45S+     0   0  159  234   92  LGPA YGDYVRGFIS GY A GGVDAWGVQGRG   TA  C     YSYTSG  DSW E         S 
   321  100 H E  T  <5 -     0   0   54  234   90  adYg esthIccwac tD g GvacvFsssaGG   Rg  D     gGFAay  FDs G         g 
   322  100AH T      < +     0   0    0  139   91  cyGg yyyn.hcfyy sY n .dfne.ppyn..   .g  .     hA..yg  .Iy .         n 
   323  100BH Y  S    S-     0   0   10  161   90  PAWS GGAP.PAFPA YA W GYAYT.GDHG..   RV  Y     AW..NL  .WY A         S 
   324  100CH F  E     +I  316   0C   0  185   48  MMFF LVIMLIVTMM FM F MFLIM.HTHF..   FF  F     LF.FFF  .VF M         F 
   325  101 H D  E     +     0   0C  42  205   40  DDDD KHDDGYDDDN QD G DDDDSPSNSD..   AD  D     DADDAD  ADD D         D 
   326  102 H V  E     -I  315   0C  35  212   66  LLPI LLLLLLLLLL FY P LYLAFNCLGY..   YH  Y     NYYYYY  YPY Y         N 
   327  103 H W  E     -I  314   0C  28  221    8  WWWW WWWWWWWWWW WW W WWWWWWRLWWL.   WW  W     WWWWWW  WWW W         W 
   328  104 H G        -     0   0    3  229    7  GGGG GGGGGGGGGG GG G GGGGGGGQSGGv   GG  G     GGGGGG  GGG G         G 
   329  105 H Q        -     0   0  100  223   52  PPQQ PPPPPPPPPP QQ R PQPQPQ...SAp   QQ  P     PQPPQQ  QQQ Q         Q 
   330  106 H G        -     0   0    3  228    7  GGGG GGGGGGGGGG GG G GGGGGG.G.GCD   GG  G     GGGGGG  GGG G         G 
   331  107 H T  E     -H  311   0C  27  233   39  VVTT VIVVVVVVVV TT T ITVLVTPTQTTT   TT  T     TTTTTV  TTT T         T 
   332  108 H T  E     -H  310   0C  48  234   79  EELM EEEEEEEEEE LS L EMELELLPVMQN   LL  M     SLMMLM  MLL S         M 
   333  109 H V  E     -H  309   0C   0  234   19  VVVV VVVVVVVVVV VV V VVVVVVVREVLL   VV  V     VVVVVV  VVV V         V 
   334  110 H T  E     -d  227   0B  16  234   41  VVTT VDVVVVVVVV IT T VTVTFTTTATCL   TT  T     TTTTTT  TTT T         T 
   335  111 H V  E     +d  228   0B   2  234    9  VVVV VVVVVVVVVV VV V VVVVVVAVVVLQ   VV  V     VVVVVV  VVV V         V 
   336  112 H S        -     0   0   18  234   31  SSSS SSSSSSSSSS SS S STSSSSAVATTG   SS  T     SSTTSS  TSS S         S 
   337  113 H S  S    S+     0   0   99  234   19  SSSS SSSSSSVSSS LS S PSSSSASTSSLK   SS  S     SASSAS  SSS S         A 
   338  114 H A  S    S-     0   0   31  234   51  AAAA AAAAAAAAAA AE A AAAEAElaEAvm   EA  A     EEAAEE  VAA E         A 
   339  115 H K        -     0   0  143  234   66  PPSS YPPPPPPPYP SP S PTPSPSssSTss   SS  T     PPTQPT  TSS P         N 
   340  116 H T        -     0   0   44  234   72  KKPT NKKKKKKKNK TA T KLKEKATTPLTT   QP  Q     AAQSAP  APP A         K 
   341  117 H T  B     -J  370   0D  35  234   73  TTTK TTTTTTTTTT KR K THTTTRKKTHKK   ST  H     RRHSRR  STT R         A 
   342  118 H P        -     0   0   60  234   66  AASG AAAAAAAAAA GE G AAASANNNKANN   SS  A     EEAAED  ASS E         A 
   343  119 H P        -     0   0   13  234   17  PPPP PPPPPPPPPP PP P PPPPPPPPPPPP   PP  P     PPPPPP  PPP P         P 
   344  120 H S  E     -K  367   0E  51  234   57  LSKS SSLLSSLLSS ST S SSSSSTDDQSDD   TK  S     TTSSTT  SKK T         S 
   345  121 H V  E     -K  366   0E   6  234   25  VVVV VVVVVVVVVV VI V VVVIVIVVVVVV   VV  V     IIVVII  VVV I         V 
   346  122 H Y  E     -K  365   0E  27  234   14  YYFF YYYYYYYYYY FY F YFYFYYFFFFFF   FF  F     YYFFYY  FFF Y         F 
   347  123 H P  E     -K  364   0E  15  234   27  PPPP PPPPPPPPPP PP P PPPPPPPPPPPP   PP  P     PPPPPP  PPP P         P 
   348  124 H L  E     +K  363   0E   4  234   22  LLLL LLLLLLLLLL LL L LLLLLLLLLLLL   LL  L     LLLLLL  LLL L         L 
   349  125 H A        -     0   0   10  234   68  AASA AAAAAAAAAA AT A ARASATTTSRTT   VS  R     TTRKTR  ISS T         V 
   350  126 H P        -     0   0   24  234   77  PPLP PPPPPPPPPP PF P PPPLPLPPLPPP   SL  P     FFPPFP  PLL F         P 
   351  127 H G  S    S-     0   0   16  234   65  CCDS CCCCCCCCCC SP C CCCGCPCCCCCC   CC  C     PPCCPP  CDD P         C 
   352  128 H S  S    S+     0   0   99  234   67  GGSS GGGGGGGGGG SQ S GCGNSPGGSCGG   ES  C     QQCCQP  CSS Q         C 
   353  129 H A        +     0   0   52  234   79  RRTK RRRRRRRRRR RA R RgRNRATTEgTT   sT  g     AAgSAS  dTT A         g 
   354  130 H A        +     0   0   70  145   76  DD.S DDDDDDDDDD S. S DsD.D....s..   l.  l     ..l...  v.. .         p 
   355  133 H Q        +     0   0  178  219   82  TTPT VTTTTTTTTT TL T TSTDTL..QS..   SQ  G     LLGSLL  DPP L         I 
   356  134 H T    >   -     0   0   64  231   47  SSQS SSSSSSSSSS SS S SSSPSSSSPSSS   DP  S     SSSSSS  FQQ S         S 
   357  135 H N  T 3  S-     0   0  146  232   60  GGDG DGGGGGGGGG GS E GDGAGSGGDDGG   ED  D     SSDNSS  NDD S         E 
   358  136 H S  T 3  S+     0   0   63  232   58  PPGG HPPPPPPPPP GD S PSPGPDTTGSTT   NG  S     DDSEDD  DGG D         N 
   359  137 H M  E <   - L   0 408E  83  232   79  NNNT NNNNNNNNNN TP T NHNQNPTTNHTT   LN  H     PPHIPP  SNN P         Q 
   360  138 H V  E     - L   0 407E  15  233   38  VVVA VVVVVVVVVV AV A VVVVVVTTVVTT   VV  V     VVVAVV  VVV V         V 
   361  139 H T  E     + L   0 406E  15  234   68  AAVA AAAAAAAAAA AI A ATAVAIAAVTAA   AV  T     IITTII  TVV I         T 
   362  140 H L  E     + L   0 405E   0  234   26  LLVL LLLLLLLLLL LI L LILILILLVILL   MI  V     IIVIII  MVV I         I 
   363  141 H G  E     -KL 348 404E   0  234   28  GGAG GGGGGGGGGG GG G GGGGGGGGAGGG   GA  G     GGGGGG  GAA G         G 
   364  142 H e  E     -KL 347 403E   1  234    1  CCCC CCCCCCCCCC CC C CCCCCCCCCCCC   CC  C     CCCCCC  CCC C         C 
   365  143 H L  E     -KL 346 402E   2  234   12  LLLL LLLLLLLLLL LL L LLLLLLLLLLLL   LL  L     LLLFLL  LLL L         L 
   366  144 H V  E     -KL 345 401E   1  234   46  AAVV VAAAAAAAVA VI V ASAVAIVVVSVV   AV  S     IISAII  VVV I         V 
   367  145 H K  E     -KL 344 400E  38  231   68  SSQK SSSSSSSSSS KH K STSQSHKKRTKK   RQ  S     HHSSHQ  TQQ H         T 
   368  146 H G  E    S+     0   0E  19  234   40  SSGD SSSSSSSSSS DD D SGSGSDDDSGDD   DG  G     DDGGDN  GGG D         G 
   369  147 H Y  E     - L   0 399E   0  234    5  YYFY YYYYYYYYYY YY Y YFYFYYYYFFYY   FF  F     YYFFYY  YFF Y         F 
   370  148 H F  B     +J  341   0D   3  234   40  FFFF FFFFFFFFFF FF F FLFFFFFFFLFF   LF  L     FFLLFF  MFF F         F 
   371  149 H P  S    S-     0   0    0  234   15  PPpP PPPPPPPPPP Pp P PPPpPpPPpPPP   Pp  P     ppPPpp  App p         P 
   372  150 H E  S    S+     0   0   53  231   47  EEeE EEEEEEEEEE Eg E EAEaEgEEeAEE   Se  A     ggAQgg  Dee g         E 
   373  151 H P        +     0   0   59  232   52  PPPP PPPPPPPPPP PT P PPPPPTPPPPPP   SP  P     TTPPTN  PPP T         P 
   374  152 H V        -     0   0   20  233   39  VVLV VVVVVVVVVV VM V VVVLVMVVLVVV   IL  V     MMVVMM  LLL M         V 
   375  153 H T  E     +N  422   0F  83  234   67  TTST TTTTTTTTTT TN T TDTSTNTTSDTT   SS  T     NNTNNN  DSS N         D 
   376  154 H V  E     +N  421   0F  23  234   44  VVVV VVVVMVVVVM VV V MVMVVVVVVVVV   FV  V     VVVIVV  IVV V         I 
   377  156 H T  E     -N  420   0F  48  234   51  TTTS TTTTTTTTTT ST S TKTTTTSSTKSS   ST  K     TTKQTT  QTT T         K 
   378  157 H W  E > >S-NO 419 383F   2  234    0  WWWW WWWWWWWWWW WW W WWWWWWWWWWWW   WW  W     WWWWWW  WWW W         W 
   379  162 H N  G > 5S-     0   0   38  234   61  NNSN NNNNNNNNNN NG N NNNNNGNNSNNN   nS  N     GGNKGG  NSS G         N 
   380  163 H S  G 3 5S-     0   0   91  234   63  SSES SSSSSSSSSS SK S SSSQSKSSQSSS   qE  S     KKSSKK  DEE K         D 
   381  164 H G  G < 5S+     0   0   39  234   50  GGSG GGGGGGGGGG GS G GGGNGSGGSGGG   NS  G     SSGSSS  GSS S         G 
   382  165 H S  T < 5 +     0   0   93  234   53  AAGA AAAAAAAAAA AG A ASAGAGAAGSAA   nG  A     GGAsGG  SGG G         a 
   383  166 H L  B   < +O  378   0F  43  228   74  LLQL LLLLLLLLLL LK L LILDLKLL.ILL   vQ  I     KKIiKK  IQQ K         v 
   384  167 H S        +     0   0   88  231   64  TTNT STTTTTTTST TD T TTTSSDTT.TTT   MG  T     DDTTDD  TNN D         S 
   385  168 H S  S    S+     0   0  101  231   73  SSVS RSSSSSSSRS SI S SSSVSISS.SSS   QV  S     IISSII  TVV I         T 
   386  169 H G  S    S+     0   0   32  226   40  GGTG VGGGGGGGVG GT G GGGSGTGGTGGG   GT  G     TTGGTS  GTT T         G 
   387  171 H V        +     0   0   48  232   57  VVAV VVVVVVVVVV VT V VLVVVTVVTLVV   VA  I     TTIITV  IAA T         I 
   388  172 H H  E     -M  404   0E  17  233   79  HHRH HHHHHHHHHH HV H HKHRHVHHTKHH   RR  K     VVKKVI  KRR V         R 
   389  173 H T  E     -M  403   0E  69  233   67  TTNT TTTTTTTTTT TN T TNTNTNTTHNTT   TN  N     NNNNNN  TNN N         K 
   390  174 H F  E     -M  402   0E   1  233   11  FFFF FFFFFFFFFF FF F FFFFFFFFFFFF   FF  F     FFFFFF  MFF F         Y 
   391  175 H P  E     -     0   0E  65  232   17  PPPP PPPPPPPPPP PP P PPPPPPPPPPPP   PP  P     PPPPPP  RPP P         S 
   392  176 H A  E     -     0   0E  19  233   53  SSPA SSSSSSSSSS AP A SASASPAAPAAA   TP  A     PPAAPP  PPP P         T 
   393  177 H V  E     -M  400   0E  42  233   54  VVSV VVVVVVVVVV VA V VVVVVAVVSVVV   LS  V     AAVVAA  VSS A         V 
   394  178 H L  E     -M  399   0E  77  233   51  LLQL LLLLLLLLLL LL L LLLLLLLLQLLL   RQ  L     LLLALQ  LQQ L         Q 
   395  179 H Q  S    S-     0   0   83  233   65  QQDQ QQQQQQQQQQ QA Q QQQAQARRAQRR   TD  Q     AAQQAI  SDD A         N 
   396  180 H S  S    S-     0   0  116  233   55  ppas pppppppppp ss s pqpGpsssaqss   Ga  q     ssqqss  daa s         s 
   397  183 H D  S    S+     0   0   90  226   21  gggg gggggggggg gg g gggSgggggggg   Dg  g     gggggg  dgg g         d 
   398  184 H L        -     0   0   53  224   74  LLlL LLLLLLLLLL LR L LLLLLRLLlLLL   Kl  S     RRSYRP  lll R         t 
   399  185 H Y  E     -LM 369 394E  36  230    2  YYYY YYYYYYYYYY YY Y YFYYYYYYYFYY   YY  F     YYFFYY  YYY Y         Y 
   400  186 H T  E     +LM 367 393E   5  228   48  SSTS SSSSSSSSSS ST S SASTSTSSTASS   TT  A     TTAATT  TTT T         T 
   401  187 H L  E     -L  366   0E  11  225   53  LLTL LLLLLLLLLL LM L LSLMLMLLTSLL   AT  S     MMSSMM  LTT M         M 
   402  188 H S  E     -LM 365 390E   5  225   25  SSSS SSSSSSSSSS SS S SSSSSSSSSSSS   TS  S     SSSSSC  SSS S         S 
   403  189 H S  E     -LM 364 389E   2  225    1  SSSS SSSSSSSSSS SS S SSSSSSSSSSSS   SS  S     SSSSSS  SSS S         S 
   404  190 H S  E     -LM 363 388E   0  225   78  MTQV MMMMMMMMMM VQ V MQMQMQMMQQMM   QQ  Q     QQQQQQ  QQQ Q         Q 
   405  191 H V  E     -L  362   0E   0  225   27  VVLV VVVVVVVVVV VL V VLVLVLVVLLVV   VL  L     LLLLLL  LLL L         L 
   406  192 H T  E     +L  361   0E  48  225   41  TTTT IITTTITTIT TT T TTTTTTTTTTTT   LT  T     TTTTTT  TTT T         T 
   407  193 H V  E     -L  360   0E  14  224   29  VVLV VVVVVVVVVV VL V VIVLVLTTLITT   LL  I     LLIILL  ILL L         I 
   408  194 H P  E  >  -L  359   0E  56  223   43  PPPP APPPPPPPAP PP P PPPPPPSSPPSS   SP  P     PPPPPP  LPP P         T 
   409  195 H S  T  4 S+     0   0   49  222   51  AAAS AAAAAAAAAA SA S ALAAAASSALSS   AA  L     AALIAA  AAA A         S 
   410  196 H S  T  4 S+     0   0   66  222   64  SRTS SSSSSSSSSS SV S SSSSSVAAASAA   KT  S     VVSSVA  STT V         T 
   411  198 H P  T  > S+     0   0   31  222   70  SSQS SSSSSSSSSS SE S SDSLSEGGQDGG   nQ  D     EEDREE  EQQ E         E 
   412  199 H R  T  < S+     0   0   16  222   99  LSCL LLLLLLLLLL LC L LWLCLCSSCWSS   eC  W     CCWWCC  WCC C         W 
   413  200 H P  T  4 S+     0   0   80  223   71  SSPG SSSSSSSSSS GP G SKSPSPQQPKQQ   GL  K     PPKNPP  KPP P         L 
   414  202 H S  T  4 S+     0   0  111  221   68  SRDT TSSSSSSSTS TE T IASKSETTDATT   SA  D     EEDSEE  NDD E         S 
   415  203 H E  S  < S-     0   0  128  221   75  KKGQ LKKKKKKKLK QG K KKKGKGYYTKYY   DG  K     GGKEGD  SGG G         K 
   416  204 H T        -     0   0   83  221   71  SCkT SSSSSSSSSS Te T SkSqSeTTkkTT   ek  S     eeSSet  Tkk e         T 
   417  205 H V        +     0   0    4  217   60  YFvY YYYYYYYYYY Yv Y YfYvYv..vf..   lv  F     vvFFvv  Yvv v         Y 
   418  206 H T  E     - P   0 433F  23  217   76  TTTI TTTTTTTTTT IK T TETTTK..KE..   VT  E     KKETKK  KTT K         K 
   419  208 H e  E     -NP 378 432F   0  220    1  CCCC CCCCCCCCCC CC C CCCCCCCCCCCC   CC  C     CCCCCC  CCC C         C 
   420  209 H N  E     -NP 377 431F   4  220   59  NNHN NNNNNNNNNN NS N NNNQNSNNSNNN   KH  N     SSNTSS  KHH S         D 
   421  210 H V  E     -NP 376 430F   1  220   24  VVVV VVVVVVVVVV VV V VVVVVVVVVVVV   IV  V     VVVVVV  VVV V         V 
   422  211 H A  E     -NP 375 429F  14  220   74  NNKN YNNNNNNNYN DQ D NENQNQVVKEVV   HK  E     QQETQQ  VKK Q         T 
   423  212 H H  E > > - P   0 428F   1  220   17  HHHH HHHHHHHHHH HH H HHHHHHHHHHHH   HH  H     HHHHHY  HHH H         H 
   424  213 H P  G > 5S+     0   0   77  209   81  PP K PPPPPPPPPP KD K PKPLPDTT KTT   G   A     DDAGDN  N   D         N 
   425  214 H A  G 3 5S+     0   0   40  203   65  AA P AAAAAAAAAA PS P APASASPP PPP   N   P     SSPSST  Y   S         P 
   426  215 H S  G < 5S-     0   0   32  202   63  TT S TTTTTTTTTT SN S TTTKTNTT TTT   K   T     NNTTNS  T   N         T 
   427  216 H S  T < 5 +     0   0  111  199   72  TT N NTTTTTTTNT NP N TSTATPGG SGG   N   S     PPSSPP  N   P         S 
   428  217 H T  E   < +P  423   0F  35  196   63  TT T TTTTTTTTAT TV T TTTSTVFF TFF   K   T     VVTTVV  T   V         T 
   429  218 H K  E     +P  422   0F 135  196   50  KK K KKKKKKKKKK KQ K KKKKKQKK KKK   D   K     QQKPQK  K   Q         A 
   430  219 H V  E     -P  421   0F  38  140   32  VV V VVVVVVVVVV V    VVV V KK VKK   L   V       VV    Q             P 
   431  220 H D  E     -P  420   0F  97  140   36  DD D DDDDDDDDDD D    DTD D DD TDD   H   N       NT    E             V 
   432  221 H K  E     -P  419   0F  51  127   45  K  K KKKKKKKKKK K    KQK K VV QVV   V   K       KS    K             T 
   433  222 H K  E     -P  418   0F 121  127   48  R  R RRRRRRRRCR K    RKR R PP KPP   P   K       KE    S             K 
   434  223 H I        -     0   0    4  123   30  V  V VVVVVVVVVV V    VIV V VV IVV   I   I       IL    L             I 
   435  224 H V        -     0   0   79  112   59  G  E DGGGGGGGDG E    GEG G PP EPP   P                               V 
   436  225 H P              0   0   73  103   61  T  P  TTTTTTT T P    T T T VV  VV   A                               Q 
   437  226 H R              0   0  167   89   21  K  K  KKKKKKK K K    K K K KK  KK                                   K 
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1    1 L D              0   0  100   77   31                Q                      EE                               
     2    2 L I        -     0   0    0   88   32                I                      LL                               
     3    3 L V        -     0   0   88   98   48                I                      VV                               
     4    4 L M  E     -Q   25   0G  12  101   21                V                      MM                               
     5    5 L T  E     -Q   24   0G  80  101   14                T                      TT                               
     6    6 L Q  E     -Q   23   0G  19  101    5                Q                      QQ                               
     7    7 L S  E    S+Q   22   0G  57  101   57                S                      TT                               
     8    8 L P        -     0   0   47  148    6  P  P P PPP  PPPP PPP P     PPP      PPP      P    PP    PP PP         
     9    9 L A  S    S-     0   0   79  156   68  P  P P PPP  PGGP PSP P     PSP      GSS      P    SP    SP SP         
    10   10 L S  E     -t  107   0H  78  168   57  S  S S SSS  SAAS SSS S     SSS      AMMS     S    SV    SS SS    S  S 
    11   11 L L  E     -t  108   0H  34  204   48  V  VVA AVV VVVQA VVA V    VVVV V  V VLLV   V VV   VVLVVVVVVVV   VVV V 
    12   12 L V  E     +t  109   0H  86  214   38  SS LSS SSS SSSSS SSS S   SSSSSSSS S SPPSS  S SS   STTSSSSSSSS   SSS S 
    13   13 L V  E     -t  110   0H  17  216   57  VG VGG GGA VGSVG GGG A   GGGGGVVV V SVVVV  G VV   TSVGGVGGVGG   VVV K 
    14   14 L S  E >   -t  111   0H  46  224   63  AS ASS TAASSNAVT TTT A   SSASSTSA S ATTSS  S AS   SASSSSSSASN   AAA S 
    15   15 L L  T 3  S+     0   0   79  225   67  PP PPP PPPPLPVAP PPP P   PPPLLLPP P VVVPP  P PP   LPPPPPLLLLP   QQQ L 
    16   16 L G  T 3  S+     0   0   39  233    6  GG GGG GGGGGGGGG GGG G   GGGGGGGG G GGGGGG G GG   GGGGGGGGGGG   GGG G 
    17   17 L Q    <   -     0   0   97  233   51  QQ KQQ QQQQQQGQQ QQR Q   QQQQQQQQ Q GQQQQQ Q KQ   SSGQQGQQQQQ   QQQ Q 
    18   18 L R        -     0   0  152  233   63  TS TSR RRKTTRTSR RRR R   SSRRTTTT T TTTNTT S TT   TTTSSTRTTRR   TTT S 
    19   19 L A  E     - R   0  79G   2  233   43  AV AIV VVVAAIVVV VVV V   VIVVVAAA A VAAAAV V AA   AVVVIVVVAVI   AAA V 
    20   20 L T  E     - R   0  78G  66  233   58  TT RTT TTTSSTSSP TTT T   TTSSTSRR K STTQRR T RR   KTTTTTSTKST   SSS T 
    21   21 L I  E     - R   0  77G   0  233   23  II III IIIIIIIII III I   IIIIIIII I IIILII I II   LLLIILIIIII   III I 
    22   22 L S  E     -QR   7  76G  36  233   53  TS TSS SSSTTSSTS SSS S   SSSTSTTT T STTTTT P TT   PTTSSTTSTTS   TTT S 
    23   23 L a  E     -QR   6  75G   0  233    0  CC CCC CCCCCCCCC CCC C   CCCCCCCC C CCCCCC C CC   CCCCCCCCCCC   CCC C 
    24   24 L R  E     -QR   5  74G 153  233   76  GT GTS STSSQSRRS SSS S   TTTTTRSG S RKKSSQ T GS   KKATTGSTSSS   SSS T 
    25   25 L A  E     -Q    4   0G   6  233   70  GG GGG GGGGGGTTG GGG G   GGGGGGGG G TAAGGG G AG   ATSGGLGGGGG   RRR G 
    26   26 L S  S    S+     0   0   63  233   52  NT DTS SRSDDSSSS SSS R   TTNSSNDN D SSSNDD T DD   SSSSTSSSDSS   DDD T 
    27   27 L E  S    S-     0   0  105  233   74  NS NSR SSSKDSQSS SSS S   SSSSSSAN A QSSNAS S NA   TQTSSSSSLSS   NNN S 
    28   27AL S        -     0   0   29  233   75  IS VSS SSSLLSDsS SSS S   STSSnILI L DSSILl S IL   GAGRGGtnLSS   III S 
    29   27BL V        +     0   0    0   70   75  .. ... ......Vy. ... .   ....i... . V..... . ..   .VA...ii...   ... . 
    30   27CL D  E     +Z   35   0I  45   97   81  .D .D. ......YS. ... .   D...G... . Y..... . ..   .YV.D.GG...   ... . 
    31   27DL S  E >  S+Z   34   0I  15  133   82  .V .VN .NN.ENVIN NNN N   VDNDI... . V..... D ..   NRTDVSIN.NN   ... D 
    32   28 L Y  T 3  S-     0   0  173  140   87  .G .GI NII.LIYYI III I   GVIVL... . Y..... V ..   IDSFGVYL.II   ... I 
    33   29 L G  T 3  S+     0   0   81  224   59  GG GGG igGGLgkyG GGG G   GggGGGPG P kIIGP. g GP   GsGgGsGGDGG   GGG g 
    34   30 L K  E <  S-Z   31   0I 112  182   77  SY SYS ngND.snkS IAS N   YhgK.RKS K nSSSRt y AK   Dg.yDs..KSV   SSS y 
    35   31 L S  E     -Z   30   0I   7  205   76  KN KDN NHNN.NHNN NNN S   NSYG.KKK K HNNKKY N KK   SDYDSY..KYY   YYY N 
    36   32 L F        +     0   0    5  218   67  SY AFY YDYYSYCLT YNS Y   YLDY.DYY Y CYYAYY Y SY   YWYHLY..YNT   YYY A 
    37   33 L M  E     -U   94   0H   0  225   52  VV VVV VVVAAVLLV VVV V   VVVVVVAV A LLLVAA V VA   VMPVVPVVTVV   III V 
    38   34 L H  E     -U   93   0H   0  229   82  HS HSY YHSCHNSSN YNN S   SSHASHYH Y SSSHFS S HY   NFNSSSNSRGQ   HHH S 
    39   35 L W  E     -UV  92  52H   0  233    0  WW WWW WWWWWWWWW WWW W   WWWWWWWW W WWWWWW W WW   WWWWWWWWWWW   WWW W 
    40   36 L Y  E     -UV  91  50H   0  233   14  YY YYY YYYYYYYYY YYY Y   YYYFYYFY Y YYYYYY Y YY   YYFYYYYYYYY   YYY Y 
    41   37 L Q  E     -UV  90  49H   4  233   29  RQ QQQ QQQQQQQLQ QQQ Q   QQQQQQQQ Q QQQQQQ R QQ   QQQQQQQQQQQ   QQQ Q 
    42   38 L Q  E     -U   89   0H  16  233   12  QQ QQQ QLQLQQQQQ QQQ Q   QQQQQQQQ Q QQQQQQ Q QQ   QQQQQQQQQQQ   QQQ Q 
    43   39 L K    >   -     0   0   47  233   62  KH KNV LLLKKLKKF ILF F   HHLIIKKK K KKKKKK H KK   YKKEHTVIKVH   KKK H 
    44   40 L P  T 3  S+     0   0   81  233   36  PP PPP PPPPPPDPP PPP P   PPPPPPPP S DAAPSP P TS   MSPPPPPPPPP   PPP P 
    45   41 L G  T 3  S+     0   0   58  232   13  GG GGG GGGGGGGGG GGG G   GGGGGGGG G GGGGGG G DG   GGGGGGGGGGG   GGG G 
    46   42 L Q  S <  S-     0   0  103  233   69  QK QKT TATQQKKGT TTT A   KKSSSQQQ Q KEESQQ K QQ   RQQKKQSSQSS   QQQ Q 
    47   43 L P        -     0   0   34  233   59  AV AAA AAASAASAA AAA A   AAVAAASA T SRRAAA A AT   SPAAAAGAGGA   AAA V 
    48   44 L P        -     0   0    5  233   10  PP PPP PPPPPPPPP PPP P   PPPPPPPP P PPPPPP P PP   PPPPPPLPPLP   PPP P 
    49   45 L K  E     -V   41   0H  96  233   63  MK VKK KKKVVKKKK KKR Q   KKRKRLVV V KKKLVV K VV   TKRKKRKRVRK   VVV V 
    50   46 L V  E     +V   40   0H  10  233   45  LL LLL LLLLLLLLL LLL L   LFLTTLLL L LLLLLL L LL   NLALLTTTSTL   LLL L 
    51   47 L L  E     +     0   0H   2  233   23  VM VIL LLLVVLLLL LLL L   MLLLLIIV I LLLVVV M VV   MLLIILILVIV   AAA V 
    52   48 L I  E     -VW  39  58H   0  233   35  VI III IIIIIIIII III I   IIIIIIII I IIIIII I VI   IIIIIIIIIII   III I 
    53   49 L Y  E  >  + W   0  57H  54  232   23  YY YYY YYYYYYYYY SHY Y   YFFYYYYY Y YYYYYY Y HY   YKYYYYYYYYY   CCC Y 
    54   50 L I  T >4 S-     0   0   10  233   88  DE YDR SGDQASWHS TTG D   EESGNNED E WDDSEA D DD   GLSDEYENKGG   NNN K 
    55   51 L A  T 34 S+     0   0    2  233   75  DV DVN TNNDDNAAN NTN N   VGNDSDDN D AAADDK V DD   DVTVDTDGDSN   SSS N 
    56   52 L S  T 34 S+     0   0   73  233   63  SS TSD NNNNDSSTN DNH D   NSTTNNSS S STTSSD N NT   DSSTHNKNSSN   NNN S 
    57   53 L N  E <<  -W   53   0H  77  233   74  AQ DNQ QIKRNNTSQ QQQ K   KKNKKSKN K TTTNKN K DE   LTSKKAYKESN   SSS N 
    58   54 L L  E     -W   52   0H  63  233   66  RR RRR RRRRLRRRR RRR R   RRRRRQRR R RLLRRR R RR   RRKRRRRRRRR   RRR R 
    59   55 L E    >   -     0   0   49  233   81  PP PPP PPPPAPQQP PPP P   PPPAPPPP P QYYPPP P PP   PEHPPSPPPPP   PPP P 
    60   56 L S  T 3  S+     0   0  107  233   40  SS SSS SSSSSSSSS SSS S   SSSSSSSS S STTSSS S SS   SSSSSYSSSSS   SSS S 
    61   57 L G  T 3  S+     0   0   67  233   21  GG GGG GGGGGGGGG GGG G   GGGGGGGG G GGGGGG G GG   GGWGGGGGGGG   GGG G 
    62   58 L V    <   -     0   0   17  233   47  IV IVV VVIIIVIVV VVV I   VVVVVIII I ITTIIV V II   VTTVVVVVIVV   TTT I 
    63   59 L P    >   -     0   0   62  233   27  PP PSP PPPPPPPSP PPP P   PSPPPPPS P PPPPPP P PP   SPPPSPPPPPS   PPP P 
    64   60 L A  T 3  S+     0   0   99  233   58  ED EHD AEDEDDSDD DED D   DNADDEEE E SAADED D EE   DAADSDDDDDN   DDD E 
    65   61 L R  T 3  S+     0   0   30  233    8  RR RRR RRRRRRRRR RRR R   RRRRRRRR R RRRRRR R RR   RRRRRRRRRRR   RRR Q 
    66   62 L F  E <   -S   79   0G   7  233    1  FF FFF FFFIFFFFF FFF F   FFFFFFFF F FFFFFF F FF   FFFFFFFFFFF   FFF F 
    67   63 L S  E     -S   78   0G  59  233   24  SS SSS SSSSSSTSS SSS S   SSSSSSSS S TSSSSS S SS   SSSSFSSSSSS   SSS S 
    68   64 L G  E     +S   77   0G  17  233   11  GG GGG GGGGGGGGG GGG G   GGGGGGGG G GGGGGG G GG   gGGAGGGGGGG   GGG G 
    69   65 L S  E     +S   76   0G  48  233   40  SS SSS SSSSSSSSS SSS S   SSSSTTSS S SHHASS S SS   dSSSSSSTSSS   SSS S 
    70   66 L G  E     -S   75   0G  35  233   77  AK NKK KKKNKKGGK KKK K   KKKRKNSN S GQQNSG K NS   SGLKKIKKSKK   NNN N 
    71   67 L S  E >   +S   74   0G  68  232   24  SS SSS SSSSSSSSS SSS S   SSSSSSSS S SSSSSS S SS   SSLSSLSSSSS   SSS S 
    72   68 L R  T 3  S-     0   0  163  232   35  EG GGG GGGGDGNKG GGG G   GGGGGGGG G NSSGGG G GG   SSGVGGGGGGG   GGG G 
    73   69 L T  T 3  S+     0   0   51  232   58  NN NNT TTTNTTSTT TPT T   NNANNSTN T STTNTN N NT   NSGNNNNNKNN   NNN N 
    74   70 L D  E <   +RS  24  71G  77  232   64  TT TTS STSTTSDDS SSS S   TTSTTTVT M DTTTMT T TV   SDKTAKTTTTT   TTT T 
    75   71 L F  E     -RS  23  70G   0  232   81  AA AAA AAAAAAFFA AAA A   AAAAGAAA A FFFAAA A AA   AFAAAAAGVAA   AAA A 
    76   72 L T  E     -RS  22  69G  33  232   61  TS TSS SSTTTSTTS SSS T   SSSTTTTT T TTTTTS S TT   FTASSATTTTS   TTT T 
    77   73 L L  E     -RS  21  68G   0  232    4  LL LLL LLLLLLLLL LLL L   LLLLLLLL L LMMLLL L LL   LLLLLLLLLLL   LLL L 
    78   74 L T  E     -RS  20  67G  28  232   48  TT TTA AAGTTTTSA AVA A   TTATTTTT T TTTTTT T ST   TTTTTTTTTTT   TTT T 
    79   75 L I  E     -RS  19  66G   0  232    4  IV III IIIIIIIII III I   VIIIIIII I IIIIII I IL   IILIIIIIIII   III I 
    80   76 L D  S    S+     0   0   68  232   42  SS SSS STTSRSSRS GSS T   SSTIASSS S STTTST S SS   QSSSSTNASSS   SSS S 
    81   77 L P  S    S-     0   0   51  232   61  GG RGG GGGGGGGGG GGG G   GGGSSEGG G GGGGGG G RG   NGGGGGSSGSG   RRR N 
    82   78 L V        +     0   0    0  232   50  VL VLL LLLTALIVL LLL L   LLLLLAAV T IVVVAA L VA   VVVLLALLALL   VVV T 
    83   79 L E    >   -     0   0   93  232   36  EQ EQR RQQQQQQQQ RQQ Q   QQQQQQQE Q QQQQQQ Q EQ   QQQQQQQQQQQ   QQQ Q 
    84   80 L A  G >  S+     0   0   22  232   55  AA ALS SATAADAAS SSS T   AAAAATVA V APPAVA A PV   ATPAAAAATAA   AAA A 
    85   81 L D  G 3  S+     0   0   58  232   28  GE GEE EEGMEGEEE EEE E   EEEDENEG E EEEQEE E GE   DEEEEDEEEEE   EEE L 
    86   82 L D  G <   +     0   0    1  232    0  DD DDD DDDDDDDDD DDD D   DDDDDDDD D DDDDDD D DD   DDDDDDDDDDD   DDD D 
    87   83 L A    <   +     0   0   12  232   78  EE EEE EEEEEDASD EEE E   EEEEEEEE E AFFEEE E EE   EAEEEEEEEEE   EEE E 
    88   84 L A  E    S- X   0 108H   8  232   20  AA AAA AAAAAAAGA AAA A   AAAAAAAA A AAAAGA A AA   AAAAASAAAAA   AAA A 
    89   85 L T  E     -UX  42 107H  35  233   69  DD DDD DDDEDDVVV HED E   DDDDDDDD D VDDDDD D DD   DVDDDDDDDDD   DDD N 
    90   86 L Y  E     -UX  41 106H   0  233    4  YY YYY YYYYYYYYY YYY Y   YYYYYYYY Y YYYYYY Y YY   YYYYYYYYYYY   YYY T 
    91   87 L Y  E     -U   40   0H   9  233    6  YY YYY YYYYYYYYH YYY Y   YYYFYYYY Y YYYYYY Y FY   YYYYYYFYYFY   YYY V 
    92   88 L a  E     -U   39   0H   0  233    4  CC CCC CCCCCCCCC CCC C   CCCCCCCC C CCCCCC C CC   CCCCCCCCCCC   CCC R 
    93   89 L Q  E     -UY  38 102H   1  233   79  QS QSA AQGQQSQQA AAG G   SCQAAQYQ Y QMMQYN C QY   QQLCCVAAQAS   QQQ R 
    94   90 L Q  E     +UY  37 101H   0  233   84  VS ISA ASTASSRsT AAT T   SSSAsVsV s sGGysS S VS   SslSSVassAS   ssI g 
    95   91 L N        +     0   0    0  206   57  WY WYW WYWWAYTwW WWW W   YYY..W.W . yYYv.. Y W.   YhyYYFy..YY   ..W l 
    96   92 L N  S    S+     0   0    1  213   78  ha dsd dddddkwnd ddd d   avdg.p.d . iQqa.r a ds   snraalS..dt   ..d h 
    97   93 L E  S    S-     0   0   48  212   78  in hth sggsdhlfn gss g   ntladqhd h lSscgh t qh   gagsvg.faah   ssk s 
    98   94 L D  S    S+     0   0   42  216   73  LL FtV lLVWLsWvl Yll V   YVFVlCsv W WsshYL F LW   IWVYLIvFVVs   ssF L 
    99   95 L P  S    S-     0   0   26  119   74  .. .p. a....p.ws .pg .   ..A.c.ct . .npv.. . ..   .V.I..t...p   pa. C 
   100   96 L P        -     0   0    4  155   90  .V YF. P....SWHW .YP .   ..C.AWVV . WPNYP. G W.   RV.W.SA...G   VAY Y 
   101   97 L T  E     -Y   94   0H  26  200   64  VV VVV LV.V.STTV AVV .   VVV.VVLC V TTTVVV V MV   VTVV.VVV..S   AHS I 
   102   98 L F  E     -Y   93   0H  26  231   16  FF FFF FFFFFWFFF FFF F   FFFFFFFC F FFFFFF F FF   FFFFFFFFFFW   WSI F 
   103   99 L G        -     0   0    3  233   17  GG GGG GGGGGGGSG GGG G   GGGGGGGG G GGGGGG G GG   GGGGGGGGGGG   VDG G 
   104  100 L A        -     0   0   81  233   63  GG TSG GGGGGIGGG TTT G   TGGSSEGG E GKKGGT G GG   GGGGGGGSSST   GTS A 
   105  101 L G        -     0   0   12  233   14  GG GGG GGGGGEGGG GGG G   GGGGGGGG G GGGGGG G GG   GGGGGGGGGGE   GGG G 
   106  102 L T  E     - X   0  90H   0  233   14  TT TTT TTTTTTTTT TTT T   TTTTTTTT T TTTTTT T TT   TTTTTTTTTTT   LRL T 
   107  103 L K  E     -tX  10  89H  74  233   53  KK KKK KKKKRKRRK KKK K   KKKTTQRT K REEQKK K KK   KKKKKKTTTTK   RWS R 
   108  104 L L  E     +tX  11  88H   2  232   22  LL VVL LLLLVLLLL VVV L   VLVLLLLL L LLLLVV L LL   LLLVVVLLLLT   LIF L 
   109  105 L E  E     -t   12   0H  14  233   69  TT TTT TTTTTAEDT TTT T   TTTTTTTT T EVVTTT T TT   TVTSTTTTTTA   ATS T 
   110  106 L M  E     -t   13   0H   0  233   29  VV VVV VVVVVLVVV VVV V   VVVVVVVV I VLLVVV V VV   VVVVVVVVVVL   DEV V 
   111  107 L R  E     +t   14   0H 126  233   86  LL LLL LLLLLPDDL LLL L   LLLLLLLL L DNNLLL L LL   LDLLLLLLLLG   MLL L 
   112  108 L R        -     0   0   64  233   79  GG GGS GGGGGGLLS RGG S   GGGGGGGG G LRRGGG G RG   SLSGGGGGGGQ   gGa G 
   113  109 L A        -     0   0   71  221   67  QQ QQQ QQQQQQGGQ QQQ Q   QQQQQQQQ Q GDDQQQ Q QQ   QGQQQQQQQQ.   hHh Q 
   114  110 L D        -     0   0   58  226   72  pp ppp ppppppHQp ppp p   pppppppp p HVVppp p pp   pVppppppppp   lll p 
   115  111 L A  B     -A  144   0J  19  225   58  aa aaa aaaasaVVa aaa a   aaasssaa v VAAaaa a aa   tVaaaassssa   aaa a 
   116  112 L A        -     0   0   40  229   62  AA NNA AAAAPTPAA NNN A   NAAPPSAT A PKKSAN A AA   SRAAAAPPPPT   SSS S 
   117  113 L P        -     0   0    9  229    4  PP PPP PPPPPPPPP PPP P   PPPPPPPP P PPPPPP P PP   PPPPPPPPPPP   PPP P 
   118  114 L T  E     -B  141   0K  85  232   60  SS TTS SSSSSSSTS TTT S   TSSSSLSS L SVVTST S SS   STSSSSSSSSS   SSS L 
   119  115 L V  E     -B  140   0K   8  233   26  VV VVV VVVVVVLLV VVV V   VVVVVVVV V LLLVVV V VV   VLVVVVVVVVV   III V 
   120  116 L S  E     -B  139   0K  17  233   67  TT TTT TTTTTTTTT TTT T   TTTTTTTT T TTSHTT T TT   TTTTTTTTTTT   TTT T 
   121  117 L I  E     -B  138   0K  22  233   31  LL LLL LLLLLVVVL LLL L   LLLLLLLV L VLLLLL L LL   LVLLLLLLLLV   LLL L 
   122  118 L F  E     -B  137   0K   4  233    7  FF FFF FFFFFFLLF FFF F   FFFFFFFF F LLLFFF F FF   FLFFFFFFFFF   FFF F 
   123  119 L P        -     0   0    5  233   25  PP PPP PPPPPPAPP PPP P   PPPPPPPP P APPPPP P PP   PPPPPPPPPPP   PPP P 
   124  120 L P        -     0   0    1  233    9  PP PPP PPPPPPPPP PPP P   PPPPPPPP P PPPPPP P PP   PPPPPPPPPPP   PPP P 
   125  121 L S    >>  -     0   0    8  233   10  SS SSS SSSSSSSSS SSS S   SSSSSSSS S SSSSSS S SS   SSSSSSSSSSS   SSS S 
   126  122 L S  H 3> S+     0   0   78  233   64  SS SSS SSSSKSMRS SSS S   SSSTTSSS S MTTSSS S SS   SRSSSSTTTTS   SSS S 
   127  123 L E  H 3> S+     0   0   76  233   30  EE EEE EEEEEEEEE EEE E   EEEEEEEE E EEEEEE E EE   EEEEEEEEEEE   EEE E 
   128  124 L Q  H <4>S+     0   0    8  233   30  EE EEE EEEEEEEEE EEE E   EEEEEEEE E EEEEEE E EE   EEEEEEEEEEE   EEE E 
   129  125 L L  H ><5S+     0   0   29  233   22  LL LLL LLLLLLLLL LLL L   LLLLLLLL L LIILLL L LL   LLLLLLLLLLL   III L 
   130  126 L T  H 3<5S+     0   0  111  233   69  QQ QQQ QQQQSQQQQ QQQ Q   QQQNNGQQ Q QSSQQQ Q QQ   EQQQQQNNNNQ   QQQ Q 
   131  127 L S  T 3<5S-     0   0   83  233   68  AA AAA AAAAASQQA AAA A   AAAGGAAS A QKKTAA A AA   TQAAAAGGGGS   AAA A 
   132  128 L G  T < 5S+     0   0   34  233   54  NN NNN NNNNNNGGN NNN N   NNNNNNNN N GGGkNN N NN   NDNNNNNNNNN   NNN N 
   133  129 L G  E   < - C   0 186K  21  216   60  KK KKK KKKKKKEKK KKK K   KKKKKKKK K ETTkKK K KK   KSKKKKKKKKK   KKK K 
   134  130 L A  E     - C   0 185K   0  225   19  AA AAA AAAAAAAAA AAA A   AAAAAAAA A AAAAAA A AA   AAAAAAAAAAA   AAA A 
   135  131 L S  E     - C   0 184K   2  226   39  TT TTT TTTTTTTTT TTT T   TTTTTTTT T TTTTTT T TT   TTTTTTTTTTT   TTT T 
   136  132 L V  E     - C   0 183K   0  226   35  LL LLL LLLLLLLLL LLL L   LLLLLLLL L LLLLLL L LL   LLLLLLLLLLL   LLL L 
   137  133 L V  E     -BC 122 182K   0  226   15  VV VVV VVVVVVMMV VVV V   VVVVVVVV V MLLVVV V VV   VVVVVVVVVVV   VVV V 
   138  134 L b  E     -BC 121 181K   0  227    9  CC CCC CCCCCCCCC CCC C   CCCCCCCC C CCCCCC C CC   CCCCCCCCCCC   CCC C 
   139  135 L F  E     -BC 120 180K   0  228   40  LL LLL LLLLLLVLL LLL L   LLLLLLLL L VLLLLL L LL   TVLLLLLLLLL   LLL L 
   140  136 L L  E     -BC 119 179K   0  228   49  II III IIIIIIAAI III I   IIIIIIII I AAALII I II   IAIIIIIIIII   III I 
   141  137 L N  E     -B  118   0K   2  221   47  SS SSS SSSSSSNNS SSS S   SSSSSSSS S NNNGSS S SS   SSSSSSSSSSS   NNN S 
   142  138 L N  E    S+     0   0K  49  225   49  DD DDD DDDDDDKKD DDD D   DDDDDDDD D KHHSDD D DD   DGDDDDDDDDD   DDD D 
   143  139 L F  E     - C   0 177K   0  226   41  FF FFF FFFFFFGGF FFF F   FFFFFFFF F GFFFFF F FF   FGFFFFFFFFF   FFF F 
   144  140 L Y  B    S+A  115   0J   9  226   46  YY YYY YYYYYYFFY YYY Y   YYYYYYYY Y FFFYYY Y YY   YFYYYYYYYYY   YYY Y 
   145  141 L P  S    S-     0   0   18  226   16  PP PPP PPPPPPPPP PPP P   PPPPPPPP P PPPPPP P PP   PPPPPPPPPPP   PPP P 
   146  142 L K  S    S+     0   0   83  227   74  GG GGG GGGGGGSSG GGG G   GGGGGSGG G SNNGGG G GG   GSGGGGGGGGG   GGG G 
   147  143 L D        +     0   0  116  228   78  AA AAA AAAASADDA AAA A   AAASSGAA A DTTSAA A AA   VAAAAASSSSA   TTT V 
   148  144 L I        -     0   0   19  228   60  VV VVV VVVVVVWWV VVV V   VVVVVLVV V WLLVVV V VV   VWVVVVVVVVV   VVV V 
   149  145 L N  E     -E  201   0L  82  228   67  TT TTT TTTTTTTST TTT T   TTTTTKET T TQQQTT T TT   TRTTTTTTTTT   VVV K 
   150  146 L V  E     -E  200   0L  27  228   12  VV VVV VVVVVVLLV VVV V   VVVVVVVV V LLLVVV V VV   VLVVVVVVVVV   VVV V 
   151  147 L K  E     -E  199   0L  53  228   76  AA AAA AAAAAESSA AAA A   AAAVVAAE A SVVTAA A AA   DGAAAAVVVVE   AAA A 
   152  148 L W  E     +E  198   0L   3  228    3  WW WWW WWWWWWWWW WWW W   WWWWWWWW W WWWWWW W WW   WWWWWWWWWWW   WWW W 
   153  149 L K  E     +EF 197 158L  76  229   45  KK KKK KKKKKKKKK KKK K   KKKKKKKK K KQQKKK K KK   KKKKKKKKKKK   KKK K 
   154  150 L I  E    S-E  196   0L   0  229   68  AA AAA AAAAAAVVA AAA A   AAAAAAAA A VKKAAA A AA   AVAAAAAAAAA   EEE A 
   155  151 L D  S    S-     0   0   71  229   24  DD DDD DDDDDDEDD DDD D   DDDDDDDD D EDDDDD D DD   DGDDDDDDDDD   DDD D 
   156  152 L G  S    S+     0   0   63  230   38  SS GGS SSSSGGSGS GGG S   GSSGGGGG G EMMGSG S SS   GGSSSSGGGGG   GGG G 
   157  153 L S  S    S-     0   0   33  229   65  SS SSS SSSSSN.SS SSS S   SSSSSSSN S SVVKSS S SS   TSSSSSSSSSN   KKK S 
   158  154 L E  B     -F  153   0L  85  229   76  PP PPP PPPPTS.SP PPP P   PPPTTTAS P RTTQPP P PP   PSPPPPTTTTS   TTT A 
   159  155 L R        -     0   0   69  231   75  VV VVV VVVVIVRCV VVV V   VVVIIIVV V SVVIVV V VV   VSVVVVIIIIV   III V 
   160  156 L Q        +     0   0  133  232   75  KK KKK KKKKTRSSK KKK K   KKKTTINR K PTTSKK K KK   TSKKKKTTTTR   TTT N 
   161  157 L N  S    S+     0   0  117  233   70  AA AAA AAAARDPSA AAA A   AAARRQAD A GDDTAA A AA   QSAAAARRRRD   QQQ A 
   162  158 L G  S    S+     0   0   29  233   33  GG GGG GGGGNGGsG GGG G   GGGNNGGG G VGGGGG G GG   GGGGGGNNNNG   GGG G 
   163  159 L V  E     -D  183   0K  46   68   75  .. ... .......w. ... .   ........ . ...... . ..   ...........   ... . 
   164  160 L L  E     -D  182   0K  16  212   47  VV VVV VVVVVV.EV VVV V   VVVVVVVV V .VVVVV V VV   VVVVVVVVVVV   VVV V 
   165  161 L N  E     +D  181   0K  52  216   55  EE EEE EEEEKE.EE EEE E   EEEEEEEE E .KKEEE E EE   ESEEEEEEEEE   QQQ E 
   166  162 L S  E     -D  180   0K  12  224   49  TT TTT TTTTTT.GT TTT T   TTTTTTTT T .TTTTT T TT   THTTTTTTTTT   TTT T 
   167  163 L W  E     -D  179   0K  99  224   71  TT TTT TTTTTT.RT TTT T   TTTTTTTT T .SSTTT T TT   TSTTTTTTTTT   TTT T 
   168  164 L T        -     0   0   24  225   66  TT KKT TTTTRK.ST KKK T   KTTRRKKK K .GGKTK T TT   QLTTTTRRRRK   KKK T 
   169  165 L D        -     0   0   99  226   74  PP PPP PPPPAP.PP PPP P   PPPAAPPP P .SSPPP P PP   PEPPPPAAAAP   PPP P 
   170  166 L Q        -     0   0   18  229   76  SS SSS SSSSSSVGS SSS S   SSSSSSSS S .VVSSS S SS   SVSSSSSSSSS   SSS S 
   171  167 L D     >  -     0   0   48  229   61  KK KKK KKKKKKLVK KKK K   KKKKKKKK K LTTKKK K KK   KLKKKKKKKKK   KKK K 
   172  168 L S  T  4 S+     0   0   54  232   60  QQ QQQ QQQQQQQLQ QQQ Q   QQQQQQQQ Q QGGQQQ Q QQ   QGQQQQQQQQQ   QQQ Q 
   173  169 L K  T  4 S+     0   0  180  232   58  SS SSS SSSSSSKQS SSS S   SSSSSSSS S KSSSSS S SS   NRSSSSSSSSS   SSS S 
   174  170 L D  T  4 S-     0   0   57  232   39  NN NNN NNNNNNDEN NNN N   NNNNNNNN N DDDDNN N NN   NDNNNNNNNNN   NNN N 
   175  171 L S     <  +     0   0    4  232   57  NN NNN NNNNSNGDN NNN N   NNNSSNNN N GHHNNN N NN   NGNNNNSSSSN   NNN N 
   176  172 L T        -     0   0    5  232   72  KK KKK KKKKKKLgK KKK K   KKKKKKKK K LSSKKK K KK   KHKKKKKKKKK   KKK K 
   177  173 L Y  E     -C  143   0K   7  226    4  YY YYY YYYYYYYyY YYY Y   YYYYYYYY Y YYYYYY Y YY   YYYYYYYYYYY   YYY E 
   178  174 L S  E     -     0   0K   1  226   72  AA AAA AAAAAASSA AAA A   AAAAATAA A SSSMAA A AA   MSAAAAAAAAA   AAA A 
   179  175 L M  E     -CD 140 167K   0  227   79  AA AAA AAAAAAWWA AAA A   AAAAAAAA A WVVAAA A AA   AWAAAAAAAAA   AAA A 
   180  176 L S  E     -CD 139 166K   3  229    6  SS SSS SSSSSSSSS SSS S   SSSSSSSS S SSSSSS S SS   SSSSSSSSSSS   SSS S 
   181  177 L S  E     -CD 138 165K   0  229    4  SS SSS SSSSSSSSS SSS S   SSSSSSSS S SSSSSS S SS   SSSSSSSSSSS   SSS S 
   182  178 L T  E     -CD 137 164K   2  230   72  YY YYY YYYYYYTTY YYY Y   YYYYYYYY Y TTTYYY Y YY   YTYYYYYYYYY   YYY Y 
   183  179 L L  E     -CD 136 163K   0  231    1  LL LLL LLLLLLLLL LLL L   LLLLLLLL L LLLLLL L LL   LLLLLLLLLLL   LLL L 
   184  180 L T  E     +C  135   0K  36  231   54  SS SSS SSSSSSRRS SSS S   SSSSSSSS S RTTSSS S SS   TSSSSSSSSSS   TTT S 
   185  181 L L  E     -C  134   0K  16  231   14  LL LLL LLLLLLLLL LLL L   LLLLLLLL L LLLLLL L LL   LLLLLLLLLLL   LLL R 
   186  182 L T  E  >  -C  133   0K  81  230   58  TT TTT TTTTTTPPT TTT T   TTTTTTTT T PPPDTT T TT   TPTTTTTTTTT   TTT T 
   187  183 L K  H >> S+     0   0   66  227   67  PP PPP PPPPDPAAP PPP P   PPPSSPSP P AAAAPP P PP   AAPPPPSSSSP   PPP S 
   188  184 L D  H 3> S+     0   0  109  228   63  EE EEE EEEESQDDE EEE E   EEESSDDQ E DQQSEE E EE   KDEEEESSSSQ   AAA D 
   189  185 L E  H >4 S+     0   0   53  228   49  QQ QQQ QQQQDQQQQ QQQ Q   QQQDDKQQ Q QVVKQQ Q QQ   AQQQQQDDDDQ   QQQ Q 
   190  186 L Y  H X< S+     0   0    6  226   12  WW WWW WWWWWWWWW WWW W   WWWWWWWW W WWWWWW W WW   WWWWWWWWWWW   WWW W 
   191  187 L E  H 3< S+     0   0   90  226   71  KK KKK KKKKKKEEK KKK K   KKKKKKKK K EAATRK K KK   ERKKEKKKKKK   KKK K 
   192  188 L R  T << S+     0   0  160  226   61  SS SSS SSSSSSKKS SSS S   SSSSSSSS S KSSSSS S SS   TKSSSSSSSSS   SSS S 
   193  189 L H    <   -     0   0   24  224   55  HH HHH HHHHKR VH HHH H   HHHKKHHR H  DDHHH H HH   HAHHHHKKKKR   HHH H 
   194  190 L N  S    S+     0   0   97  224   71  KR RRK RRRRGS CK RRR R   RRRGGSKS R  AADKR K KR   SGRRRRGGGGS   NNN K 
   195  191 L S  E     + G   0 214L  37  224   71  SS SSS SSSSSS SS SSS S   SSSSSSSS S  RRTSS S SS   SSSSSSSSSSS   SSS S 
   196  192 L Y  E     +EG 154 213L   0  224   14  YY YYY YYYYYY VY YYY Y   YYYYYFYY Y  FFYYY Y YY   YVYYYYYYYYY   YYY Y 
   197  193 L T  E     -EG 153 212L   3  223   48  SS SSS SSSSSS TS SSS S   SSSSSSSS S  SSTSS S SS   SSSSSSSSSSS   SSS S 
   198  194 L b  E     -EG 152 211L   1  223    0  CC CCC CCCCCC CC CCC C   CCCCCCCC C  CCCCC C CC   CCCCCCCCCCC   CCC C 
   199  195 L E  E     -EG 151 210L  34  212   62  QQ QQQ   QQEH EQ QQQ Q   QQ EELQH Q  VVQQQ Q QQ   QE   QEEEEH   QQQ Q 
   200  196 L A  E     -EG 150 209L   1  212   22  VV VVV   VVVV AV VVV V   VV VVVVV V  VVVVV V VV   VA   VVVVVV   VVV V 
   201  197 L T  E     +E  149   0L  36  212   35  TT TTT   TTTT TT TTT T   TT TTTTT T  TTTTT T TT   TS   TTTTTT   TTT A 
   202  198 L H  E >   - G   0 205L  18  212   27  HH HHH   HHHH QH HHH H   HH HHHHH H  HHHHH H HH   HL   HHHHHH   HHH H 
   203  199 L K  T 3  S+     0   0  145  211   56  EE EEE   EEEE GE EEE E   EE EEQEE E  EEDEE E EE   EN   EEEEEE   EEE E 
   204  200 L T  T 3  S+     0   0   55  211   41  GG GGG   GGGG SG GGG G   GG GGGGG G  SSGGG G GG   GG   GGGGGG   GGG G 
   205  201 L S  E <   -G  202   0L  45  187   83  SS SSS   SSSK HS SSS S   SS SSSSK S  LLKSS S SS   HQ   SSSSSK   SSS S 
   206  202 L T  E    S+     0   0L 140  187   30  TT TTT   TTTT TT TTT T   TT TTTTT T  TTTTT T TT   TS   TTTTTT   TTT T 
   207  203 L S  E    S-     0   0L  82   90   51                P                      GG            P                  
   208  204 L P  E     -     0   0L  43   67   33                L                      PP                               
   209  205 L I  E     -G  200   0L  46   67   29                L                      LL                               
   210  206 L V  E     +G  199   0L  70   63   53                                       TT                               
   211  207 L K  E     +G  198   0L  85   63   26                                       QQ                               
   212  208 L S  E     -G  197   0L  67   63   28                                       TT                               
   213  209 L F  E     -G  196   0L  30   63   18                                       II                               
   214  210 L N  E      G  195   0L  99   63   62                                       RR                               
   215  211 L R              0   0   82   54   19                                                                        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  213   30    Q   E         D   D QQD        E        E E  EDE           E     Q  
   218    2 H V        +     0   0   30  215   38    V   V         V   V VIV        V        V A  VVV           V     V  
   219    3 H K  E     -A  241   0A 143  215   52    Q   Q         Q   Q HTQ        Q        Q Q  KKH           Q     Q  
   220    4 H L  E     -A  240   0A  11  231    3    L   L         L   L LLL        L L      L V  LLL           LLL   L L
   221    5 H Q  E     -A  239   0A 120  231   74    V   V         A   A VDV        V T      V V  VVV           VTT   Q T
   222    6 H E  E     -A  238   0A   2  232   34    Q   E         Q   Q EQE        E Q      E E  EEE           EQQ   E S
   223    7 H S  E     +A  237   0A  48  232   22    S   S         S   S SPS        S S      S S  SSS           SSS   S S
   224    8 H G        -     0   0   35  232   24    G   G         E   E GGG        G E      G G  GGG           GEE   G D
   225    9 H P        -     0   0   50  232   51    A   G         P   S GSG        G A      G G  GGG           GAA   P S
   226   10 H A  S    S+     0   0   30  232   54    D   G         V   V GTG        G V      G G  GGG           GVV   G V
   227   11 H V  E     -d  334   0B  33  233   26    V   L         V   V VLL        L I      L L  LLL           LII   L V
   228   12 H I  E     -d  335   0B   9  233   54    K   V         I   I VVV        V K      V V  VVV           VKK   V K
   229   13 H K        -     0   0  104  233   49    K   K         K   K QKP        Q R      Q Q  QKK           QRR   K R
   230   14 H P  S    S+     0   0   56  233   12    P   P         P   P PPP        P P      L P  PPP           PPP   P P
   231   15 H S  S    S+     0   0   90  233   20    G   G         G   G GSG        G E      G G  GGG           GEE   S G
   232   16 H Q  S    S-     0   0   76  233   60    A   G         G   G RDG        G E      G G  TGG           GEE   Q E
   233   17 H S        -     0   0   51  232   21    S   S         S   S STS        S S      S S  SSS           SSS   T S
   234   18 H L  E     - B   0 300A   1  232   46    V   L         H   H LLR        L H      L L  LLL           LHH   L V
   235   19 H S  E     - B   0 299A  64  233   50    K   R         K   K RKK        R R      R R  TRK           RRR   S T
   236   20 H L  E     - B   0 298A   1  233   15    V   L         L   L LIL        L L      L L  LLL           LLL   L L
   237   21 H T  E     -AB 223 297A  29  233   34    S   S         S   S SAS        S T      S S  SSS           STT   T S
   238   22 H c  E     -AB 222 296A   0  234    0    C   C         C   C CCC        C C      C C  CCC           CCC   C C
   239   23 H I  E     -AB 221 295A  54  233   74    K   A         T   T AKA        A T      A A  AAV           ATT   A T
   240   24 H V  E     -A  220   0A   4  233   54    A   A         A   P ALA        A T      T A  TAV           ATT   I V
   241   25 H S  E     +A  219   0A  60  234    9    S   S         S   S FSS        S S      S S  SSS           SSS   S S
   242   26 H G  S    S+     0   0   54  228    4    G   G         G   G G.G        G G      G G  GGG           GGG   G G
   243   27 H F  S    S-     0   0   37  199   30    Y   L         F   F F.F        F F      L F  FFF           F..   D .
   244   28 H S    >   -     0   0   44  201   49    T   S         T   T T.T        T T      T P  TIS           T..   S .
   245   29 H I  T 3  S+     0   0    2  232   27    F   F         F   F FVF        F F      F F  FFF           FFF   V I
   246   30 H T  T 3   +     0   0   59  232   53    T   S         S   S GSS        S R      T S  TST           STT   S S
   247   31 H R  S X  S-     0   0  145  234   77    N   T         S   D DVN        S S      K S  ENS           SFF   S M
   248   32 H T  T 3  S+     0   0   72   68   71    .   .         .   . .S.        . .      . .  ...           .SS   N S
   249   33 H N  T 3  S+     0   0   16   73   70    .   .         .   . .S.        . .      . .  ...           .SS   S S
   250   34 H Y  E <   -E  317   0C  23  234   47    Y   Y         Y   H HYY        Y Y      Y F  YSY           YYY   A Y
   251   35 H d  E     -EF 316 270C   0  224   90    F   A         A   W SYG        A E      W W  YYD           AWY   T W
   252   35AH W  E     -EF 315 269C   1  222   46    F   M         M   M MWM        M M      M M  MMM           MMM   W M
   253   35BH H  E     -EF 314 268C   0  231   72    H   N         S   N HTH        D N      T T  SSS           GHN   N H
   254   36 H W  E     +EF 313 267C   1  233    1    W   W         W   W WWW        W W      W W  WWW           WWW   W W
   255   37 H I  E     -EF 312 265C   0  233   13    V   V         V   V VVV        V I      V V  VVV           VII   I I
   256   38 H R  E     -EF 311 264C  10  234   15    R   R         R   R RRR        R R      R R  RRR           RRR   R R
   257   39 H Q  E     -EF 310 263C  22  233    3    Q   Q         Q   Q QQQ        Q Q      Q Q  QQQ           QQQ   Q Q
   258   40 H A    >   -     0   0   14  233   59    A   A         A   A ATA        A A      A A  PTT           AAA   S K
   259   41 H P  T 3  S+     0   0   99  234   20    P   P         P   P PPP        P P      P P  PPP           PPP   P P
   260   42 H G  T 3  S+     0   0   94  234   11    G   G         G   G GGE        G G      G G  GEE           GGG   S G
   261   43 H K  S <  S-     0   0  140  234   34    Q   K         K   K RKK        K K      K K  RKR           KKK   R K
   262   44 H G        -     0   0   20  234   23    G   G         G   G GGG        G G      G G  ARR           GGG   G G
   263   45 H L  E     -F  257   0C  10  234    6    P   L         L   L LLL        L L      L L  LLL           LLL   L L
   264   46 H E  E     -F  256   0C  79  234   10    E   E         Q   Q EEE        E E      E E  EEE           EEE   E E
   265   47 H W  E     +F  255   0C  13  234    9    W   W         W   W WYW        W W      W W  WWW           WWW   W W
   266   48 H M  E     -     0   0C   3  234   31    M   V         V   L MMV        V I      V V  LVV           VII   L I
   267   49 H G  E     -FG 254 277C   0  234   42    G   S         S   S AGA        G A      A A  GAA           SAA   G G
   268   50 H R  E     -FG 253 276C  10  234   92    M   S         A   N LRY        F F      N S  FTA           TYI   R Y
   269   51 H I  E     -FG 252 275C   3  234   20    I   I         I   I TII        I I      I I  III           III   T I
   270   52 H d  E >   -F  251   0C   0  234   84    N   S         S   Y WTS        R S      N N  RST           YGH   Y D
   271   53 H Y  T 3  S+     0   0   47  234   85    p   s         D   d FSS        n T      E K  nnS           NTP   y T
   272   54 H E  T 3  S-     0   0   63  232   61    d   i         g   n dSs        n s      d d  taG           Gss   n G
   273   55 H G  S <  S+     0   0   25  185   36    G   .         g   . sGg        g s      s r  ..G           Gss   . T
   274   56 H S        -     0   0   42  200   70    S   .         S   . NVT        T P      D D  ..N           SPP   . T
   275   57 H I  E     -G  269   0C  71  215   54    T   .         T   . NTI        A I      E S  PTT           TII   . A
   276   58 H Y  E     -G  268   0C  70  222   77    K   Y         Y   . YEF        E Y      Y Y  EHY           YYY   D Y
   277   59 H Y  E     -G  267   0C  41  227   14    Y   Y         Y   Y YHY        Y Y      Y Y  YYY           YYY   Y Y
   278   60 H S    >>  -     0   0   11  231   57    A   R         A   A ATA        A S      V V  SPP           ASS   A A
   279   61 H P  T 34 S+     0   0   76  234   56    Q   D         D   D DSD        A P      G E  ADD           DPP   Q Q
   280   62 H S  T 34 S+     0   0   79  234   55    R   S         S   S SST        S S      S S  SSN           SSS   S S
   281   63 H I  T X4 S+     0   0    4  234   43    F   V         V   L VFV        V V      V V  VMV           VVV   V L
   282   64 H K  G >< S+     0   0  133  234   33    Q   K         K   K KQK        K K      E K  QKK           KKK   Q Q
   283   65 H S  G 3  S+     0   0  116  234   31    G   G         G   G GNG        G G      G G  GGG           GGG   N G
   284   66 H R  G <  S+     0   0   51  234   16    R   R         R   R RRR        R R      R R  RRR           RRR   R Q
   285   67 H S  E <   -C  300   0A  11  234   54    V   F         F   F FVF        F F      F F  FFF           FFF   I F
   286   68 H T  E     -C  299   0A  67  220   24    S   T         T   T TTT        T T      T T  TTT           TTT   S T
   287   69 H I  E     +C  298   0A   3  220   25    M   I         I   I ILI        I I      I I  IIV           III   I I
   288   70 H S  E     -C  297   0A  56  234   45    T   S         S   S STS        S S      S S  SSS           SSS   N T
   289   71 H R  E     -C  296   0A  71  234   70    R   R         R   R RRR        R R      R R  RRR           RRR   P K
   290   72 H D  E >>> -C  295   0A  55  234   18    D   D         D   D DDD        D D      D D  DDD           DDD   D D
   291   73 H T  T 345S+     0   0   78  233   60    T   N         N   N NAN        D D      N N  NNN           NDN   T T
   292   74 H S  T 345S+     0   0  105  233   44    S   A         N   N IAA        S S      A A  SAA           ASP   S S
   293   75 H L  T <45S-     0   0  103  234   70    T   K         N   N RKK        K S      K E  QQK           KSS   K K
   294   76 H N  T  <5 +     0   0   29  234   47    S   N         N   N NNN        N S      S T  NNY           NSS   N N
   295   77 H K  E   < -BC 239 290A  51  234   64    T   S         K   K IET        S K      S S  ITT           SKK   Q M
   296   78 H F  E     -BC 238 289A   1  234   61    I   L         L   L LIL        L L      L L  LVL           LLL   F L
   297   79 H F  E     -BC 237 288A  50  234   27    Y   Y         Y   Y YYF        Y Y      Y Y  YLY           YYY   S Y
   298   80 H I  E     -BC 236 287A   4  234    5    M   L         L   L LLL        L L      L L  LLL           LLL   L L
   299   81 H Q  E     -BC 235 286A  73  234   36    E   Q         Q   Q QAQ        Q Q      Q Q  QQQ           QQQ   Q E
   300   82 H L  E     -BC 234 285A   3  234   23    L   M         M   M ILM        M M      M M  MMM           MMM   L V
   301   82AH I        +     0   0   70  234   62    S   N         N   N NST        N N      N G  NTS           NNN   N K
   302   82BH S  S    S-     0   0   59  234   35    S   S         N   N RSS        R S      S S  TSS           SSS   S S
   303   82CH V        -     0   0    0  234   13    L   L         L   L LML        L L      L L  LLL           LLL   V L
   304   83 H T    >   -     0   0   65  234   62    R   R         Q   Q RRR        K K      R R  RNK           RKK   T K
   305   84 H N  G >  S+     0   0  120  234   65    S   V         T   T DSS        T T      A A  ASS           ATT   P S
   306   85 H E  G 3  S+     0   0  160  234   25    E   D         E   E EEE        E E      E E  EEE           EEE   E E
   307   86 H D  G <  S+     0   0    0  234    1    D   D         D   D DDD        D D      D D  DDD           DDD   D D
   308   87 H T    <   +     0   0   30  234   32    T   T         T   T TST        A S      T T  STT           TSS   M T
   309   88 H A  E    S- H   0 333C   3  234    4    A   A         A   A AGA        A A      A A  AAA           AAA   A A
   310   89 H M  E     -EH 257 332C  43  234   58    M   V         V   V VTM        M V      V V  TVM           VVV   V V
   311   90 H Y  E     -EH 256 331C   2  234    0    F   Y         Y   Y YYY        Y Y      Y Y  YYY           YYY   Y Y
   312   91 H Y  E     -E  255   0C   1  234    3    F   Y         Y   Y YYY        Y Y      Y Y  YYY           YYY   Y Y
   313   92 H c  E     +E  254   0C   0  234    1    C   C         C   C CCC        C C      C C  CCC           CCC   C C
   314   93 H S  E     -EI 253 327C   0  234   30    A   A         A   A AGA        A A      A A  ATV           AAA   A A
   315   94 H R  E     -EI 252 326C  20  233   44    R   R         R   K RSR        G R      R R  RRR           RRR   R R
   316   95 H E  E     -EI 251 324C   0  233   77    A   D         H   H EGL        D D      Y K  AGP           DDD   D T
   317   96 H N  E  >> -E  250   0C   6  233   90    G   S         G   M RVY        T T      H F  YDE           TAP   T S
   318   97 H H  T  45S+     0   0    0  233   93    P   C         G   G GGY        V Q      L M  SYI           VHH   V H
   319   98 H M  T  45S+     0   0   73  234   93    G   N         G   V TLS        R V      V F  NWP           GDD   R C
   320   99 H Y  T  45S+     0   0  159  234   92    Y   G         S   A LDN        G Y      P D  YYI           ADG   G D
   321  100 H E  T  <5 -     0   0   54  234   90    g   a         W   D mYy        a h      g s  YFy           sYA   s Y
   322  100AH T      < +     0   0    0  139   91    y   y         .   . d.g        p t      e h  ..s           d..   n .
   323  100BH Y  S    S-     0   0   10  161   90    Y   G         Y   A A.A        C N      F Y  ..Y           H..   W Y
   324  100CH F  E     +I  316   0C   0  185   48    F   F         F   F L.M        R F      V F  F.F           HFF   F F
   325  101 H D  E     +     0   0C  42  205   40    D   S         E   D D.D        G D      D D  DDD           SDD   D D
   326  102 H V  E     -I  315   0C  35  212   66    Y   P         H   Y M.Y        A Y      L L  NVS           GYY   V Y
   327  103 H W  E     -I  314   0C  28  221    8    W   W         W   W WWW        R W      W W  WWW           WWW   W W
   328  104 H G        -     0   0    3  229    7    G   G         G   G GGG        g G      G G  GGG           SGG   G G
   329  105 H Q        -     0   0  100  223   52    Q   Q         Q   A QQQ        q Q      Q R  QAQ           .KK   P K
   330  106 H G        -     0   0    3  228    7    G   G         G   G GGG        G G      G G  GGG           .GG   G G
   331  107 H T  E     -H  311   0C  27  233   39    T   T         T   T TTT        A T      V T  TTT           QTT   V T
   332  108 H T  E     -H  310   0C  48  234   79    L   L         M   M LMS        T T      L Q  TTT           VQM   L K
   333  109 H V  E     -H  309   0C   0  234   19    V   V         V   V VVV        V V      V V  LVI           EVV   V V
   334  110 H T  E     -d  227   0B  16  234   41    T   T         T   T TTT        T T      T T  TTT           ATT   T T
   335  111 H V  E     +d  228   0B   2  234    9    V   V         V   V VVV        L V      V V  VVV           VVV   V V
   336  112 H S        -     0   0   18  234   31    S   S         T   T STS        A S      S S  SSS           ATT   S S
   337  113 H S  S    S+     0   0   99  234   19    S   S         S   S SSS        S S      S S  SSS           SSS   S S
   338  114 H A  S    S-     0   0   31  234   51    A   A         A   V TAE        E E      A A  EEE           EvA   G a
   339  115 H K        -     0   0  143  234   66    S   S         T   T STP        S T      S S  PPS           SaA   S p
   340  116 H T        -     0   0   44  234   72    P   P         S   A PLA        P T      P P  AAA           PSS   A S
   341  117 H T  B     -J  370   0D  35  234   73    T   T         N   S THR        T A      T T  RRR           TTT   S A
   342  118 H P        -     0   0   60  234   66    S   S         P   A SAE        K S      S S  EEN           KRR   A P
   343  119 H P        -     0   0   13  234   17    P   P         P   P PPP        P P      P P  PPP           PPP   P Q
   344  120 H S  E     -K  367   0E  51  234   57    K   K         S   S KST        Q T      K K  TTT           QTT   T S
   345  121 H V  E     -K  366   0E   6  234   25    V   V         L   V VVI        V L      V V  III           VLL   L V
   346  122 H Y  E     -K  365   0E  27  234   14    F   F         F   F FFY        F F      F F  YYY           FFF   F F
   347  123 H P  E     -K  364   0E  15  234   27    P   P         P   P PPP        P P      P P  PPP           PPP   P G
   348  124 H L  E     +K  363   0E   4  234   22    L   L         L   L LLL        L L      L L  LLL           LLL   L L
   349  125 H A        -     0   0   10  234   68    S   S         I   I SRT        S V      S S  TTT           SMM   V S
   350  126 H P        -     0   0   24  234   77    L   L         S   P LPF        L M      L L  FFL           LQQ   S Q
   351  127 H G  S    S-     0   0   16  234   65    D   C         C   C CCP        C C      D D  PPP           CCC   C C
   352  128 H S  S    S+     0   0   99  234   67    S   S         G   C SCQ        S Q      S S  QQR           SGG   E S
   353  129 H A        +     0   0   52  234   79    T   T         E   d TgA        E P      T T  AAA           ESS   n S
   354  130 H A        +     0   0   70  145   76    .   .         .   v .s.        . .      . .  ...           ...   p .
   355  133 H Q        +     0   0  178  219   82    P   Q         .   D QSL        Q G      P P  LLL           QGG   L G
   356  134 H T    >   -     0   0   64  231   47    Q   P         S   F PSS        P C      Q Q  SSS           PTT   D S
   357  135 H N  T 3  S-     0   0  146  232   60    D   D         M   N DDS        D A      D D  SSS           DGG   T D
   358  136 H S  T 3  S+     0   0   63  232   58    G   G         D   D GSD        G D      G G  DDD           GDN   N G
   359  137 H M  E <   - L   0 408E  83  232   79    N   N         P   S NHP        N E      N N  PPP           NTT   E S
   360  138 H V  E     - L   0 407E  15  233   38    V   V         V   V VVV        V I      V V  VVV           VVV   V I
   361  139 H T  E     + L   0 406E  15  234   68    V   V         T   T VTI        V T      V V  III           VTT   A T
   362  140 H L  E     + L   0 405E   0  234   26    V   I         I   M III        V V      V V  III           VLL   V L
   363  141 H G  E     -KL 348 404E   0  234   28    A   A         G   G AGG        A G      A A  GGG           AGG   G G
   364  142 H e  E     -KL 347 403E   1  234    1    C   C         C   C CCC        C C      C C  CCC           CCC   C C
   365  143 H L  E     -KL 346 402E   2  234   12    L   L         L   L LLL        L L      L L  LLL           LIF   L L
   366  144 H V  E     -KL 345 401E   1  234   46    V   V         A   V VSI        V A      V V  III           VAA   A A
   367  145 H K  E     -KL 344 400E  38  231   68    Q   Q         K   T QTH        R H      Q Q  HHH           RSS   Q K
   368  146 H G  E    S+     0   0E  19  234   40    G   G         D   G GGD        S D      G G  DDD           SGG   D G
   369  147 H Y  E     - L   0 399E   0  234    5    F   F         F   Y FFY        F F      F F  YYY           FFF   F F
   370  148 H F  B     +J  341   0D   3  234   40    F   F         L   M FLF        F F      F F  FFF           FSS   L S
   371  149 H P  S    S-     0   0    0  234   15    p   p         P   A pPp        p P      p p  ppp           pPP   P p
   372  150 H E  S    S+     0   0   53  231   47    e   e         E   D eAg        e E      e e  ggg           eSS   D d
   373  151 H P        +     0   0   59  232   52    P   P         T   P PPT        P S      P P  TTT           PSS   S S
   374  152 H V        -     0   0   20  233   39    L   L         I   L LVM        L L      L L  MMM           LLL   I L
   375  153 H T  E     +N  422   0F  83  234   67    S   S         S   D SDN        S T      S S  NNN           STT   T N
   376  154 H V  E     +N  421   0F  23  234   44    V   V         F   I VVV        V F      V V  VVV           VFF   F F
   377  156 H T  E     -N  420   0F  48  234   51    T   T         T   Q TKT        T Q      T T  TTT           TAA   S K
   378  157 H W  E > >S-NO 419 383F   2  234    0    W   W         W   W WWW        W W      W W  WWW           WWW   W W
   379  162 H N  G > 5S-     0   0   38  234   61    S   S         g   N SNG        S T      S S  GGG           Snn   k k
   380  163 H S  G 3 5S-     0   0   91  234   63    E   E         k   D ESK        Q N      E E  KKK           Qvv   k p
   381  164 H G  G < 5S+     0   0   39  234   50    S   S         N   G SGS        S A      S S  SSS           SNN   N A
   382  165 H S  T < 5 +     0   0   93  234   53    G   G         n   S GSG        G K      G G  GGG           Ggg   n g
   383  166 H L  B   < +O  378   0F  43  228   74    Q   Q         y   I QIK        T G      Q Q  KKK           .aa   i l
   384  167 H S        +     0   0   88  231   64    N   G         S   T GTD        T A      N N  DDD           .LL   S S
   385  168 H S  S    S+     0   0  101  231   73    V   V         T   T VSI        T V      V V  III           .TT   K D
   386  169 H G  S    S+     0   0   32  226   40    T   T         G   G TGT          T      T T  TTT           TDD   G .
   387  171 H V        +     0   0   48  232   57    A   A         L   I ALT          S      A A  TTT           TFF   V F
   388  172 H H  E     -M  404   0E  17  233   79    R   R         K   K RKV          D      R R  VVV           TII   W V
   389  173 H T  E     -M  403   0E  69  233   67    N   N         S   T NNN          K      N N  NNN           HQQ   G Q
   390  174 H F  E     -M  402   0E   1  233   11    F   F         Y   M FFF          Y      F F  FFF           FYY   F Y
   391  175 H P  E     -     0   0E  65  232   17    P   P         K   R PPP          P      P P  PPP           PPP   P P
   392  176 H A  E     -     0   0E  19  233   53    P   P         P   P PAP          S      P P  PPP           PPP   S A
   393  177 H V  E     -M  400   0E  42  233   54    S   S         V   V SVA          T      S S  AAA           SVV   V F
   394  178 H L  E     -M  399   0E  77  233   51    Q   Q         M   L QLL          L      Q Q  LLL           QRR   L G
   395  179 H Q  S    S-     0   0   83  233   65    D   D         Q   S DQA          N      D D  AAA           AKE   R K
   396  180 H S  S    S-     0   0  116  233   55    a   a         s   d aqs          n      a a  sss           aGG   G E
   397  183 H D  S    S+     0   0   90  226   21    g   g         g   d ggg          k      g g  ggg           gDD   G G
   398  184 H L        -     0   0   53  224   74    l   l         S   l lLR          .      l l  RRG           lFF   K D
   399  185 H Y  E     -LM 369 394E  36  230    2    Y   Y         Y   Y YFY          Y      C Y  YYY           YYY   Y Y
   400  186 H T  E     +LM 367 393E   5  228   48    T   T         S   T TAT          T      T T  TTT           TTT   A T
   401  187 H L  E     -L  366   0E  11  225   53    T   T         A   L TSM          G      T T  MMM           TGG   A K
   402  188 H S  E     -LM 365 390E   5  225   25    S   S         S   S SSS          V      S S  SSS           SVV   T I
   403  189 H S  E     -LM 364 389E   2  225    1    S   S         S   S SSS          S      S S  SSS           SSS   S S
   404  190 H S  E     -LM 363 388E   0  225   78    Q   Q         Q   Q QQQ          L      Q Q  QQQ           QNN   Q H
   405  191 H V  E     -L  362   0E   0  225   27    L   L         V   L LLL          L      L L  LLL           LII   V I
   406  192 H T  E     +L  361   0E  48  225   41    T   T         N   T TTT          K      T T  TTT           TRR   L R
   407  193 H V  E     -L  360   0E  14  224   29    L   L         V   I LIL          V      L L  LLL           LVV   L V
   408  194 H P  E  >  -L  359   0E  56  223   43    P   P         A   L PPP          S      P P  PPP           PSS   A K
   409  195 H S  T  4 S+     0   0   49  222   51    A   A         S   A ALA          K      A A  AAA           ARR   S K
   410  196 H S  T  4 S+     0   0   66  222   64    T   T         A   S TSV          S      T T  VVV           AQQ   K S
   411  198 H P  T  > S+     0   0   31  222   70    Q   Q         V   E QDE          D      Q Q  EEE           Qdd   d D
   412  199 H R  T  < S+     0   0   16  222   99    C   C         W   W CWC          W      C C  CCC           Cee   q W
   413  200 H P  T  4 S+     0   0   80  223   71    P   L         D   K LKP          N      P P  PPP           PAA   G I
   414  202 H S  T  4 S+     0   0  111  221   68    D   A         K   N AAE          S      D D  EEE           DKK   T D
   415  203 H E  S  < S-     0   0  128  221   75    G   G         M   S GKG          R      G G  GGG           TDD   D T
   416  204 H T        -     0   0   83  221   71    k   k         e   T kKe          r      k k  eee           kaa   e k
   417  205 H V        +     0   0    4  217   60    v   v         f   Y vIv          f      v v  vvv           vff   v y
   418  206 H T  E     - P   0 433F  23  217   76    T   T         Y   K TLK          Q      T T  KKK           KRR   V T
   419  208 H e  E     -NP 378 432F   0  220    1    C   C         C   C C C          C      C C  CCC           CCC   C C
   420  209 H N  E     -NP 377 431F   4  220   59    H   H         N   K H S          S      H H  SSS           SAA   K E
   421  210 H V  E     -NP 376 430F   1  220   24    V   V         A   V V V          V      V V  VVV           VAA   V A
   422  211 H A  E     -NP 375 429F  14  220   74    K   K         K   V K Q          T      K K  QQQ           KTT   Q S
   423  212 H H  E > > - P   0 428F   1  220   17    H   H         H   H H H          H      H H  HHH           HHH   H N
   424  213 H P  G > 5S+     0   0   77  209   81    Y             L   N Y D          T           DDD            AA   P S
   425  214 H A  G 3 5S+     0   0   40  203   65    T             D   Y T S          G           SSS            AA   N V
   426  215 H S  G < 5S-     0   0   32  202   63    N             T   T N N          G           NNN            GG   G G
   427  216 H S  T < 5 +     0   0  111  199   72    S             I   N P P          S           PPA            PP   N A
   428  217 H T  E   < +P  423   0F  35  196   63    S             K   T S V          K           VVV            VV   K P
   429  218 H K  E     +P  422   0F 135  196   50    Q             S   K Q Q          S           QQQ            EE   E K
   430  219 H V  E     -P  421   0F  38  140   32                  V   Q              V                          VV   Q T
   431  220 H D  E     -P  420   0F  97  140   36                  E   E              T                          TT   N A
   432  221 H K  E     -P  419   0F  51  127   45                  L   K                                              V  
   433  222 H K  E     -P  418   0F 121  127   48                  K   S                                              P  
   434  223 H I        -     0   0    4  123   30                      L                                              L  
   435  224 H V        -     0   0   79  112   59                                                                        
   436  225 H P              0   0   73  103   61                                                                        
   437  226 H R              0   0  167   89   21                                                                        
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1    1 L D              0   0  100   77   31  EEE   Q                        D                Q              E      
     2    2 L I        -     0   0    0   88   32  LLL   V                        L                V              L      
     3    3 L V        -     0   0   88   98   48  VVV   T                        V                T              I      
     4    4 L M  E     -Q   25   0G  12  101   21  MMM   V                        M                V              MM     
     5    5 L T  E     -Q   24   0G  80  101   14  TTT   T                        T                T              TT     
     6    6 L Q  E     -Q   23   0G  19  101    5  QQQ   Q                        Q                Q              QQ     
     7    7 L S  E    S+Q   22   0G  57  101   57  TTT   T                        T                S              TT     
     8    8 L P        -     0   0   47  148    6  PPP P PP  P                  P PP    P      P   P            P PP     
     9    9 L A  S    S-     0   0   79  156   68  SSS SASS  S                  A SP    A      P  AAAA          P SS     
    10   10 L S  E     -t  107   0H  78  168   57  IMM SSVS  S              S  SS MS    S      VS SVSS     SS   S MM     
    11   11 L L  E     -t  108   0H  34  204   48  LLL EVLV  V           L  VVVVV LV   LV      VVLVRVVVVL  VV   V LL     
    12   12 L V  E     +t  109   0H  86  214   38  PPP SSLS  S           T  TSSSS PS   TS      TSTSSSSSSTS SS   S SP     
    13   13 L V  E     -t  110   0H  17  216   57  VVV VVSG  G           V  AGGGA VG   VV      SAVVIVVGGTV GA   V VV     
    14   14 L S  E >   -t  111   0H  46  224   63  TTT SSES  S           S  QTTTN TN   SS      ANSSTSSTTSN TN   S TT     
    15   15 L L  T 3  S+     0   0   79  225   67  VVV PVPL  L           P  APPPL VP   PV      PPPVQVVPPPLPPP   L VV     
    16   16 L G  T 3  S+     0   0   39  233    6  GGG GGGG  G           G  GGGGG GGG  GG      GGGGGGGGGGEGGGG GG GG G   
    17   17 L Q    <   -     0   0   97  233   51  QQQ GGQQ  Q           G  QQQSG QQQ  GG      SEGGEGGQQEQGSEQ HQ QQ Q   
    18   18 L R        -     0   0  152  233   63  TTT TTSR  R           T  ASSST TRT  TT      TTTTTTTSSTTTSTT TN TT T   
    19   19 L A  E     - R   0  79G   2  233   43  AAA VVLV  V           V  VVVVV AVA  VV      VVVVLVVVVVAVVVA AG AA V   
    20   20 L T  E     - R   0  78G  66  233   58  TTT KTTS  S           T  STTTK TTR  TT      TKTTTKKTTTRSTKR KQ TT T   
    21   21 L I  E     - R   0  77G   0  233   23  III LLVI  I           L  IIIII MII  LL      LILLILLIILIIIII LI II I   
    22   22 L S  E     -QR   7  76G  36  233   53  TTT STHT  T           T  TSSST TST  TT      TTTTSTTSSTTTSTT ST TT N   
    23   23 L a  E     -QR   6  75G   0  233    0  CCC CCCC  C           C  CCCCC CCC  CC      CCCCCCCCCCCCCCC CC CC C   
    24   24 L R  E     -QR   5  74G 153  233   76  KKK TERS  S           A  KTTAS KAR  GQ      KSAEKEETTRGSASS TS KK Q   
    25   25 L A  E     -Q    4   0G   6  233   70  AAA LGLG  G           S  TGGGG AGG  SG      TGSGTGGGGSGGGGG IG AA T   
    26   26 L S  S    S+     0   0   63  233   52  SSS TDSS  S           S  STTSG SSD  TN      SDSDSDDTTSDDSGD SN SS S   
    27   27 L E  S    S-     0   0  105  233   74  NSS GDRS  S           T  TSSSS RSN  TN      QRTNQDDSSTNLSSK GS SS R   
    28   27AL S        -     0   0   29  233   75  SSS VIDS  S           G  ASSNS SSI  GI      DSGFPIISSGILNSL SI SS g   
    29   27BL V        +     0   0    0   70   75  ... T...  .           .  ..... ...  P.      V.A.I.......... .. .. g   
    30   27CL D  E     +Z   35   0I  45   97   81  ... F...  .           A  VDD.. ...  V.      Y.V.S..DDA..... .. .. r   
    31   27DL S  E >  S+Z   34   0I  15  133   82  ... S.PN  N           V  WVVD. .N.  T.      T.T....VVV..DY. T. .. T   
    32   28 L Y  T 3  S-     0   0  173  140   87  ... N.VI  V           T  NGGI. .I.  S.      D.S.D..GGT..IY. I. .. H   
    33   29 L G  T 3  S+     0   0   81  224   59  III VGCG  G           S  GGGgG IGG  GG      s.GSCGGGGTGDgGD SE II g   
    34   30 L K  E <  S-Z   31   0I 112  182   77  SSS .SCR  N           D  .YYt. SGS  .G      g..SNSSYYSNKtNQ NN SS r   
    35   31 L S  E     -Z   30   0I   7  205   76  NNN .KYD  G           Y  NNNSY DYK  HK      G.HKDMMNNNKKSYE HR NN K   
    36   32 L F        +     0   0    5  218   67  YYY DAYN  Y           F  HYYGA YYY  YY      RYYYCAAAYYYYGYY RY YY C   
    37   33 L M  E     -U   94   0H   0  225   52  LLL VVVV  V           P  LVVVY LVA  PV      MYAVVVVVVASTVYI IV LL L   
    38   34 L H  E     -U   93   0H   0  229   82  SSS RQSG  S           N  ASSSG SQY  YH      SGNYSHHSSNHSSGS YQ SS S   
    39   35 L W  E     -UV  92  52H   0  233    0  WWW WWWW  W           W  WWWWW WWW  WW      WWWWWWWWWWWWWWW WW WW W   
    40   36 L Y  E     -UV  91  50H   0  233   14  YYY LYYY  Y           F  YYYYY YHY  FY      YYFYYYYYYVYHYYY LY YY Y   
    41   37 L Q  E     -UV  90  49H   4  233   29  QQQ QQLQ  Q           Q  QQQQQ QQQ  QQ      QQQQQQQQQQQQQQQ QQ QQ L   
    42   38 L Q  E     -U   89   0H  16  233   12  QQQ QQQQ  L           Q  QQQQQ QQQ  QQ      QQQQQQQQQEKQQQQ HQ QQ Q   
    43   39 L K    >   -     0   0   47  233   62  KKK KMKV  I           K  KHHRK KLK  KI      KKHMKMMHHKPKRKK RK KK K   
    44   40 L P  T 3  S+     0   0   81  233   36  AAA sLPP  P           P  PPPPs APP  PL      SaPLPLLPPPGPPsA PP AA P   
    45   41 L G  T 3  S+     0   0   58  232   13  GGG sPGG  G           G  GGGGg GRS  GP      GgGPGPPGGD.GGgG GG GG G   
    46   42 L Q  S <  S-     0   0  103  233   69  EEE ASES  S           Q  ESSTS EKQ  QS      QSQSESSSSHLQTSQ NK EE E   
    47   43 L P        -     0   0   34  233   59  RRR PAAG  A           A  AAAAV RAA  VA      PAAATAAAALDAAAS PA RR A   
    48   44 L P        -     0   0    5  233   10  PPP RPPL  P           P  PPPPP PPP  PP      PPPPPPPPPFPPPPP PP PP P   
    49   45 L K  E     -V   41   0H  96  233   63  KKK YRKR  R           R  KKKKV KEL  RR      KVRRKRRKKTVVKVV rV KK K   
    50   46 L V  E     +V   40   0H  10  233   45  LLL LLLT  T           A  LLLLT LLL  TL      LTGLLLLLLGLALTL lL LL L   
    51   47 L L  E     +     0   0H   2  233   23  LLL LILI  L           L  LMMLV LLI  LI      LLLILIIMMLIVLVV LI LL L   
    52   48 L I  E     -VW  39  58H   0  233   35  III WIII  I           I  IIIII III  II      IIIIIIIIIIIIIII YI II I   
    53   49 L Y  E  >  + W   0  57H  54  232   23  YYY YYYY  Y           Y  YYYYY YYY  YY      KYYYYYYYYGYYYYY YY YY Y   
    54   50 L I  T >4 S-     0   0   10  233   88  DDD rVYS  G           H  YDDSY RDG  DE      LDREYSSDDGRKSSR kQ RR Y   
    55   51 L A  T 34 S+     0   0    2  233   75  AAA eDTS  D           T  AVVDN AND  TN      VNTDIDDVVTDDVND eD AA I   
    56   52 L S  T 34 S+     0   0   73  233   63  TTT KSTS  T           G  TSSSN TYS  SS      NTDRSDDSSNSSSTS KR TT R   
    57   53 L N  E <<  -W   53   0H  77  233   74  TTT HNVS  S           K  TSSEN TKN  AQ      TNKKSNNSSNNESNE HR TT S   
    58   54 L L  E     -W   52   0H  63  233   66  LLL QRLR  R           K  RRRRR LRR  KR      RRKRPRRRRRQRRRR QR LL L   
    59   55 L E    >   -     0   0   49  233   81  YYY GPQP  A           H  YPPPP YPP  HP      EPHPYPPPPVPPPPP GP YY Q   
    60   56 L S  T 3  S+     0   0  107  233   40  TTT SDSS  S           S  SSSSS TSS  SA      SSSTSDDSSSSSSSS SS TT S   
    61   57 L G  T 3  S+     0   0   67  233   21  GGG GGGG  G           W  NGGGN GGG  WG      GNWGNGGGGGGGGNG GG GG E   
    62   58 L V    <   -     0   0   17  233   47  TTT VITV  V           T  TVVII TVI  TI      TITITIIVVVIIIII VI TT T   
    63   59 L P    >   -     0   0   62  233   27  PPP PPAP  P           P  PSSPP PPP  PP      PPHPPPPSSPPPPPP PP PP P   
    64   60 L A  T 3  S+     0   0   99  233   58  AAA AESD  D           A  SNNDS ADE  AE      GSAESEENNADDESE AD AA A   
    65   61 L R  T 3  S+     0   0   30  233    8  RRR RRRR  R           R  RRRRR RRR  RR      RRRRRRRRRRQRRRR RR RQ R   
    66   62 L F  E <   -S   79   0G   7  233    1  FFF FFFF  F           F  FFFFF FFF  FF      FFFFFFFFFFFFFFF FF FF F   
    67   63 L S  E     -S   78   0G  59  233   24  SSS SSSS  S           S  SSSSS SSS  SS      ISSSSSSSSSSSSSS SS SS S   
    68   64 L G  E     +S   77   0G  17  233   11  GGG gGGG  G           G  GGGGG GGG  GG      GGGGgGGGGGGGGGG gG GG g   
    69   65 L S  E     +S   76   0G  48  233   40  HHH dTSS  S           S  GSSSS HST  ST      SSSTsKKSSSTSSSS dT HH a   
    70   66 L G  E     -S   75   0G  35  233   77  QQQ GNGK  R           L  GKKSK QKN  LN      GKLNDNNKKLNSKTS NN QQ D   
    71   67 L S  E >   +S   74   0G  68  232   24  SSS SSSS  S           L  SSSSS SSS  LS      SSLSYSSSSILSSSS PS SS Y   
    72   68 L R  T 3  S-     0   0  163  232   35  SSS KGNG  G           G  RGGGG SGG  GG      SGGGGGGGGGGGGGG SG SS G   
    73   69 L T  T 3  S+     0   0   51  232   58  TTT DNSN  N           G  TNNKS TNN  DN      SSGNSNNNNDNKNSN ND TT T   
    74   70 L D  E <   +RS  24  71G  77  232   64  TTT ITDT  T           K  DTTTT TST  KT      DTKTDTTTTKTTTTT TT TT D   
    75   71 L F  E     -RS  23  70G   0  232   81  FFF FAFA  A           A  FAANG FAA  AA      FAAAFAAAAAANASA GA FF F   
    76   72 L T  E     -RS  22  69G  33  232   61  TTT YSTT  T           A  TSSTT TTT  VS      TTASTSSSSATTTTT IT TT T   
    77   73 L L  E     -RS  21  68G   0  232    4  MMM LLLL  L           L  LLLLL MLL  LL      LLLLLLLLLLLLLLL LL MM L   
    78   74 L T  E     -RS  20  67G  28  232   48  TTT TEST  T           T  STTTT TTT  TT      TTTESEETTTTTTTT TN TS T   
    79   75 L I  E     -RS  19  66G   0  232    4  III IIII  I           L  IIIII III  LI      IILIIIIIIIIIIII II II I   
    80   76 L D  S    S+     0   0   68  232   42  TTT SSSS  S           S  SSSST TAS  SS      STSSSSSSSTSSSTS ST TT S   
    81   77 L P  S    S-     0   0   51  232   61  GGG SGGS  S           G  GGGGG GGG  AG      GGGGGGGGGGGGGGG SQ GG G   
    82   78 L V        +     0   0    0  232   50  VVV VAVL  L           V  VLLVV VLA  AA      VVAAVAALLAAVLVA VA VV V   
    83   79 L E    >   -     0   0   93  232   36  QQQ EQQQ  Q           Q  QQQLQ QQQ  QQ      QQRQQQQQQQRLQQQ EQ QQ Q   
    84   80 L A  G >  S+     0   0   22  232   55  PPP AATA  P           P  TAAAA PAA  PA      TAPATAAAATAAAAA AE PP T   
    85   81 L D  G 3  S+     0   0   58  232   28  EEE EGEE  E           E  EEEEE EEE  EE      EDEGEGGEEEEEEEG EE EE E   
    86   82 L D  G <   +     0   0    1  232    0  DDD DDDD  D           D  DDDDD DDD  DD      DDDDDDDDDDDDDDD DD DD D   
    87   83 L A    <   +     0   0   12  232   78  FFF EEAE  E           E  AEDEE FEE  EE      AEEEAEEEEEEEEEE EE FF A   
    88   84 L A  E    S- X   0 108H   8  232   20  AAA AAGA  A           A  GAAAA AAA  AA      AAAAGAAVAAVAAAA AA AA G   
    89   85 L T  E     -UX  42 107H  35  233   69  DDD DDHD  D           E  DGDDV DDD  DD      VVDDDDDDGIDDDVD DD DD H   
    90   86 L Y  E     -UX  41 106H   0  233    4  YYY YYYY  Y           Y  YCYYY YYY  YY      YYYYYYYYCYYYYYY YY YY Y   
    91   87 L Y  E     -U   40   0H   9  233    6  YYY YYYF  F           Y  YYYYY SYY  YY      YYYYYYYYYFYYHFY YY YY Y   
    92   88 L a  E     -U   39   0H   0  233    4  CCC CCCC  C           C  CCCCC CCC  CC      CCCCCCCCCCCCCCC CC CC C   
    93   89 L Q  E     -UY  38 102H   1  233   79  MMM AQQV  A           L  QSSQG MSQ  MQ      QGLQLQQSSAAQCGT LQ MM M   
    94   90 L Q  E     +UY  37 101H   0  233   84  GGG EVSA  s           L  sSSSN GAs  lV      SsLVSVMSSlISSsr Ea GG s   
    95   91 L N        +     0   0    0  206   57  YYY WWYY  e           Y  yYYWA YW.  yW      Y.YWY.YYYyYWY.. W. YY w   
    96   92 L N  S    S+     0   0    1  213   78  qQq ddhd  d           h  pkkdd qd.  Gd      h.rdhdtaksHDa.. d. qq i   
    97   93 L E  S    S-     0   0   48  212   78  sS. nant  a           h  lgttg ssg  Ga      nsgalgqta.EScga hc gn n   
    98   94 L D  S    S+     0   0   42  216   73  ss. VVVV  V           L  WlFlI sll  VY      VsVIWMWVF.fiFIV tV VT W   
    99   95 L P  S    S-     0   0   26  119   74  pns ....  .           .  .vVc. sgc  ..      .a.......hcc... v. .. V   
   100   96 L P        -     0   0    4  155   90  YPN W.F.  .           .  YVVF. TIY  R.      WA..YVY..WWF... YY .. F   
   101   97 L T  E     -Y   94   0H  26  200   64  TGT VYT.  .           V  TFFV. TVV  VI      TRV.TYIV.VVVV.. VV A. T   
   102   98 L F  E     -Y   93   0H  26  231   16  FFF FFFF  F           F  FWWFF FFF  FF      FFFFFFFFHFFFFFF FF FF F   
   103   99 L G        -     0   0    3  233   17  GGG GGGG  G           G  GGGGG GGG  GG      GGGGGGGGSGGGGGG GG GG G   
   104  100 L A        -     0   0   81  233   63  KKK KGGS  S           G  GIIGS KGG  TG      GAGGGGGTVGGGGSS KG KK S   
   105  101 L G        -     0   0   12  233   14  GGG GGGG  G           G  GEEGG GGG  GG      GGGGGGGESGGGGGG GG GG G   
   106  102 L T  E     - X   0  90H   0  233   14  TTT TTTT  T           T  TTTTT TTT  TT      TTTTTTTTKTTTTTT TT TT T   
   107  103 L K  E     -tX  10  89H  74  233   53  EEE KQKT  T           K  KKNQT EQQ  QQ      KTKQKQQKEKQQQTR KS EE K   
   108  104 L L  E     +tX  11  88H   2  232   22  LLL LLLL  L           L  LLLLL LVL  VL      VLLLLLLTLLLLLLL LL LL L   
   109  105 L E  E     -t   12   0H  14  233   69  VVV YTDT  T           T  LAPTT VTT  TT      VTTTLTTASTTTTTT NL VV D   
   110  106 L M  E     -t   13   0H   0  233   29  LLL VVVV  V           V  ILLVV LVV  VV      VVVVIVVLLVVVVVV VV LL V   
   111  107 L R  E     +t   14   0H 126  233   86  NNN QLGL  L           L  SGALL NLL  LL      DLLLSLLGPLLLLLL QL NN G   
   112  108 L R        -     0   0   64  233   79  RRR KTTG  G           S  tQQGG RGG  Gt      LGSttttSGGGGGGG KG RR T   
   113  109 L A        -     0   0   71  221   67  DDD SG.Q  Q           Q  s..QQ DQQ  Qd      GQQdsdd.QQQQQQQ EQ DD .   
   114  110 L D        -     0   0   58  226   72  VVV SdVp  p           p  Ppppp Vpp  pV      VppVPVV.ppppppp sp VV V   
   115  111 L A  B     -A  144   0J  19  225   58  AAA SkSs  s           a  Vaasv Ass  aK      VvaKVKKRassssva sv AA S   
   116  112 L A        -     0   0   40  229   62  KKK VSPP  P           A  KAAAA KAA  NA      RAASKSSATSAAAAT VH KK P   
   117  113 L P        -     0   0    9  229    4  PPP PPPP  P           P  PPPPP PPP  PP      PPPPPPPPPPPPPPP PP PP P   
   118  114 L T  E     -B  141   0K  85  232   60  VVV LSQS  S           S  SSSST VTS  TS      TTSSSSSASSSSSTT LS VV Q   
   119  115 L V  E     -B  140   0K   8  233   26  LLL VVVV  V           V  VVVVI LVV  VV      LIVVVVVMVVVVVIV VV LL V   
   120  116 L S  E     -B  139   0K  17  233   67  TTT SSST  T           T  STTST TTT  TS      STTSSSSKTTTSSTG SS TT S   
   121  117 L I  E     -B  138   0K  22  233   31  LLL LIVL  L           L  LLLLL LLL  LI      VLLILIIMVLLLLLL LV LL V   
   122  118 L F  E     -B  137   0K   4  233    7  LLL LFLF  F           F  LFFFF LFF  FF      LFFFLFFFFFFFFFF LF LL L   
   123  119 L P        -     0   0    5  233   25  PPP PPTP  P           P  GPPPP PPP  PP      PPPPGPPPPPPPPPA PP PP P   
   124  120 L P        -     0   0    1  233    9  PPP PPPP  P           P  SPPPP PPP  PP      PPPPSPPPPPPPPPP PP PP P   
   125  121 L S    >>  -     0   0    8  233   10  SSS SSSS  S           S  SSSSS SSS  SS      SSSSSSSSSSSSSSS SS SS S   
   126  122 L S  H 3> S+     0   0   78  233   64  TTT LEST  T           S  SSSAK TTS  SV      RKSESEESSSSAAKP LQ TT S   
   127  123 L E  H 3> S+     0   0   76  233   30  EEE AEAE  E           E  LEEEE EEE  EE      EEEELEEEEEEEEED AE EE A   
   128  124 L Q  H <4>S+     0   0    8  233   30  EEE EEEE  E           E  QEEEE EEE  EE      EEEEQEEEEEEEEEQ EE EE E   
   129  125 L L  H ><5S+     0   0   29  233   22  III LIIL  L           L  SLLLL ILL  LI      LLLISIILLLLLLLL LI II I   
   130  126 L T  H 3<5S+     0   0  111  233   69  SSS TASN  N           Q  SQQND SSA  QA      QNQASAAQQEGNNDK TK SS S   
   131  127 L S  T 3<5S-     0   0   83  233   68  KKK DTSG  G           A  GAANQ KNT  AT      QEATGTTASTANNQD DS KK S   
   132  128 L G  T < 5S+     0   0   34  233   54  GGG kKkN  N           N  DNNNN GNN  NK      DaNKDKKNNNNNNNN kk GG k   
   133  129 L G  E   < - C   0 186K  21  216   60  TTT rKaK  K           K  SKKKK TKK  KK      SkKKSKKKKKKKKKK rk TT a   
   134  130 L A  E     - C   0 185K   0  225   19  AAA AAAA  A           A  AAAAA AAA  AA      AAAAAAAAAAAAAAV AA AA A   
   135  131 L S  E     - C   0 184K   2  226   39  TTT TTTT  T           T  ATTTT TTT  TT      TTTTATTTTTTTTTT TT TT T   
   136  132 L V  E     - C   0 183K   0  226   35  LLL LLLL  L           L  LLLLL LLL  LV      LLLLLLLLLLLLLLL LL LL L   
   137  133 L V  E     -BC 122 182K   0  226   15  LLL VVLV  V           V  LVVVV LVV  VV      VVVVLVVVVVVVVVV VV LL L   
   138  134 L b  E     -BC 121 181K   0  227    9  CCC CCCC  C           C  CCCCC CCC  CC      CCCCCCCCCCCCCCC CC CC C   
   139  135 L F  E     -BC 120 180K   0  228   40  LLL LSVL  L           L  LLLLL LLL  LS      VLLSLSSLLTLLLLL LL LL V   
   140  136 L L  E     -BC 119 179K   0  228   49  AAA VLAI  I           I  LIIMI AMI  IL      AIILLLLIIIVMMII VM AA A   
   141  137 L N  E     -B  118   0K   2  221   47  NNN NSNS  S           S  SSSSS NSS  SS      SNSSSSSSSTSSSSN ND NN N   
   142  138 L N  E    S+     0   0K  49  225   49  HHH NDKD  D           D  SDDDD HDD  DD      GDDDSDDDDDDDDDG NG HH K   
   143  139 L F  E     - C   0 177K   0  226   41  FFF FFGF  F           F  YFFFF FFF  FF      GFFFYFFFFFFFFFF FF FF G   
   144  140 L Y  B    S+A  115   0J   9  226   46  SFF STFY  Y           Y  SYYYY FYY  YT      FYYTSTTYYYYYYYY SY FF F   
   145  141 L P  S    S-     0   0   18  226   16  PPP PPPP  P           P  PPPPP PPP  PP      PPPPPPPPPPPPPPL PP PP P   
   146  142 L K  S    S+     0   0   83  227   74  NNN GRSG  G           G  PGGGS NGS  GR      SSGRPRRGGGGGGSP GR NN S   
   147  143 L D        +     0   0  116  228   78  TTT SGDS  S           A  GAASP TAG  AG      APAGGGGAAVASSPT SA TT D   
   148  144 L I        -     0   0   19  228   60  LLL VAWV  V           V  AVVVV LVV  VA      WVVAAAAVVVVVVVV VI LL W   
   149  145 L N  E     -E  201   0L  82  228   67  QQQ ETRT  T           T  KTTTT QTT  TT      RTTTKTTTTTTTTTS EQ QQ R   
   150  146 L V  E     -E  200   0L  27  228   12  LLL VVLV  V           V  VVVVV LVV  VV      LVVVVVVVVVVVVVM VV LL L   
   151  147 L K  E     -E  199   0L  53  228   76  VVV TKVV  V           A  SAAAE VAA  AK      GDAKSKKAEDAAAEA TE VV V   
   152  148 L W  E     +E  198   0L   3  228    3  WWW WWWW  W           W  WWWWW WWW  WW      WWWWWWWWWWWWWWW WW WW W   
   153  149 L K  E     +EF 197 158L  76  229   45  QQQ TQKK  K           K  TKKKL QKR  KL      KVKQTQQKKKKKKLK TK QQ K   
   154  150 L I  E    S-E  196   0L   0  229   68  KKK VVVA  A           A  RAAAV KED  AV      VIAVRVVAAVAAAVA VA KK V   
   155  151 L D  S    S-     0   0   71  229   24  DDD DDSD  D           D  DDDND DNG  DD      GDDDDDDDDDDNNDD DN DD L   
   156  152 L G  S    S+     0   0   63  230   38  MMM GGGG  G           S  GGGGG MGS  GG      GGSGGGGGGGGGGGG GD MM K   
   157  153 L S  S    S-     0   0   33  229   65  VVV VKSS  S           S  SNNTS VSP  SK      SSSKSKKNNTSTTSS VG VV P   
   158  154 L E  B     -F  153   0L  85  229   76  TTT AEST  T           P  ESSPT TPV  PD      STPEEEESSPTPPTP AT TT D   
   159  155 L R        -     0   0   69  231   75  VVV QKGI  I           V  LVVVR VVT  VQ      SRVKLKKVVVIVVRA QI VV G   
   160  156 L Q        +     0   0  133  232   75  TTT RTGT  T           K  SRRTK TSQ  KT      SSKTSTTRRTTTTKT RS TT S   
   161  157 L N  S    S+     0   0  117  233   70  DDD SDQR  R           A  EDDQG DQG  AD      SGADEDDDDQQQQGQ SA DD S   
   162  158 L G  S    S+     0   0   29  233   33  GGG GGEN  N           G  GGGGE GGV  GS      GEGGGGGGGGGGGEG GG GG s   
   163  159 L V  E     -D  183   0K  46   68   75  ... ..S.  .           .  F.... ...  ..      ....F.......... .. .. g   
   164  160 L L  E     -D  182   0K  16  212   47  VVV IV.V  V           V  .VVV. VV.  VV      V.VV.VVVVMVVV.V IV VV q   
   165  161 L N  E     +D  181   0K  52  216   55  KKK QV.E  E           E  .EEE. KEE  EQ      S.EV.VVEEEEEE.G QE KK E   
   166  162 L S  E     -D  180   0K  12  224   49  TTT TSST  T           T  LTTTT TTT  TS      HTTSLSSTTTTTTTT TT TT S   
   167  163 L W  E     -D  179   0K  99  224   71  SSS SSST  T           T  TTTTT STT  TS      STTSTSSTTTTTTTT SS SS S   
   168  164 L T        -     0   0   24  225   66  GGG LGAR  R           T  SKKKP GKK  KG      LATGSGGKKQKKKPQ LT GG S   
   169  165 L D        -     0   0   99  226   74  SSS ALGA  A           P  APPPA SPP  PL      EPPLALLPPPPPPAP AP SS A   
   170  166 L Q        -     0   0   18  229   76  VVV QSLS  S           S  ESSSQ VSS  SS      VQSSESSSSSSSSQS QV VV G   
   171  167 L D     >  -     0   0   48  229   61  TTT KKLK  K           K  SKKKR TKK  KK      LRKKSKKKKKKKKRK KK TT L   
   172  168 L S  T  4 S+     0   0   54  232   60  GGG QQEQ  Q           Q  QQQQQ GQQ  QQ      GQQQQQQQQQQQQQQ QQ GG L   
   173  169 L K  T  4 S+     0   0  180  232   58  SSS NSKS  S           S  QSSSS SSS  SS      RSSSQSSSSSSSSSS NG SS E   
   174  170 L D  T  4 S-     0   0   57  232   39  DDD EDDN  N           N  DNNNN DNN  ND      DNNDDDDNNNNNNNK ED DD K   
   175  171 L S     <  +     0   0    4  232   57  HHH NSGS  S           N  GNNNS HNN  NN      GSNSGSSNNNNNNSG NK HH D   
   176  172 L T        -     0   0    5  232   72  SSS TLLK  K           K  RKKKQ SKK  KL      HQKLRLLKKKKKKQK TY SS g   
   177  173 L Y  E     -C  143   0K   7  226    4  YYY YYYY  Y           Y  YYYYY YYY  YY      YYYYYYYYYYYYYYY Y. YY y   
   178  174 L S  E     -     0   0K   1  226   72  SSS SMSA  A           A  SAAAM SVA  AM      SMAMSMMAAMAAAMT SV SS S   
   179  175 L M  E     -CD 140 167K   0  227   79  VVV VEWA  A           A  CAAAA VAA  AE      WAAECEEAAAAAAAA VA VV W   
   180  176 L S  E     -CD 139 166K   3  229    6  SSS SSSS  S           S  TSSSS SSS  SS      SSSSTSSSSSSSSSS SS SS S   
   181  177 L S  E     -CD 138 165K   0  229    4  SSS SSSS  S           S  SSSSS SSS  SS      SSSSSSSSSSSSSSS SS SS S   
   182  178 L T  E     -CD 137 164K   2  230   72  TTT FYSY  Y           Y  VYYYY TYY  YY      TYYYVYYYYYYYYYY FY TT S   
   183  179 L L  E     -CD 136 163K   0  231    1  LLL LLLL  L           L  LLLLL LLL  LL      LLLLLLLLLLLLLLM LL LL L   
   184  180 L T  E     +C  135   0K  36  231   54  TTT TSTS  S           S  KSSSS TSS  SS      SSSSKSSSSTSSSSS TA TT T   
   185  181 L L  E     -C  134   0K  16  231   14  LLL LLLL  L           L  LLLVL LML  LL      LLLLLLLLLLLVVLL LL LL L   
   186  182 L T  E  >  -C  133   0K  81  230   58  PPP PTST  T           T  KTTST PSS  TT      PSTTKTTTTTSSSTT PT PP T   
   187  183 L K  H >> S+     0   0   66  227   67  AAA VSES  S           P  RPPSA AAL  PA      AAPSRSSPPAPSSA. VR AA E   
   188  184 L D  H 3> S+     0   0  109  228   63  QQQ LDQS  S           E  EQQQS QSD  ED      DSEDEDDQQRDQQSD LS QQ Q   
   189  185 L E  H >4 S+     0   0   53  228   49  VVV EEQD  D           Q  EQQDD VKK  QQ      QDQEEEEQQAKDDDE EE VV Q   
   190  186 L Y  H X< S+     0   0    6  226   12  WWW WWWW  W           W  WWWWW WWW  WW      WWWWWWWWWWWWWWW WW WW W   
   191  187 L E  H 3< S+     0   0   90  226   71  AAA NLMK  K           K  EKKKS AKQ  KL      RSKLELLKKEKKKSR NE AA M   
   192  188 L R  T << S+     0   0  160  226   61  SSS SKES  S           S  KSSSS SSS  SR      KSSKKKKSSRSSSSS SA SS E   
   193  189 L H    <   -     0   0   24  224   55  DDD KHSK  K           H  RRRAH DAH  HH      AHHHRHHRRHHAAHG KN DD S   
   194  190 L N  S    S+     0   0   97  224   71  AAA NDVG  G           R  ESSSE ASS  RE      GERDEDDSSSSSSEN NK AA A   
   195  191 L S  E     + G   0 214L  37  224   71  RRR ILSS  S           S  RSSAT RQS  ST      STSLRLLSSSSAATT ID RR S   
   196  192 L Y  E     +EG 154 213L   0  224   14  FFF YYVY  Y           Y  YYYYY FYF  YY      VYYYYYYYYYFYYYF YY FF V   
   197  193 L T  E     -EG 153 212L   3  223   48  SSS TSSS  S           S  ASSST SSS  SS      STSSASSSSSSSSTS TT SS S   
   198  194 L b  E     -EG 152 211L   1  223    0  CCC CCCC  C           C  CCCCC CCC  CC      CCCCCCCCCCCCCCC CC CC C   
   199  195 L E  E     -EG 151 210L  34  212   62  VVV EKEE  E              RHHQR VHL  QK      ER KRKKHHQLQQRQ EK VV E   
   200  196 L A  E     -EG 150 209L   1  212   22  VVV VVAV  V              VVVVV VVV  VV      AV VVVVVVVVVVVV VV VV A   
   201  197 L T  E     +E  149   0L  36  212   35  TTT KTTT  T              TTTTT TTT  TS      ST TTTTTTTTTTTT KT TT T   
   202  198 L H  E >   - G   0 205L  18  212   27  HHH HHRH  H              HHHHH HHH  HH      LH HHHHHHHHHHHH HH HH R   
   203  199 L K  T 3  S+     0   0  145  211   56  EEE QQSE  E              AEEDD EDE  EQ      NN QAQQEEEEDDDK QE EE S   
   204  200 L T  T 3  S+     0   0   55  211   41  SSS NGGG  G              GGGGG SVG  GG      GG GGGGGGGGGGGG NS SS G   
   205  201 L S  E <   -G  202   0L  45  187   83  LLL   QS  S              GKKKT LSN  S       QT  G  KKHSKKT   K LL Q   
   206  202 L T  E    S+     0   0L 140  187   30  MTT   PT  T              DTTTA TTT  T       SS  D  TTTTTTA   T TT P   
   207  203 L S  E    S-     0   0L  82   90   51  GGG   A                  Q     G            P   Q              GG A   
   208  204 L P  E     -     0   0L  43   67   33  PPP                      E     P                E              PP     
   209  205 L I  E     -G  200   0L  46   67   29  LLL                      I     L                I              LL     
   210  206 L V  E     +G  199   0L  70   63   53  TTT                            T                               TT     
   211  207 L K  E     +G  198   0L  85   63   26  QQQ                            Q                               QQ     
   212  208 L S  E     -G  197   0L  67   63   28  TTT                            T                               TT     
   213  209 L F  E     -G  196   0L  30   63   18  III                            I                               II     
   214  210 L N  E      G  195   0L  99   63   62  RRR                            R                               RR     
   215  211 L R              0   0   82   54   19                                                                        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  213   30     E    QQ QDQDDQQQQQE EQ     E   QE  QE EEQ                     E EQQ
   218    2 H V        +     0   0   30  215   38     V    VV DVVVVVVVEVV VV     V   VV  AQ VVI                     V VVV
   219    3 H K  E     -A  241   0A 143  215   52     Q    QQ QKTQQQQQQHQ TT     Q   TK  QQ KQQ                     Q QQH
   220    4 H L  E     -A  240   0A  11  231    3     L    LL LLLLLLLLLLL VV     L   LL  LL LLL               L  L  L LLL
   221    5 H Q  E     -A  239   0A 120  231   74     V    QQ QVKDALVQEVV SS     V   KL  LV EVV               T  T  L QQQ
   222    6 H E  E     -A  238   0A   2  232   34     E    QQ QEEQQQQQQQE LL     E   EE  QQ EEQ               Q  S  Q QQQ
   223    7 H S  E     +A  237   0A  48  232   22     S    PP SSSSSSSPSSS SS     S   SS  SS ASS               S  S  S SPS
   224    8 H G        -     0   0   35  232   24     G    GG GGGEEGGGGGG VV     G   GG  GA GGG               E  G  G GGG
   225    9 H P        -     0   0   50  232   51     G    AA AGPSSAAAAAG PP     G   PG  PG GGP               P  S  A PSA
   226   10 H A  S    S+     0   0   30  232   54     G    EE EGGVVEEEEEG EE     D   GG  EG GGE               V  E  E EVE
   227   11 H V  E     -d  334   0B  33  233   26     L    LL RLIVVVVLVLL LL     L   ML  VLVLLL               V  V  V LLL
   228   12 H I  E     -d  335   0B   9  233   54     V    VV VVLIIKKVTKV VV     V   LV  KVLVVK               K  K  K VVV
   229   13 H K        -     0   0  104  233   49     Q    RK KQQKKTKKKMK KK     K   QQ  LQKQKK               R  K  K KRR
   230   14 H P  S    S+     0   0   56  233   12     P    PP PPPPPPPPPPP PP     P   PP  PPPPPP               P  P  P PPP
   231   15 H S  S    S+     0   0   90  233   20     G    GG GGSGGGGGGGG SS     G   SG  GGGGGG               G  R  G GGG
   232   16 H Q  S    S-     0   0   76  233   60     N    TV ARQGGAAAASG EE     G   KG  AGEGGE               E  E  A AAT
   233   17 H S        -     0   0   51  232   21     S    SS SSTSSSSSSSS KT     S   TS  SSTSST               S  S  S SSS
   234   18 H L  E     - B   0 300A   1  232   46     L    VV VLLHHVVVVVL LL     L   LL  VLLMLV               H  V  V VVV
   235   19 H S  E     - B   0 299A  64  233   50     R    KK KKSKKKKKKKK KR     R   SK  KRSKKK               T  T  K KKK
   236   20 H L  E     - B   0 298A   1  233   15     L    LM ILLLLLVLVVL LL     L   LL  VLLLVI               L  L  V VLM
   237   21 H T  E     -AB 223 297A  29  233   34     S    SS SSTSSSSSSSS VA     S   TS  SSSSSS               T  S  S SSS
   238   22 H c  E     -AB 222 296A   0  234    0     C    CC CCCCCCCCCCC CC     C   CC  CCCCCC               C  C  C CCC
   239   23 H I  E     -AB 221 295A  54  233   74     V    KK KATTTKKKKKA KK     V   SA  NSRAAK               S  V  K KKK
   240   24 H V  E     -A  220   0A   4  233   54     A    AA AAFAAPAAAAA VV     A   FA  PAGAAA               A  V  A AAA
   241   25 H S  E     +A  219   0A  60  234    9     S    SS SSSSSSSSSSS SS     S   SS  TSSSSS               S  S  S SSV
   242   26 H G  S    S+     0   0   54  228    4     G    GG GGGGGGGGGAG gg     G   GG  DGGGGG               G  G  G GGG
   243   27 H F  S    S-     0   0   37  199   30     F    FY YFF..NYYYNF ii     .   FF  YFFFLY               F  .  Y YYY
   244   28 H S    >   -     0   0   44  201   49     T    ST ATS..TTTTMT TT     .   SD  KTTTTT               T  .  T PTT
   245   29 H I  T 3  S+     0   0    2  232   27     F    FF FFLFFVFFFFF DD     F   LF  FFFFFF               F  .  F FFF
   246   30 H T  T 3   +     0   0   59  232   53     D    TT SSSTTNSTIRS GG     T   SS  GEGSST               S  .  T TTT
   247   31 H R  S X  S-     0   0  145  234   77     D    SS GDTFFIDSASS SS     F   TK  SNSNND               D  L  S DSN
   248   32 H T  T 3  S+     0   0   72   68   71     .    .. ..YSS...... KK     S   S.  ......               .  S  . ...
   249   33 H N  T 3  S+     0   0   16   73   70     .    .. ..GSS...... II     S   G.  ......               .  L  . ...
   250   34 H Y  E <   -E  317   0C  23  234   47     Y    YY PYMTYYHYYYY HH     N   MD  YHYYYY               Y  A  Y YYY
   251   35 H d  E     -EF 316 270C   0  224   90     A    WW WGGWYASWDAA AA     Y   VW  DANWAS               G  W  Y FWW
   252   35AH W  E     -EF 315 269C   1  222   46     M    MI MMVMMLIMIFM VV     M   VM  IMMMMM               M  L  I MMI
   253   35BH H  E     -EF 314 268C   0  231   72     S    NN NAGSNHTHNTS ND     S   SS  SHHNSH               H  H  H NHG
   254   36 H W  E     +EF 313 267C   1  233    1     W    WW WWWWWWWWWWW YF     W   WW  WWWWWW               W  W  W WWW
   255   37 H I  E     -EF 312 265C   0  233   13     V    VV VVIVVLLVVVV II     I   IV  VVIVVV               V  I  V VVV
   256   38 H R  E     -EF 311 264C  10  234   15     R    KR KRRRRRRKRRR RR     R   RR  RRRRRK               R  R  R KKK
   257   39 H Q  E     -EF 310 263C  22  233    3     Q    QQ QQQQQQQQQQQ QQ     Q   QQ  QQQQQQ               Q  Q  Q QQQ
   258   40 H A    >   -     0   0   14  233   59     A    RR RAPAAAARAAT FF     A   PA  AVQSSA               V  K  A SRR
   259   41 H P  T 3  S+     0   0   99  234   20     P    PP PPSPPPPPPPP SS     P   SP  PPPPPP               P  P  P HPP
   260   42 H G  T 3  S+     0   0   94  234   11     G    GG GGGGGGGGGGE GG     G   GG  GGGEEG               G  G  E GGG
   261   43 H K  S <  S-     0   0  140  234   34     K    QQ KKKKKHQRQQK SS     K   KK  QKKKKK               K  K  Q KQH
   262   44 H G        -     0   0   20  234   23     G    GG GGGGGGGGGGR TR     G   SG  GRAGRG               G  G  G SGG
   263   45 H L  E     -F  257   0C  10  234    6     L    LL LPLLLPLLLLL FF     L   LL  LLLLLL               L  L  L LLL
   264   46 H E  E     -F  256   0C  79  234   10     E    EE EEEQQEEEEQE EE     Q   EE  EEMEEK               E  E  E EEE
   265   47 H W  E     +F  255   0C  13  234    9     W    WW WCWWWWWWWWW FF     W   WW  WWWWWW               W  W  W WWW
   266   48 H M  E     -     0   0C   3  234   31     V    II IVLVLMIIMMV LL     V   LI  MVMVVM               I  I  M III
   267   49 H G  E     -FG 254 277C   0  234   42     S    GG GAASCTGGGGA AA     S   AG  GSGAAG               A  G  G GGG
   268   50 H R  E     -FG 253 276C  10  234   92     Y    MD RFNVQWWRWGT HH     Q   AE  WGREAW               Y  R  K NED
   269   51 H I  E     -FG 252 275C   3  234   20     I    II IIIIILIIMII II     I   II  IIVIIV               I  I  I III
   270   52 H d  E >   -F  251   0C   0  234   84     N    HY YSWSNNSDNIS NN     S   DN  GDWRNN               Y  D  F NYY
   271   53 H Y  T 3  S+     0   0   47  234   85     K    pP PnWSPvaPPpD yy     S   Wp  lWylSI               S  S  P pPP
   272   54 H E  T 3  S-     0   0   63  232   61     n    dg gnDddssnqgg nn     d   Dn  dnqane               s  G  g nsg
   273   55 H G  S <  S+     0   0   25  185   36     d    Sg g.Dgg.Ggg.s ..     s   G.  Gg..gg               s  T  s Sgg
   274   56 H S        -     0   0   42  200   70     T    EM E.DSS.QGNAY ..     S   D.  NDG.NE               S  G  D DRF
   275   57 H I  E     -G  269   0C  71  215   54     T    TT TIKTT.TTTPT ..     T   K.  AAHTTS               Q  T  T VTT
   276   58 H Y  E     -G  268   0C  70  222   77     Y    RN HYYYY.YKENY ..     S   Y.  RGDHYV               Y  I  K INT
   277   59 H Y  E     -G  267   0C  41  227   14     N    LY YYYYY.YYFYY ..     Y   YY  PYYYYY               Y  F  Y YYY
   278   60 H S    >>  -     0   0   11  231   57     A    NN SANAASANAAP ..     A   NA  TAAASA               S  A  A NDN
   279   61 H P  T 34 S+     0   0   76  234   56     N    QD GDPDDHQEQQD PS     D   PP  QDNEDD               E  Q  Q QEE
   280   62 H S  T 34 S+     0   0   79  234   55     S    RK QTSSSYNKKNN DA     A   SS  NSSSTD               S  S  K KKK
   281   63 H I  T X4 S+     0   0    4  234   43     V    FF FVLVVFLFFFV LL     V   LL  FVFVMF               V  L  F FFF
   282   64 H K  G >< S+     0   0  133  234   33     K    KK KTKKKRQKQQK KK     K   KK  KKKKKK               K  Q  Q KKK
   283   65 H S  G 3  S+     0   0  116  234   31     G    DT GGNGGPGSGDG SS     G   SD  DGGGGG               G  G  G DGG
   284   66 H R  G <  S+     0   0   51  234   16     R    KK KRRRRRRKRRR RR     R   RK  RRRRRR               R  Q  R KKK
   285   67 H S  E <   -C  300   0A  11  234   54     F    AA AFLFFLVALVF LL     F   LF  IFIFFF               F  F  V AAA
   286   68 H T  E     -C  299   0A  67  220   24     T    ST TTTITTTTTTT TT     T   TI  NTETTA               I  T  A TTT
   287   69 H I  E     +C  298   0A   3  220   25     I    LL LIIIIVMLFII WL     I   VI  IIIIIF               I  I  M LLL
   288   70 H S  E     -C  297   0A  56  234   45     S    TT TSSSSTTTSSS SS     S   SS  ISTSSS               S  T  I TTT
   289   71 H R  E     -C  296   0A  71  234   70     R    VL ARKRRRTVRAR RR     R   KR  KRRRRL               R  K  V VVA
   290   72 H D  E >>> -C  295   0A  55  234   18     D    DD DDDDDDDDDDD DD     D   NE  DDDDDE               D  D  D DDD
   291   73 H T  T 345S+     0   0   78  233   60     N    TT KNTNNATKTDN TT     N   TN  TNNDNT               N  T  K KTA
   292   74 H S  T 345S+     0   0  105  233   44     A    ST SASNNSSPSSA AA     A   SA  SSSSAS               N  S  S SSS
   293   75 H L  T <45S-     0   0  103  234   70     K    SS SKNNNATSITK KR     K   NK  TKKKKA               R  K  T SSS
   294   76 H N  T  <5 +     0   0   29  234   47     N    NS SNNNNNSSNTN NN     N   TN  NKSSSS               A  N  N SSS
   295   77 H K  E   < -BC 239 290A  51  234   64     T    VT TTQKKTTTTTN EE     T   QT  ISMSTT               Q  M  T TTT
   296   78 H F  E     -BC 238 289A   1  234   61     L    VA ALALLVAAAVL AA     L   VL  VLVVLI               L  V  A AAA
   297   79 H F  E     -BC 237 288A  50  234   27     Y    YY YYFYYYYYYYY YY     Y   FY  YYYYYH               N  Y  Y YYY
   298   80 H I  E     -BC 236 287A   4  234    5     L    MM MLLLLMMMMML LL     L   LL  MLLLLL               L  L  M MVM
   299   81 H Q  E     -BC 235 286A  73  234   36     Q    QQ QQKQQEEQVEQ EE     Q   KQ  EQKQQQ               Q  E  E QDQ
   300   82 H L  E     -BC 234 285A   3  234   23     M    LL LMIMMLLLLLM IF     M   IM  MMLMMI               M  I  L LFL
   301   82AH I        +     0   0   70  234   62     N    SS NSTNNTRSSTS SR     N   TS  RSSNSN               N  K  S NSS
   302   82BH S  S    S-     0   0   59  234   35     N    SS GSNNNSSSSSH GG     S   SK  GSANSN               S  S  S SSS
   303   82CH V        -     0   0    0  234   13     L    PL LLVLLLLLLLL MM     L   VV  LLLLLL               L  L  L LLL
   304   83 H T    >   -     0   0   65  234   62     R    TT TRDQQTRTSTK TT     R   DR  TRTRRK               K  K  R TTT
   305   84 H N  G >  S+     0   0  120  234   65     V    SS SSTTTSSSTFS AA     D   IS  PPEASN               T  A  A SSS
   306   85 H E  G 3  S+     0   0  160  234   25     E    EE EEAEEEDEEEE GE     E   AE  DDEEEE               E  E  E EEE
   307   86 H D  G <  S+     0   0    0  234    1     D    DD DDDDDDDDDDD DD     D   DD  DDDDDD               D  D  D DDD
   308   87 H T    <   +     0   0   30  234   32     T    SS STTTTTTSSTT TT     T   TT  TSSTTT               S  T  T SSS
   309   88 H A  E    S- H   0 333C   3  234    4     A    AA AAAAAAAAAAA AA     A   AA  AAAGAA               A  A  A AAA
   310   89 H M  E     -EH 257 332C  43  234   58     M    VV VLTVVVVVIFM MM     V   TL  TFVIFT               V  V  V VVI
   311   90 H Y  E     -EH 256 331C   2  234    0     Y    YY YYYYYYYYYYY YY     Y   YY  YYYYYY               Y  Y  Y YYY
   312   91 H Y  E     -E  255   0C   1  234    3     Y    YY FYYYYFYYFYY YY     Y   YY  FFYYYF               Y  Y  Y YYY
   313   92 H c  E     +E  254   0C   0  234    1     C    CC CCCCCCCCCCC CC     C   CC  CCCCCC               C  C  C CCC
   314   93 H S  E     -EI 253 327C   0  234   30     A    AS AAATAAATAGA AA     A   AA  VAATVA               A  A  G ATA
   315   94 H R  E     -EI 252 326C  20  233   44     K    RR RRRRSSKRRRR SK     R   RR  RRRRRR               R  K  S RRR
   316   95 H E  E     -EI 251 324C   0  233   77     V    RA GHIDQEDEGGD GD     D   YF  GDARGS               W  E  D WES
   317   96 H N  E  >> -E  250   0C   6  233   90     A    NG NKAGQRQGNLM YY     T   RL  TTNGGD               I  Y  S DGG
   318   97 H H  T  45S+     0   0    0  233   93     G    NS WLTTYGSDLTG FS     N   DA  AVYYYY               R  N  G YKG
   319   98 H M  T  45S+     0   0   73  234   93     S    PN PRTYAGYYRYG AG     H   SY  VSYGFD               L  Y  L TEW
   320   99 H Y  T  45S+     0   0  159  234   92     N    YY YLGNSLTDGYS YG     N   YW  LGYDDY               N  Y  P YFL
   321  100 H E  T  <5 -     0   0   54  234   90     n    YA WYyAgFtAggp WN     C   AG  DwFpVd               G  F  G yDL
   322  100AH T      < +     0   0    0  139   91     q    YF ..w.n.d.nys .Y     .   P.  .w.w.y               T  .  F a..
   323  100BH Y  S    S-     0   0   10  161   90     S    AA YVY.A.A.WYR .A     .   F.  .S.Y.A               T  .  G E..
   324  100CH F  E     +I  316   0C   0  185   48     F    LM LMFFF.FMFLF .F     F   F.  .F.F.M               F  .  F K.R
   325  101 H D  E     +     0   0C  42  205   40     E    DD DDDDDDHDDQD .D     D   D.  .DDD.D               D  D  N D.D
   326  102 H V  E     -I  315   0C  35  212   66     Y    YY VYFYYVIYPHY .Y     Y   Y.  PLYV.Y               V  Y  Y YYY
   327  103 H W  E     -I  314   0C  28  221    8     W    WW WWWWWWWWWWW .W     W   W.  WWWWWW               W  W  W WWW
   328  104 H G        -     0   0    3  229    7     G    GG GGGGGGGGGGG GG     G   G.  GGGGGG               G  G  G GGG
   329  105 H Q        -     0   0  100  223   52     Q    QQ AQPAAPQQHQQ QP     Q   QQ  QRKAAQ               N  K  Q QQQ
   330  106 H G        -     0   0    3  228    7     G    GG GGGGGGGGGGG GG     G   GG  GGGGGG               G  G  G GGG
   331  107 H T  E     -H  311   0C  27  233   39     T    TT TTTTTTTTTTT TT     T   VT  TTTTTT               T  T  T TTT
   332  108 H T  E     -H  310   0C  48  234   79     L    SS TSMMMTMSLLT MM     L   MS  LLKTAS               K  K  L LTT
   333  109 H V  E     -H  309   0C   0  234   19     V    VV VVVVVVVVVVI VV     V   VV  VVVVVV               V  V  V VLL
   334  110 H T  E     -d  227   0B  16  234   41     T    TT TTTTTTTTTTT TT     T   TT  TSTTTT               T  T  T TIT
   335  111 H V  E     +d  228   0B   2  234    9     V    VV VVVVVVVVVVV VV     V   VV  VVVVVV               V  V  V VVV
   336  112 H S        -     0   0   18  234   31     S    SS SSSTTSSSSSS TT     S   SS  SSSSSS               S  S  S SSS
   337  113 H S  S    S+     0   0   99  234   19     S    SS SSSSSSSSSSS SS     S   SS  SSSSSS               S  S  S ASS
   338  114 H A  S    S-     0   0   31  234   51     V    EE EEEAAAAEAAE VV     E   EE  AAaEEE               G  a  I EEE
   339  115 H K        -     0   0  143  234   66     D    PP PPSTTSSPSSS TT     S   SP  SSpPPS               S  p  D PPP
   340  116 H T        -     0   0   44  234   72     P    AA AAQSSPPAPPA AA     P   QA  PPSAAA               T  S  P AAA
   341  117 H T  B     -J  370   0D  35  234   73     N    RR RRSKKTTRTTR SS     S   SR  TTARRR               K  A  N RRR
   342  118 H P        -     0   0   60  234   66     S    EE EESSSSSENSN AA     P   SE  SSPEEN               S  P  S EEE
   343  119 H P        -     0   0   13  234   17     L    PP PPPPPPPPPPP PP     P   PP  PPQPPP               P  Q  L PPP
   344  120 H S  E     -K  367   0E  51  234   57     R    TT TTTSSKKTKKT SS     N   TT  KKSTTT               T  S  R TTT
   345  121 H V  E     -K  366   0E   6  234   25     S    II IIVLLVVIVVI VV     L   VI  VVVIII               L  V  S III
   346  122 H Y  E     -K  365   0E  27  234   14     F    YY YYFFFFFYFFY FF     F   FY  FFFYYY               F  F  F YYY
   347  123 H P  E     -K  364   0E  15  234   27     P    PP PPPPPPPPPPP PP     P   PP  PPGPPP               P  G  P PPP
   348  124 H L  E     +K  363   0E   4  234   22     L    LL LLLLLLLLLLL LL     L   LL  LLLLLL               L  L  L LLL
   349  125 H A        -     0   0   10  234   68     S    TT TTVIISSTSST II     I   VT  SSSTTT               V  S  S TTT
   350  126 H P        -     0   0   24  234   77     L    FF FFSSSLLFLLL PP     T   SF  LLQFFL               Q  Q  L FFF
   351  127 H G  S    S-     0   0   16  234   65     Q    PP PPCCCCDPCCP CC     C   CP  CCCPPP               C  C  Q PPP
   352  128 H S  S    S+     0   0   99  234   67     S    QQ QQEGGSSQSSR CC     E   EQ  SSSQQP               N  S  S QQQ
   353  129 H A        +     0   0   52  234   79     T    AA AAsEETTATTA dg     n   sA  TTSAAA               P  S  T AAA
   354  130 H A        +     0   0   70  145   76     .    .. ..l........ vv     l   l.  ......               D  .  . ...
   355  133 H Q        +     0   0  178  219   82     D    LL LLS..QPLQQL DD     S   SL  QQGLLL               R  G  D LLL
   356  134 H T    >   -     0   0   64  231   47     S    SS SSDSSPQSPPS FF     D   DS  PPSSSS               S  S  S SSS
   357  135 H N  T 3  S-     0   0  146  232   60     D    SS SSEMMDDSDDS NE     E   ES  DDDSSS               A  D  D SSS
   358  136 H S  T 3  S+     0   0   63  232   58     G    DD DDNDDGGDGGD DN     T   ND  GGGDDD               S  G  G DDD
   359  137 H M  E <   - L   0 408E  83  232   79     H    PP PPLPPNNPNNP SS     L   LP  NNSPPP               Q  S  H PPP
   360  138 H V  E     - L   0 407E  15  233   38     V    VV VVVVVVVVVVV VV     V   VV  VVIVVV               I  I  V VVV
   361  139 H T  E     + L   0 406E  15  234   68     V    II IIATTVVIVVI TT     A   AI  VVTIII               A  T  V III
   362  140 H L  E     + L   0 405E   0  234   26     I    II IIMIIIVIIII MM     M   MI  IILIII               V  L  I III
   363  141 H G  E     -KL 348 404E   0  234   28     G    GG GGGGGAAGAAG GG     G   GG  AAGGGG               G  G  G GGG
   364  142 H e  E     -KL 347 403E   1  234    1     C    CC CCCCCCCCCCC CC     C   CC  CCCCCC               C  C  C CCC
   365  143 H L  E     -KL 346 402E   2  234   12     M    LL LLLLLLLLLLL LL     L   LL  LLLLLL               L  L  M LLL
   366  144 H V  E     -KL 345 401E   1  234   46     V    II IIAAAVVIVVI VV     A   AI  VVAIII               A  A  V III
   367  145 H K  E     -KL 344 400E  38  231   68     Q    HH HHRKKQQHQQH TT     R   RH  QQKHHH               L  K  Q HHH
   368  146 H G  E    S+     0   0E  19  234   40     D    DD DDDDDGGDGGD GG     D   DD  GGGDDD               D  G  D DDD
   369  147 H Y  E     - L   0 399E   0  234    5     F    YY YYFFFFFYFFY YY     F   FY  FFFYYY               F  F  F YYY
   370  148 H F  B     +J  341   0D   3  234   40     F    FF FFLLLFFFFFF MM     L   LF  FFSFFF               F  S  F FFF
   371  149 H P  S    S-     0   0    0  234   15     p    pp ppPPPpppppp AA     P   Pp  pppppp               P  p  p ppp
   372  150 H E  S    S+     0   0   53  231   47     e    gg ggSEEeegeeg DD     G   Sg  eedggg               E  d  e ggg
   373  151 H P        +     0   0   59  232   52     S    TT TTSTTPPTPPT PP     S   ST  PPSTTT               S  S  S TTT
   374  152 H V        -     0   0   20  233   39     V    MM MMIIILLMLLM LL     I   IM  LLLMMM               L  L  V MMM
   375  153 H T  E     +N  422   0F  83  234   67     N    NN NNSSSSSNSSN DE     T   SN  SSNNNN               T  N  N NNN
   376  154 H V  E     +N  421   0F  23  234   44     V    VV VVFFFVVVVVV II     F   FV  VVFVVV               Y  F  V VVV
   377  156 H T  E     -N  420   0F  48  234   51     T    TT TTSTTTTTTTT QQ     S   ST  TTKTTT               Q  K  T TTT
   378  157 H W  E > >S-NO 419 383F   2  234    0     W    WW WWWWWWWWWWW WW     W   WW  WWWWWW               W  W  W WWW
   379  162 H N  G > 5S-     0   0   38  234   61     D    GG GGnggSSGSSG NN     k   nG  sskGGG               S  k  D GGG
   380  163 H S  G 3 5S-     0   0   91  234   63     H    KK KKqkkEEKEEK DD     e   qK  sspKKK               N  p  H KKK
   381  164 H G  G < 5S+     0   0   39  234   50     K    SS SSNNNSSSSSS GG     N   NS  GGASSS               Q  A  K SSS
   382  165 H S  T < 5 +     0   0   93  234   53     G    GG GGnnnGGGGGG SS     l   nG  QQgGGG               G  g  G GGG
   383  166 H L  B   < +O  378   0F  43  228   74     K    KK KKvyyQQKQQK II     i   vK  ..dKKK               S  l  K KKK
   384  167 H S        +     0   0   88  231   64     G    DD DDMSSGNDGGD TT     N   MD  GGLDDD               Q  S  G DDD
   385  168 H S  S    S+     0   0  101  231   73     T    II IIQTTVVIVVI TT     n   QI  VVSIII               .  D  T III
   386  169 H G  S    S+     0   0   32  226   40     S    TT TTGGGTTTTTT GG     d   GT  TTDTTT               .  .  S TTT
   387  171 H V        +     0   0   48  232   57     V    TT TTVLLAATAAT II     I   VT  AAFTTT               S  F  V TTT
   388  172 H H  E     -M  404   0E  17  233   79     M    VV VVRKKRRVRRV KK     K   RV  RRVVVV               E  V  M VVV
   389  173 H T  E     -M  403   0E  69  233   67     N    NN NNTSSNNNNNN TT     T   TN  NNQNNN               Q  Q  N NNN
   390  174 H F  E     -M  402   0E   1  233   11     F    FF FFFYYFFFFFF MM     F   FF  FFYFFF               Y  Y  F FFF
   391  175 H P  E     -     0   0E  65  232   17     P    PP PPPKKPPPPPP RG     P   PP  PPPPPP               P  P  P PPP
   392  176 H A  E     -     0   0E  19  233   53     P    PP PPTPPPPPPPP PP     S   TP  PPAPPP               V  A  P PPP
   393  177 H V  E     -M  400   0E  42  233   54     V    AA AALVVSSASSA VV     V   LA  SSFAAA               I  F  V AAA
   394  178 H L  E     -M  399   0E  77  233   51     H    LL LLRMMQQLQQL LL     L   RL  QQGLLL               A  G  H LLL
   395  179 H Q  S    S-     0   0   83  233   65     V    AA AATQQDDADDA SS     R   TA  DDKAAA               K  K  V AAA
   396  180 H S  S    S-     0   0  116  233   55     a    ss ssGssaasaas da     E   Gs  aaEsss               D  E  a sss
   397  183 H D  S    S+     0   0   90  226   21     g    gg ggDgggggggg dd     G   Dg  ggGggg               G  G  g ggg
   398  184 H L        -     0   0   53  224   74     L    RR RRKTTllRllG ll     K   KR  llDRRR               S  D  L RRR
   399  185 H Y  E     -LM 369 394E  36  230    2     Y    YY YYYYYYYYYYY YY     Y   YY  YYYYYY               F  Y  Y YYY
   400  186 H T  E     +LM 367 393E   5  228   48     T    TT TTTSSTTTTTT TT     V   TT  TTTTTT               S  T  T TTT
   401  187 H L  E     -L  366   0E  11  225   53     M    MM MMAAATTMTTM LL     A   AM  TTKMMM               R  K  M MMM
   402  188 H S  E     -LM 365 390E   5  225   25     S    SS SSTSSSSSSSS SS     T   TS  SSISSS               V  I  S SSS
   403  189 H S  E     -LM 364 389E   2  225    1     S    SS SSSSSSSSSSS SS     S   SS  SSSSSS               S  S  S SSS
   404  190 H S  E     -LM 363 388E   0  225   78     Q    QQ QQQQQQQQQQQ QQ     Q   QQ  QQHQQQ               L  H  Q QQQ
   405  191 H V  E     -L  362   0E   0  225   27     L    LL LLVVVLLLLLL LL     V   VL  LLILLL               I  I  L LLL
   406  192 H T  E     +L  361   0E  48  225   41     T    TT TTLNNTTTTTT TT     F   LT  TTRTTT               R  R  T TTT
   407  193 H V  E     -L  360   0E  14  224   29     L    LL LLLVVLLLLLL II     L   LL  LLVLLL               V  V  L LLL
   408  194 H P  E  >  -L  359   0E  56  223   43     P    PP PPSAAPPPPPP LL     P   SP  PPRPPP               S  K  P PPP
   409  195 H S  T  4 S+     0   0   49  222   51     A    AA AAASSAAAAAA AA     S   AA  AAKAAA               K  K  A AAA
   410  196 H S  T  4 S+     0   0   66  222   64     D    VV VVKAATTVTTV SS     V   KV  TTSVVV               T  S  D VVV
   411  198 H P  T  > S+     0   0   31  222   70     Q    EE EEnVVQQEQQE EE     d   nE  qqDEEE               D  D  Q EEE
   412  199 H R  T  < S+     0   0   16  222   99     C    CC CCeWWCCCCCC WW     q   eC  llWCCC               W  W  C CCC
   413  200 H P  T  4 S+     0   0   80  223   71     P    PP PPGDDLPPLLP KK     G   GP  AADPPP               D  I  P PPP
   414  202 H S  T  4 S+     0   0  111  221   68     A    EE EESNNADEAAE NN     S   SE  GGAEEE               A  D  A EEE
   415  203 H E  S  < S-     0   0  128  221   75     K    GG GGDIIGGGGGG ST     D   DG  KKKGGG               G  T  K GGG
   416  204 H T        -     0   0   83  221   71     g    ee eeeeekkekke TT     e   ee  SSkeee               k  k  g eee
   417  205 H V        +     0   0    4  217   60     q    vv vvlffvvvvvv YY     i   lv  VVyvvv               y  y  q vvv
   418  206 H T  E     - P   0 433F  23  217   76     K    KK KKVYYTTKTTK KR     T   VK  TTTKKK               N  T  K KKK
   419  208 H e  E     -NP 378 432F   0  220    1     C    CC CCCCCCCCCCC CC     C   CC  CCCCCC               C  C  C CCC
   420  209 H N  E     -NP 377 431F   4  220   59     H    SS SSKNNHHSHHS KK     N   KS  HHESSS               S  E  H SSS
   421  210 H V  E     -NP 376 430F   1  220   24     V    VV VVIAAVVVVVV VV     V   IV  VVAVVV               V  A  V VVV
   422  211 H A  E     -NP 375 429F  14  220   74     Q    QQ QQHKKKKQKKQ VV     K   HQ  KKSQQQ               S  S  Q QQQ
   423  212 H H  E > > - P   0 428F   1  220   17     H    HH HHHHHHHHHHH HH     H   HH  HHNHHH               H  N  H HHH
   424  213 H P  G > 5S+     0   0   77  209   81     N    DD DDGLLYYDYYD NN     S   GD  YYSDDD               K  S  N DDD
   425  214 H A  G 3 5S+     0   0   40  203   65     S    SS SSNDDTTSTTS YS     N   NS  TTVSSS               G  V  S SSS
   426  215 H S  G < 5S-     0   0   32  202   63     S    NN NNKTTNNNNNN TT     G   KN  NNGNNN               Q  G  S NNN
   427  216 H S  T < 5 +     0   0  111  199   72     P    PP PPNIIPSPPPA NN     D   NP  PPAPPP               S  A  P PPP
   428  217 H T  E   < +P  423   0F  35  196   63     S    VV VVKKKSSVSSV TT     K   KV  SSPVVV               K  P  S VVV
   429  218 H K  E     +P  422   0F 135  196   50     Q    QQ QQDSSQQQQQQ KK     S   DQ  QQKQQQ               H  K  Q QQQ
   430  219 H V  E     -P  421   0F  38  140   32               LVV       QQ     V   L     T                  V  T       
   431  220 H D  E     -P  420   0F  97  140   36               HEE       EE     N   H     A                  T  A       
   432  221 H K  E     -P  419   0F  51  127   45               VLL       KK     V   V                        L          
   433  222 H K  E     -P  418   0F 121  127   48               PKK       SS     P   P                        K          
   434  223 H I        -     0   0    4  123   30               IKK       LL     I   I                                   
   435  224 H V        -     0   0   79  112   59               PDD              T   P                                   
   436  225 H P              0   0   73  103   61               APP                  A                                   
   437  226 H R              0   0  167   89   21                                                                        
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1    1 L D              0   0  100   77   31           Q            E  Q         D   Q    E         Q            Q  
     2    2 L I        -     0   0    0   88   32           N            I  V         I   T    V    L    I            I  
     3    3 L V        -     0   0   88   98   48           V            Q  T         V   V    V    V    V            TV 
     4    4 L M  E     -Q   25   0G  12  101   21           V            M  V         M   V    L    M    L            VL 
     5    5 L T  E     -Q   24   0G  80  101   14           L            T  T         T   T    T    T    T            TT 
     6    6 L Q  E     -Q   23   0G  19  101    5           T            Q  Q         Q   Q    Q    Q    Q            QQ 
     7    7 L S  E    S+Q   22   0G  57  101   57           Q            S  S         T   S    T    T    T            SK 
     8    8 L P        -     0   0   47  148    6      P    P            P  P   P     P   Q P  PP   P P  P    PP PP   PP 
     9    9 L A  S    S-     0   0   79  156   68      A    A            S  A AAV     S   E V  GP   A A  E    PA PP  ASP 
    10   10 L S  E     -t  107   0H  78  168   57      S    A   SSSS     S  V SSS     F   S S  PS   S V  S    SV SS  SSV 
    11   11 L L  E     -t  108   0H  34  204   48      VV   KL LVVVL     L  K VVE     LLL L E  LVVL V I  L    MI LL VVKL 
    12   12 L V  E     +t  109   0H  86  214   38      SS   ST TSSSS     S  S SSSS    ASS A S  SASS S T  F    ST SS SSSS 
    13   13 L V  E     -t  110   0H  17  216   57      VG   VV TAGGA     A  I VVVV    VVV V V  VSGG A S  V    SS AA VVVV 
    14   14 L S  E >   -t  111   0H  46  224   63      SS   QS SNTTK   T S  T SSKK    SSS P K  TFTS A T  S    ST SS LSLR 
    15   15 L L  T 3  S+     0   0   79  225   67      VP   LPMPPPPV   P P  Q VVLL    APP V L  PLPP V P  P    LP PP PVPK 
    16   16 L G  T 3  S+     0   0   39  233    6      GG   GGGGGGGG   G G  G GGGG    GGG G R  GGGGGGGG  G    GG GG GGGG 
    17   17 L Q    <   -     0   0   97  233   51      GQ   QGDGESTE   S D  E GGEE    EGG G E  EAQAAGTS  E    TS AA GGEE 
    18   18 L R        -     0   0  152  233   63      TS   TTTTTSST   T R  T TTTT    RTT R T  PTSSSTAT  R    TT TT STST 
    19   19 L A  E     - R   0  79G   2  233   43      VI   VVLVVVVV   V V  L VVVV    AVV V V  AVVAAVVV  V    IV AA VVIA 
    20   20 L T  E     - R   0  78G  66  233   58      TT   STRIKTTR   T T  I TTRR    TTT S R  SRTRKTRA  T    RA RR GTTT 
    21   21 L I  E     - R   0  77G   0  233   23      LI   ILILIIII   L I  I LLII    ILL I I  ILILLILL  I    LL LL LLIM 
    22   22 L S  E     -QR   7  76G  36  233   53      TS   DTTTTSST   T T  S TTSS    STT N S  SASTTNTT  N    PT TT STTD 
    23   23 L a  E     -QR   6  75G   0  233    0      CC   CCCCCCCC   C C  C CCCC    CCC C C  CCCCCCCC  C    CC CC CCCC 
    24   24 L R  E     -QR   5  74G 153  233   76      QT   KASRSAAS   R R  K EQTT    KGG K T  KTTTTQTK  K    TK TT SERN 
    25   25 L A  E     -Q    4   0G   6  233   70      GG   ASSSGGGG   T A  T GGLL    SSS A L  ALGLLALT  A    LT LL WGTL 
    26   26 L S  S    S+     0   0   63  233   52      NT   NSSSSSSS   S S  S DNSS    SSS S S  SSTRSSRN  S    SN NN TDSG 
    27   27 L E  S    S-     0   0  105  233   74      DS   PTSTSSSS   Q Q  Q DNGG    QSS T G  QSSSSQSP  T    RP SS GNST 
    28   27AL S        -     0   0   29  233   75      IS   kGYGYNNY   A N  P IIAY    sGG S A  sDSDESDa  S    Da gg GISV 
    29   27BL V        +     0   0    0   70   75      ..   aA......   V V  I ....    l.. I .  v..IH..h  I    .h vv S.V. 
    30   27CL D  E     +Z   35   0I  45   97   81      ..   HV.A....   Y N  S ....    sSS . S  HHD.S.Hr  S    Hr .. ..SD 
    31   27DL S  E >  S+Z   34   0I  15  133   82      .D   YT.V.DD.   R .  . ..SS    aVV . I  SDVSD.Ng  .    Dg VV V..N 
    32   28 L Y  T 3  S-     0   0  173  140   87      .V   SS.T.II.   W .  . ..II    NTX . S  DVGVYIIQ  .    VQ EE T..T 
    33   29 L G  T 3  S+     0   0   81  224   59      Gg   gGGT.gg.   s .  g GGGS    QSX G G  GNGGTSGs  .    Gs GG GA.V 
    34   30 L K  E <  S-Z   31   0I 112  182   77      Sy   q..S.ty.   g .  s SSDD    KTX . .  KLYS..Fs  .    Is .. TS.. 
    35   31 L S  E     -Z   30   0I   7  205   76      NN   YN.N.SN.   D T  E KKLR    NNX S Y  THNK.TYH  N    YH YY NKN. 
    36   32 L F        +     0   0    5  218   67      LH   YYSYSGLS   A W  C ANHA    YYY Y H  YSAT.ASC  Y    NC HH HYY. 
    37   33 L M  E     -U   94   0H   0  225   52      VV   LAYAYVVY   M L  V VVMV    LPP L V  LIVIILIM  L    IM II PVM. 
    38   34 L H  E     -U   93   0H   0  229   82      QS   ANGNGSSG   Y A  S QYCH    NGG N N  YYSFDAFS  G    YS NN NHSR 
    39   35 L W  E     -UV  92  52H   0  233    0      WW   WWWWWWWW   W W  W WWWW    WWW W W  WWWWWWWW  W    WW WW WWFW 
    40   36 L Y  E     -UV  91  50H   0  233   14      YY   YFYVYYYY   Y Y  Y YYYF    YFF Y Y  LYYYYYYY  Y    YY FF IYYY 
    41   37 L Q  E     -UV  90  49H   4  233   29      QR   QQQQQQQQ   Q Q  Q QQQQ    QQQ Q Q  LQQQQQQQ  Q    QQ QQ HQQK 
    42   38 L Q  E     -U   89   0H  16  233   12      QH   QQQEQQQQ   H Q  Q QQQQ    QQQ Q Q  QQQQQQQQ  Q    QQ KK QQQQ 
    43   39 L K    >   -     0   0   47  233   62      IH   KHKKKRRK   K K  K MIKK    KTT K K  KRHKHKRK  K    RK KK TMKI 
    44   40 L P  T 3  S+     0   0   81  233   36      LP   TPvPsPPv   S P  P LLaA    APP P S  PPPSPPPP  P    PP PP PLPP 
    45   41 L G  T 3  S+     0   0   58  232   13      PG   GGgDgGGg   G G  G PPnG    GGG G G  GGGEGGGG  G    GG GG GPGG 
    46   42 L Q  S <  S-     0   0  103  233   69      SK   EQSHSTRS   Q K  E SSRN    QKK Q N  QHSSKQQQ  Q    HQ SS SSQG 
    47   43 L P        -     0   0   34  233   59      AA   AAALAAAA   T V  A AVPR    SAA A R  PRAAARPP  V    PP PP IAAV 
    48   44 L P        -     0   0    5  233   10      PP   PPPFPPPP   P P  P PPRP    PPP P P  PPPPPPPP  P    PP PP PPPP 
    49   45 L K  E     -V   41   0H  96  233   63      RE   ERVTVKKV   K K  K RRYr    KQQ K r  QrKrrKrQ  K    RQ rr kRKq 
    50   46 L V  E     +V   40   0H  10  233   45      LL   LGTGTLLT   L L  L LLLl    LMM L l  RlLllLlL  L    FL ll aLLv 
    51   47 L L  E     +     0   0H   2  233   23      II   LLVLVLLV   L L  L IILL    LLL L L  LLMLLLLL  L    LL LL VILL 
    52   48 L I  E     -VW  39  58H   0  233   35      II   MIIIIIII   I I  I IIRW    III I R  IRIYYIRV  I    lV RR gILS 
    53   49 L Y  E  >  + W   0  57H  54  232   23      YY   YYYGYYYY   K Y  Y YYFF    YYY Y F  YYYYLYY.  Y    yR FF wYYW 
    54   50 L I  T >4 S-     0   0   10  233   88      YE   LRDGASDY   Y R  G VDyn    LSS G y  QfDneDfr  D    fH kk gRAG 
    55   51 L A  T 34 S+     0   0    2  233   75      NV   TTNTNVVN   V A  I DDss    ATT A n  VdVdsAdv  S    dV dd qDVS 
    56   52 L S  T 34 S+     0   0   73  233   63      ST   TDSSTSTD   K S  N SSKK    SNN S K  SKSKYSKR  T    NR NK NSTP 
    57   53 L N  E <<  -W   53   0H  77  233   74      EK   TKNNNSKK   T T  S NKHH    TNN T H  NRSHEKHI  N    NI YD YNST 
    58   54 L L  E     -W   52   0H  63  233   66      RR   RKRRRRRR   L L  R RRQQ    RRR R Q  RQRQKLQN  R    QN QQ RRRY 
    59   55 L E    >   -     0   0   49  233   81      PP   FHPAPPPP   E Q  Y PPGG    YPP Q G  GGPGGAGH  Y    GH GG PPQG 
    60   56 L S  T 3  S+     0   0  107  233   40      DS   SSSPSSSS   S T  L DDDD    TSS S D  SHSSTSPS  S    SS SS STSS 
    61   57 L G  T 3  S+     0   0   67  233   21      GG   GWGGNGGD   G G  N GGGG    GGG G G  GKGGGGKG  G    KG GG GGGg 
    62   58 L V    <   -     0   0   17  233   47      IV   ITIVIIII   T V  T IIVV    VVV V V  VVVVVVVT  T    IT VV TIVs 
    63   59 L P    >   -     0   0   62  233   27      PS   AHPPPPPP   P P  P RPPP    PPP P P  PPSPPPPA  P    PA PP PPSS 
    64   60 L A  T 3  S+     0   0   99  233   58      ED   SASVSEES   S S  S EEDD    DEE A D  DPNSDSPA  A    PA SN EEDS 
    65   61 L R  T 3  S+     0   0   30  233    8      RR   RRRRRRRR   R R  R RRRR    RRR R R  RRRRRRRR  R    RR RR RRRK 
    66   62 L F  E <   -S   79   0G   7  233    1      FL   FFFFFFFF   F F  F FFFF    FFF F F  FFFFFFFF  F    FF FF FFFF 
    67   63 L S  E     -S   78   0G  59  233   24      SS   SSSSSSSS   S S  S SSSS    TSS S S  TSSSSKSS  S    SS SS TSST 
    68   64 L G  E     +S   77   0G  17  233   11      GG   gGGGGGGG   G G  g GGgg    GGG G g  GgGgGGgG  G    gG gg GGGs 
    69   65 L S  E     +S   76   0G  48  233   40      TS   aSSSSSSS   S S  a TTdd    SSS S d  SdSdSSdS  S    dS dd ATRh 
    70   66 L G  E     -S   75   0G  35  233   77      NK   ALLLKKKK   G G  S NNSS    GII G S  GLKASGVG  G    LG SS INGQ 
    71   67 L S  E >   +S   74   0G  68  232   24      SS   NLSISSSS   S S  I SSPP    SSS S P  SASSSSSS  S    AS SS TSSS 
    72   68 L R  T 3  S-     0   0  163  232   35      DG   GGGGGGGG   S G  G GGNN    GEE G N  GKGAGGRS  G    KS AA GGGT 
    73   69 L T  T 3  S+     0   0   51  232   58      NN   VGSDSNNS   S T  K NNNN    TNN T N  TNNNATNT  T    NT NN GNTT 
    74   70 L D  E <   +RS  24  71G  77  232   64      TT   DKTKTTTT   D D  D TTVV    DKK D I  DTTADQQD  D    TD AA KTDD 
    75   71 L F  E     -RS  23  70G   0  232   81      AA   FAGAGAAA   F F  F AAGG    FAA F G  FGAGHFGF  F    GF GG AAFY 
    76   72 L T  E     -RS  22  69G  33  232   61      SS   TATATTTT   S T  T SSYY    TAA T Y  TYSLNTYT  T    YT LL VSSC 
    77   73 L L  E     -RS  21  68G   0  232    4      LL   LLLLLLLL   M L  L LLLL    LLL F L  LLLLLLLL  L    LL LL LLFL 
    78   74 L T  E     -RS  20  67G  28  232   48      TT   TTTTTTTT   T T  T EKTT    TTT T T  KSTLITST  T    ST TT SQTI 
    79   75 L I  E     -RS  19  66G   0  232    4      II   ILIIIIII   I I  I IIII    III I I  IIIIIIII  I    II II IIII 
    80   76 L D  S    S+     0   0   68  232   42      SS   SSTTTSST   S S  S SSKK    STT S K  SASSSSSS  S    SS SS SSSN 
    81   77 L P  S    S-     0   0   51  232   61      GG   GGGGGGGG   G S  G GGGG    NGG S G  GEGGSGEG  S    EG GG RGNN 
    82   78 L V        +     0   0    0  232   50      AL   VAVAVLLV   V L  V AAAA    IAA V A  VLLLIVLV  V    LV LL AAVV 
    83   79 L E    >   -     0   0   93  232   36      QQ   QRQQQQQQ   Q E  Q QQLL    QQQ E L  KQQQQQQQ  E    QQ QQ QQQE 
    84   80 L A  G >  S+     0   0   22  232   55      AA   APATAAAA   A P  T TGLL    APP A L  AAAPACPT  V    PT PP AATE 
    85   81 L D  G 3  S+     0   0   58  232   28      EE   EEEEEEEE   E E  E GEEE    EEE D E  EEEEEDEQ  E    EQ EE EGER 
    86   82 L D  G <   +     0   0    1  232    0      DD   DDDDDDDD   D D  D DDDD    DDD D D  DDDDNDDD  D    DD DD DDDD 
    87   83 L A    <   +     0   0   12  232   78      EE   AEEDEEEE   A A  A EEDD    MEE A D  AEEEEAEE  A    EE EE DEAS 
    88   84 L A  E    S- X   0 108H   8  232   20      AA   AAAAAAAA   A A  G AAAA    GGG G A  GAVAAAAA  G    AA AA GAGA 
    89   85 L T  E     -UX  42 107H  35  233   69      DD   LDVMVDDV   E T  D DDDD    DDD D D  VVDDDTIV  N    VV DD VDDV 
    90   86 L Y  E     -UX  41 106H   0  233    4      YY   YYYYYYYY   V Y  Y YYYY    YYY Y Y  YYYYYYYY  Y    YY YY YYYY 
    91   87 L Y  E     -U   40   0H   9  233    6      YF   YYFFYHYF   F Y  Y YYYY    YYY Y Y  YFYYIYYY  Y    FY YY YYYY 
    92   88 L a  E     -U   39   0H   0  233    4      CC   CCCCCSCC   V C  C CCCC    CCC C C  CCCCCCCC  C    CC CC CCCC 
    93   89 L Q  E     -UY  38 102H   1  233   79      RC   QLGAGACG   R Q  Q QQAA    LCC Q N  AASEGQAL  Q    AL GG AQQQ 
    94   90 L Q  E     +UY  37 101H   0  233   84      VS   SLSlSVSS   p Q  s VVTi    qll k T  QvSAvQLG  q    vG AT LVqT 
    95   91 L N        +     0   0    0  206   57      WY   YY.yY.YY   f .  y WWWy    yyy s W  .tYWf.WY  y    .Y WW WWyW 
    96   92 L N  S    S+     0   0    1  213   78      dv   hresdgrd   V .  i ddhs    sss e h  .padt.gn  P    .n hh tdsd 
    97   93 L E  S    S-     0   0   48  212   78      kt   qgg.gccs   S .  s aass    vpx q s  .pttc.pt  .    at ta agpv 
    98   94 L D  S    S+     0   0   42  216   73      LY   YVV.IFFi   L .  W VIFL    lYV F Y  .WVVY.MF  I    WF FV WlLI 
    99   95 L P  S    S-     0   0   26  119   74      ..   ...h...r   W .  V ....    pT. . .  .......T  .    .. .. .w.T 
   100   96 L P        -     0   0    4  155   90      H.   ...W...S   Y .  F ...H    PY. S .  .F....FQ  T    F. .. .GTV 
   101   97 L T  E     -Y   94   0H  26  200   64      II   VV.V.VVQ   T .  T Y.II    TV. G I  .TVVVGVT  V    VT V. IWVV 
   102   98 L F  E     -Y   93   0H  26  231   16      FF   FFFFFFFP   F H  F FFFF    KFF G F  .FFSFYFF  I    FH FF FWIF 
   103   99 L G        -     0   0    3  233   17      GG   GGGGGGGS   G N  G GGGG    TGG G G  AGWGGSGN  Q    SS GG GAQG 
   104  100 L A        -     0   0   81  233   63      GT   GGAGSGGS   G S  G GGGG    SSS S G  TSGGGSSL  T    EG GG GVTQ 
   105  101 L G        -     0   0   12  233   14      GG   GGGGGGGG   G G  G GGGG    SGG G G  PGTGGSGS  I    GC GG GANG 
   106  102 L T  E     - X   0  90H   0  233   14      TT   TTTTTTTS   T I  T ITTT    ETT T T  DTETTATT  T    TS TT TSTT 
   107  103 L K  E     -tX  10  89H  74  233   53      QS   RKTKTQQT   K H  K QQQQ    SHH N Q  SKTRQDQQ  K    QK QQ QMKK 
   108  104 L L  E     +tX  11  88H   2  232   22      LV   LLLLLLLV   L I  L VLLL    LLL Y L  LVKLLTLX  T    LI VL LLTL 
   109  105 L E  E     -t   12   0H  14  233   69      TT   DTTTTTTT   I F  L TTTT    TSS T T  STTPTTTL  T    TT TT TQNI 
   110  106 L M  E     -t   13   0H   0  233   29      VV   VVVVVVVI   V A  I VVVV    SVV L V  LICFVVVI  L    VT VV VKCV 
   111  107 L R  E     +t   14   0H 126  233   86      LL   GLKLLLLS   G F  S LLLL    CLL T L  YPPQTFLV  C    LG LL IHTT 
   112  108 L R        -     0   0   64  233   79      tR   SSDGGGGG   S p  t tttt    LGG v t  KDgrGQGd  T    GV GG tWLS 
   113  109 L A        -     0   0   71  221   67      dQ   DQQQQQQQ   G d  s dddd    HQQ s d  .QsqQ.Qg  .    Q. QQ d..S 
   114  110 L D        -     0   0   58  226   72      Vp   Vppppppp   V Q  P VVVV    Hpp v V  .pGpp.pV  .    p. pp V..s 
   115  111 L A  B     -A  144   0J  19  225   58      Ka   .avsvssv   V .  V KKKK    Sss a K  .fSav.aV  .    sV ss K..p 
   116  112 L A        -     0   0   40  229   62      AN   RAASAAAA   R .  K SAAA    QAA D A  .PLAT.SR  K    AR AA AGNP 
   117  113 L P        -     0   0    9  229    4      PP   PPPPPPPP   P .  P PPPP    PPP D P  .PSPP.PP  H    PP PP PGAP 
   118  114 L T  E     -B  141   0K  85  232   60      ST   TSTSTSST   T S  S SSSS    WTS A S  .SASSAST  A    ST TT SPDV 
   119  115 L V  E     -B  140   0K   8  233   26      VV   LVVVIVVV   L G  V VVVV    TVV A V  KVMVVLVL  R    VL VV VWKL 
   120  116 L S  E     -B  139   0K  17  233   67      ST   TTHTTSSH   T Q  S SSSS    CTT D S  KTKTITTT  C    TT TT SIIT 
   121  117 L I  E     -B  138   0K  22  233   31      IL   VLLLLLLL   V L  L IIII    NLL Y I  MLMLLELV  L    LV LL ISIV 
   122  118 L F  E     -B  137   0K   4  233    7      FF   LFFFFFFF   L L  L FFFF    FFF Y F  FFFFFTFL  F    FL FF FILF 
   123  119 L P        -     0   0    5  233   25      PP   PPAPPPPA   P L  G PPAP    PPP C P  DPPPPPPP  V    LP PP APAP 
   124  120 L P        -     0   0    1  233    9      PP   PPPPPPPP   P S  S PPPP    LPP P P  IPPPPQPP  T    PP PP PKNP 
   125  121 L S    >>  -     0   0    8  233   10      SS   SSSSSSSS   S E  S SSSS    LSS Q S  PSSSSESS  A    FS SS SNIS 
   126  122 L S  H 3> S+     0   0   78  233   64      VS   RSASKAAS   K E  S EVEV    PTT A V  GTSSSSSP  V    SP TT EKTS 
   127  123 L E  H 3> S+     0   0   76  233   30      EE   EEQEEEEE   D N  L EEEE    KEE E E  DEEEEREE  I    EE EE EGIA 
   128  124 L Q  H <4>S+     0   0    8  233   30      EE   DEEEEEEE   E Q  Q EEEE    SEE R E  QEEEESEE  K    EE EE EIHE 
   129  125 L L  H ><5S+     0   0   29  233   22      IL   LLMLLLLL   D A  S IIII    LLL L I  VLLLLVLL  M    LL LL ILVL 
   130  126 L T  H 3<5S+     0   0  111  233   69      AQ   QQEEDNNS   K G  S AAAA    KSS P A  ASQQKRKQ  R    GQ SS AQSQ 
   131  127 L S  T 3<5S-     0   0   83  233   68      TA   QATTQNNQ   Q G  G TTTT    TNN L T  ATAADLAQ  G    AQ NN TTRS 
   132  128 L G  T < 5S+     0   0   34  233   54      KN   GNGNNNNG   S G  D KKKK    HNN T K  EYNNNGNG  F    NG NN KPGN 
   133  129 L G  E   < - C   0 186K  21  216   60      KK   KKKKKKKK   S .  S KKKK    .KK . K  GTKKK.KS  .    KS KK KH.. 
   134  130 L A  E     - C   0 185K   0  225   19      AA   AAAAAAAA   A .  A AAAA    .AA . A  SAAAA.AA  .    AA AA AL.T 
   135  131 L S  E     - C   0 184K   2  226   39      TT   TTTTTTTT   T .  A TTTT    .TT . T  GTTTT.TT  .    TT TT TS.A 
   136  132 L V  E     - C   0 183K   0  226   35      VL   LLLLLLLV   L .  L LVVV    .LL . V  HLLLL.LL  .    LL LL VL.S 
   137  133 L V  E     -BC 122 182K   0  226   15      VV   MVVVVVVV   V .  F VVVV    .VV . V  AVVVV.VV  .    VV VV VV.L 
   138  134 L b  E     -BC 121 181K   0  227    9      CC   CCCCCCCC   C .  C CCCC    .CC . C  CCCCCCCC  .    CC CC CC.V 
   139  135 L F  E     -BC 120 180K   0  228   40      SL   LLLTLLLL   L .  L SSSS    .LL V S  SLLLLPLL  .    LL LL SS.C 
   140  136 L L  E     -BC 119 179K   0  228   49      LI   AIMIIMMI   A .  L LLLL    .MM I L  CIIIISIA  .    IA MM LL.L 
   141  137 L N  E     -B  118   0K   2  221   47      SS   NSETSSSE   T .  S SSSS    .SS . S  .SSSNCNS  .    SS SS SS.S 
   142  138 L N  E    S+     0   0K  49  225   49      DD   KDNDDDDN   G .  S DDDD    .DD . D  .DDDDSDG  .    DG DD DD.S 
   143  139 L F  E     - C   0 177K   0  226   41      FF   GFFFFFFF   G .  Y FFFF    .FF Q F  .FFFFSFG  .    FG FF FF.Q 
   144  140 L Y  B    S+A  115   0J   9  226   46      TY   FYYYYYYY   F .  S TTTT    .YY T T  .YYYYWYS  .    YS YY TT.S 
   145  141 L P  S    S-     0   0   18  226   16      PP   PPPPPPPP   P .  P PPPP    .PP N P  .PPPPAPP  .    PP PP PP.V 
   146  142 L K  S    S+     0   0   83  227   74      RG   SGSGSGGR   S .  P RRRR    .GG T R  .GGGRHAS  Q    GS GG RR.P 
   147  143 L D        +     0   0  116  228   78      GA   DARVPSSD   N .  G GGGG    .AA T G  .NAATLTQ  P    SQ AA GGQF 
   148  144 L I        -     0   0   19  228   60      AV   WVVVVVVV   W .  A AAAA    .VV T A  .VVVVLIW  L    LW VV AAIA 
   149  145 L N  E     -E  201   0L  82  228   67      TT   STTTTTTS   N .  K TTTT    .TT S T  .TTTKRVK  P    KK TT TTTD 
   150  146 L V  E     -E  200   0L  27  228   12      VV   LVVVVVVV   L .  V VVVV    .VV R V  .VVVVVVL  P    VL VV VVVV 
   151  147 L K  E     -E  199   0L  53  228   76      KA   AAEDEAAE   G .  T KKKK    .AA F K  .AAANIAS  S    AS AA KKTS 
   152  148 L W  E     +E  198   0L   3  228    3      WW   WWWWWWWW   W .  W WWWW    .WW W W  .WWWWLWW  W    WW WW WWQW 
   153  149 L K  E     +EF 197 158L  76  229   45      LK   KKVKLKKV   K .  T QLLL    .KK R L  .KKKKRKK  Q    KK KK LQSL 
   154  150 L I  E    S-E  196   0L   0  229   68      VA   VAAVVAAA   V .  R VVVV    .EE C V  .AAAAAAV  I    AV EE VVPA 
   155  151 L D  S    S-     0   0   71  229   24      DD   DDDDDNND   G .  D DDDD    .NN S D  .DDDDANG  K    DG NN DDSA 
   156  152 L G  S    S+     0   0   63  230   38      GG   GSGGGGGG   G G  G GGGG    .GG N G  .GGGGRGG  T    GG GG GGSG 
   157  153 L S  S    S-     0   0   33  229   65      KS   SSNTSTTK   T G  S KKKK    .SS G K  .SNNNLTG  E    SG SS KKKS 
   158  154 L E  B     -F  153   0L  85  229   76      DP   SPTPTPPT   S G  E EDED    .PP Q D  .PSSSELS  R    PS PP EESP 
   159  155 L R        -     0   0   69  231   75      QV   SVIVRVVI   T D  L KQKQ    .VV I Q  CVVVVGIS  S    IS VV QKVV 
   160  156 L Q        +     0   0  133  232   75      TK   SKTTKTTT   S N  S TTTT    .SS V T  STRRTPTT  L    TT SS TTLS 
   161  157 L N  S    S+     0   0  117  233   70      DA   SASQGQQS   S G  E DDDD    EQQ L D  ARDDQAQT  T    QT QQ DDPS 
   162  158 L G  S    S+     0   0   29  233   33      SG   sGGGEGGG   G G  G GSSS    TGG T S  GGGGGGGS  d    GS GG SGGG 
   163  159 L V  E     -D  183   0K  46   68   75      ..   s.......   . .  F ....    ... . .  S......A  a    .A .. .... 
   164  160 L L  E     -D  182   0K  16  212   47      VV   eVVM.VVV   V .  . VVVV    .VV . V  .VVVV.V.  I    V. VV VV.I 
   165  161 L N  E     +D  181   0K  52  216   55      QE   EEEE.EEE   S .  . VQQQ    .EE . Q  .VEED.ES  E    ES EE QVES 
   166  162 L S  E     -D  180   0K  12  224   49      ST   STTTTTTT   T .  L SSSS    .TT . S  .TTTT.TH  N    TH TT SSST 
   167  163 L W  E     -D  179   0K  99  224   71      ST   RTSTTTTS   S .  T SSSS    .TT . S  .STTT.TS  G    TS TT SSIS 
   168  164 L T        -     0   0   24  225   66      GK   SSQQPKKH   L .  S GGGG    .KK . G  .QKKQSQL  K    KL KK GGTT 
   169  165 L D        -     0   0   99  226   74      LP   PPPPAPPN   E .  A LLLL    .PP . L  .APPPGLE  K    PE PP LLIA 
   170  166 L Q        -     0   0   18  229   76      SS   GSQSQSSA   V G  E SSSS    .SS . S  .SSSSGSV  A    SV SS SSTV 
   171  167 L D     >  -     0   0   48  229   61      KK   VKRKRKKQ   L R  S KKKK    .KK . K  .QKKKRKL  Q    KL KK KKCQ 
   172  168 L S  T  4 S+     0   0   54  232   60      QQ   LQQQQQQQ   G S  Q QQQQ    PQQ Q Q  SQQQQGQG  H    QG QQ QQRR 
   173  169 L K  T  4 S+     0   0  180  232   58      SS   ESSSSSSQ   T S  Q SSSS    HSS T S  GSSSSQSS  A    IS SS SSTP 
   174  170 L D  T  4 S-     0   0   57  232   39      DN   KNPNNNNS   D G  D DDDD    ENN P D  DSNNNAND  V    ND NN DDSD 
   175  171 L S     <  +     0   0    4  232   57      NN   DNSNSNNS   G D  G SNNN    NNN E N  FSNNNDNG  R    NG NN NSSQ 
   176  172 L T        -     0   0    5  232   72      LK   gRHKQKKt   R V  R LLLL    VKK S L  vKKKKSKR  T    KR KK LLST 
   177  173 L Y  E     -C  143   0K   7  226    4      YY   yYYYYYYy   Y V  Y YYYY    FYY . Y  tYYYY.YF  .    YF YY YY.Y 
   178  174 L S  E     -     0   0K   1  226   72      MA   SAMMMAAL   S M  S MMMM     VV . M  QVAAA.RS  .    VS VV MM.Q 
   179  175 L M  E     -CD 140 167K   0  227   79      EA   WAAAAAAA   W T  C EEEE     AA . E  TAAAA.AW  .    AW AA EEVI 
   180  176 L S  E     -CD 139 166K   3  229    6      SS   SSSSSSSS   S Q  T SSSS     SS . S  PSSSSSSS  V    SS SS SSSS 
   181  177 L S  E     -CD 138 165K   0  229    4      SS   SSSSSSSS   S T  S SSSS     SS . S  GSSSSESS  S    SS SS SSNS 
   182  178 L T  E     -CD 137 164K   2  230   72      YY   TYYYYYYY   T P  V YYYY     YY . Y  SYYYFAYT  L    YT YY YYYS 
   183  179 L L  E     -CD 136 163K   0  231    1      LL   LLLLLLLL   L L  L LLLL     LL L L  LLLLLPLL  L    LL LL LLML 
   184  180 L T  E     +C  135   0K  36  231   54      SS   RSSTSSSS   S S  K SSSS     SS A S  STSSSSIN  N    NN SS SSHT 
   185  181 L L  E     -C  134   0K  16  231   14      LL   LLLLLVVL   L L  L LLLL     MM V L  VLLLLFLL  G    LL MM LLFI 
   186  182 L T  E  >  -C  133   0K  81  230   58      TT   PTDTTSST   S P  K TTTT     SS S T  TTTTSPMP  N    SP SS TT Q 
   187  183 L K  H >> S+     0   0   66  227   67      AP   APAAASSP   A    R SAAA     AA P A  PGPPAPPA  K    PA AA AS T 
   188  184 L D  H 3> S+     0   0  109  228   63      DE   DESRSQQT   D    E DDDD     SS G D  GSQQNPND  G    ED SS DD S 
   189  185 L E  H >4 S+     0   0   53  228   49      QQ   QQKADDDE   Q    E EQQQ     KK D Q  EEQQQWQQ  I    KQ KK QE D 
   190  186 L Y  H X< S+     0   0    6  226   12      WW   WWWWWWWW   W    W WWWW     WW   W   WWWWWWW  V    WW WW WW W 
   191  187 L E  H 3< S+     0   0   90  226   71      LK   GKQESKKQ   R    E LLLL     KK   L   KKKKQRK  K    KK KK LL N 
   192  188 L R  T << S+     0   0  160  226   61      RS   KSSRSSSS   K    K KRKR     SS   R   PSSSQSK  S    SK SS RK M 
   193  189 L H    <   -     0   0   24  224   55      HH   VHYHHAAY   A    R HHHH     AA   H   KRRYHHV  Y    HV AA HH D 
   194  190 L N  S    S+     0   0   97  224   71      ER   GRNSESSN   G    E DEEE     SS   E   SSSQRKD  S    SD SS ED K 
   195  191 L S  E     + G   0 214L  37  224   71      TS   SSSSTAAS   S    R LTTT     QQ   T   SSSSHRS  S    SS QQ TL V 
   196  192 L Y  E     +EG 154 213L   0  224   14      YY   VYVYYYYV   V    Y YYYY     YY   Y   YYYVYYV  L    FV YY YY Y 
   197  193 L T  E     -EG 153 212L   3  223   48      SS   TSSSTSSS   S    V SSSS     SS   S   SSST SA  A    SA SS SS T 
   198  194 L b  E     -EG 152 211L   1  223    0      CC   CCCCCCCC   C    C CCCC     CC   C   CCCC CC  C    CC CC CC C 
   199  195 L E  E     -EG 151 210L  34  212   62      KQ   E KQRQQK   E    R KKKK     HH   K   EHHQ QE       LE HH KK K 
   200  196 L A  E     -EG 150 209L   1  212   22      VV   A VVVVVV   A    V VVVV     VV   V   VVVV VA       VA VV VV V 
   201  197 L T  E     +E  149   0L  36  212   35      ST   T RTTTTR   S    T TSSS     TT   S   TTTT TS       TS TT ST S 
   202  198 L H  E >   - G   0 205L  18  212   27      HH   Q HHHHHH   L    H HHHH     HH   H   HHHH HL       HL HH HH L 
   203  199 L K  T 3  S+     0   0  145  211   56      QE   G EEDDD    S    A QQQQ     DD   Q   EEEE ES       ES ED QQ G 
   204  200 L T  T 3  S+     0   0   55  211   41      GG   S AGGGG    G    G GGGG     GV   G   GGGG GG       GG VG GG S 
   205  201 L S  E <   -G  202   0L  45  187   83       S   Q  HTKK    Q    G          NS       SKKH SQ       SQ SN    Q 
   206  202 L T  E    S+     0   0L 140  187   30       T   T  TATT    S    D          TT       TTTT TS       TS TT    T 
   207  203 L S  E    S-     0   0L  82   90   51           P          P    Q                         S        S       S 
   208  204 L P  E     -     0   0L  43   67   33                           E                                            
   209  205 L I  E     -G  200   0L  46   67   29                           I                                            
   210  206 L V  E     +G  199   0L  70   63   53                                                                        
   211  207 L K  E     +G  198   0L  85   63   26                                                                        
   212  208 L S  E     -G  197   0L  67   63   28                                                                        
   213  209 L F  E     -G  196   0L  30   63   18                                                                        
   214  210 L N  E      G  195   0L  99   63   62                                                                        
   215  211 L R              0   0   82   54   19                                                                        
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  213   30  QEQQ  QEQ        Q   Q QQ      EEQE   Q Q QK         Q EEDE     E     
   218    2 H V        +     0   0   30  215   38  VIVI  VVV        I   V IV      VIVI   V V VV         V VIVV     I     
   219    3 H K  E     -A  241   0A 143  215   52  QQQS  QQQ        K   Q QQ      KQQT   T Q QQ         Q QTQQ     L     
   220    4 H L  E     -A  240   0A  11  231    3  LLLL  LLL        MLL L LL L    LLLL   V L LL        LL LLLL  L  L    L
   221    5 H Q  E     -A  239   0A 120  231   74  QHQT  QQL        DTT V QQ T    DQQT   S Q QQ        TV QTVV  T  S    V
   222    6 H E  E     -A  238   0A   2  232   34  QQQQ  QQQ        QQS Q QQ S    EQQQ   L Q QQ        SQ QQEE  E  Q    E
   223    7 H S  E     +A  237   0A  48  232   22  SSPP  PSS        SSS S PS S    TSPP   S S SS        SS SPSS  S  K    S
   224    8 H G        -     0   0   35  232   24  GGGG  GGG        PEG G GG D    GGGE   V G GG        DG GEGG  E  A    G
   225    9 H P        -     0   0   50  232   51  APAT  TPP        NPS A AP S    GPAS   P A PA        SA ASGG  P  S    G
   226   10 H A  S    S+     0   0   30  232   54  EEEV  EEE        VVE E EE V    GEEV   E E EE        VE EVDG  A  E    D
   227   11 H V  E     -d  334   0B  33  233   26  LLLT  LLL        VVV L LL V    LLIV   L L LL        VL LVVL  V  I    V
   228   12 H I  E     -d  335   0B   9  233   54  AVVV  VVV        KKK R VV K    VVVK   V A VV        KR VKRV  K  A    K
   229   13 H K        -     0   0  104  233   49  SKRK  KKK        RRK K KR R    QRRK   K K KK        RK KKQQ  R  N    K
   230   14 H P  S    S+     0   0   56  233   12  PPPP  PPP        PPP P PP P    PPPP   P P PP        PP PPPP  P  V    P
   231   15 H S  S    S+     0   0   90  233   20  GGGS  GGG        GGR G GG G    GGGG   S G GG        GG GGGG  G  G    G
   232   16 H Q  S    S-     0   0   76  233   60  ATVE  AAA        EEE A AV E    RTAE   E S AA        EA AEGG  E  T    D
   233   17 H S        -     0   0   51  232   21  SSSV  SSS        TSS S AS S    PSSS   T S LS        SS SSSS  S  S    S
   234   18 H L  E     - B   0 300A   1  232   46  VVVL  VVV        VHV V VV V    MVVH   L V VV        VV VHLL  H  I    L
   235   19 H S  E     - B   0 299A  64  233   50  KKKQ  KKK        KTT K NK T    KKKR   R K KK        TE KRSR  R  L    R
   236   20 H L  E     - B   0 298A   1  233   15  FMLL  LLI        MLL I LI L    LVLL   L I IL        LV ILLL  L  L    L
   237   21 H T  E     -AB 223 297A  29  233   34  SSST  SSS        STS S SS S    SSST   A S SS        SS STSS  T  Q    S
   238   22 H c  E     -AB 222 296A   0  234    0  CCCC  CCC        CCC C CC C    CCCC   C C CC        CC CCCC  C  C    C
   239   23 H I  E     -AB 221 295A  54  233   74  KKKK  KKK        VSV K KK T    VKKT   K K KK        TR KTKT  T  E    K
   240   24 H V  E     -A  220   0A   4  233   54  AAAV  AAA        CAV A AG V    AATV   V A AA        GA AVAG  T  V    A
   241   25 H S  E     +A  219   0A  60  234    9  SSST  SSS        SSS P SS S    SSSS   S S SS        SS SSSS  S  S    S
   242   26 H G  S    S+     0   0   54  228    4  GGGg  GGG        GGG G GG G    GGGG   g G GG        GG GGGG  G  G    G
   243   27 H F  S    S-     0   0   37  199   30  YYYl  YYY        .F. Y FY .    FYYF   i . YY        .. .FF.  F  .    F
   244   28 H S    >   -     0   0   44  201   49  TTTT  TTT        .T. T ST .    TSTS   T . TT        .. .ST.  T  .    T
   245   29 H I  T 3  S+     0   0    2  232   27  FFFD  FIF        FF. F FF I    FFFL   D Y FF        FY YLFF  F  Y    F
   246   30 H T  T 3   +     0   0   59  232   53  TTTS  TTT        SS. T TT S    GITS   G T TS        SI TSST  S  N    S
   247   31 H R  S X  S-     0   0  145  234   77  SNNS  SDS        MDL R SD M    DDDS   S F SD        VF FSSF  S  I    S
   248   32 H T  T 3  S+     0   0   72   68   71  ...K  ...        T.S . Q. S    ....   K T ..        GT N..S  .  N    .
   249   33 H N  T 3  S+     0   0   16   73   70  ...I  ...        S.L . W. R    ....   I S ..        DS D..S  .  D    .
   250   34 H Y  E <   -E  317   0C  23  234   47  YYYY  YYY        FYA Y FY Y    YYYY   H Y FY        YY YYYY  Y  H    Y
   251   35 H d  E     -EF 316 270C   0  224   90  WYWS  WYY        YGW W .A W    WNWG   A D DF        WA NGCY  A  H    W
   252   35AH W  E     -EF 315 269C   1  222   46  MMMV  MVI        IML M .L M    MIMM   V I II        ML MMMM  M  M    M
   253   35BH H  E     -EF 314 268C   0  231   72  QHNE  HNH        HHH H HH H    NYNH   D S SH        HL DHYY  D  H    S
   254   36 H W  E     +EF 313 267C   1  233    1  WWWW  WWW        WWW W WW W    WWWW   F W WW        WW WWWW  W  W    W
   255   37 H I  E     -EF 312 265C   0  233   13  VVVV  VVV        IVI V VV I    VVVV   I I MI        IV VVIV  V  V    V
   256   38 H R  E     -EF 311 264C  10  234   15  KRKR  KKK        RRR R KK R    RKKR   R K KK        RR KRCR  R  R    R
   257   39 H Q  E     -EF 310 263C  22  233    3  QQQD  QQQ        QQQ Q RQ Q    QQQQ   Q Q QQ        QQ QQQQ  Q  Q    Q
   258   40 H A    >   -     0   0   14  233   59  RSRP  RSR        KVK A RS K    SSRA   F T RR        KS SAAA  A  A    A
   259   41 H P  T 3  S+     0   0   99  234   20  PHPA  PHP        PPP P PH P    PHPP   S T PS        PP HPPP  P  P    P
   260   42 H G  T 3  S+     0   0   94  234   11  GGGG  GGG        GGG G GG G    EGGG   G G GG        GA GGGG  G  G    G
   261   43 H K  S <  S-     0   0  140  234   34  QKQK  RKQ        RKK Q QK K    KKQK   S Q QQ        KG RKKK  K  P    K
   262   44 H G        -     0   0   20  234   23  GSGG  GSG        AGG G GS G    GSGG   R G GG        GA SGGG  G  g    G
   263   45 H L  E     -F  257   0C  10  234    6  LLLL  LLL        LLL L LL L    LLLL   F L PL        LL LLLL  L  i    L
   264   46 H E  E     -F  256   0C  79  234   10  EEEE  EEV        EEE E EE E    EEEE   E E EE        EQ EEEE  E  E    E
   265   47 H W  E     +F  255   0C  13  234    9  WWWW  WWW        WWW W WW W    WWWW   F Y WW        WY WWWW  W  W    W
   266   48 H M  E     -     0   0C   3  234   31  IIIL  III        III V II I    VIIL   L I II        IL ILIV  I  L    V
   267   49 H G  E     -FG 254 277C   0  234   42  GGGG  GGG        GAG G GG G    SGGA   A G GG        GG GAAS  A  A    A
   268   50 H R  E     -FG 253 276C  10  234   92  AYMR  RDW        FYR T VI Y    QYAA   H Y WW        YW NAYA  F  A    T
   269   51 H I  E     -FG 252 275C   3  234   20  IIII  III        III V II I    IIII   I I IF        II IIII  I  Y    I
   270   52 H d  E >   -F  251   0C   0  234   84  YYHI  DNY        SYD N NS D    RDDA   N N SN        DN NSSN  H  R    D
   271   53 H Y  T 3  S+     0   0   47  234   85  PPpH  PpP        gSS a Pt T    nppG   y T PP        ST pGST  T  S    D
   272   54 H E  T 3  S-     0   0   63  232   61  gndN  nng        ssG d sg G    endS   n g gg        Gd dGsg  g  D    G
   273   55 H G  S <  S+     0   0   25  185   36  ggSS  gGg        .sT . g. T    .G.G   . g gg        Tg .Gsg  s  .    S
   274   56 H S        -     0   0   42  200   70  EAED  DGN        .SG . RN T    .G.H   . G SS        GK SRSS  H  T    Q
   275   57 H I  E     -G  269   0C  71  215   54  TTST  TTT        .QT . TT A    TSSK   . T SI        TP TKTT  I  T    Q
   276   58 H Y  E     -G  268   0C  70  222   77  RSRY  KSK        .YI . NS Y    YSYY   . Y EK        IT IYSW  Y  Y    F
   277   59 H Y  E     -G  267   0C  41  227   14  YYLY  FYY        YYF . YY Y    YYTY   . Y YF        FY YYYY  Y  I    Y
   278   60 H S    >>  -     0   0   11  231   57  SNDA  NNN        SSA A NN A    SNSE   . N NN        AA NAAT  S  S    A
   279   61 H P  T 34 S+     0   0   76  234   56  QQQQ  EQE        EEQ Q EQ Q    DQYP   S E EE        QQ QPDD  Q  E    D
   280   62 H S  T 34 S+     0   0   79  234   55  KKKS  KKK        SSS K KK S    SKNA   A K KK        SG KASS  S  S    S
   281   63 H I  T X4 S+     0   0    4  234   43  VFFL  FFF        VVL F FF L    VFQG   L F FF        LF FFVV  V  F    V
   282   64 H K  G >< S+     0   0  133  234   33  KKKK  RKK        KKQ Q KK Q    KKKR   K K KK        QS KRKK  Q  K    K
   283   65 H S  G 3  S+     0   0  116  234   31  GGDG  TGG        NGG D NG G    GGFD   S G GD        GE GDGG  G  E    G
   284   66 H R  G <  S+     0   0   51  234   16  KKKR  KKK        RRQ R KK Q    RKKR   R K KK        QR KRRR  R  R    R
   285   67 H S  E <   -C  300   0A  11  234   54  AAAI  AAT        FFF A AA F    FAgF   L A AA        FF ALFF  F  L    F
   286   68 H T  E     -C  299   0A  67  220   24  TTTT  TTT        TIT T TT T    TTtE   T T TT        TV T.TT  T  .    T
   287   69 H I  E     +C  298   0A   3  220   25  LLLV  LLL        III M LM I    ILLI   L L LL        IF L.II  I  .    I
   288   70 H S  E     -C  297   0A  56  234   45  TTTS  TTT        SST T TT T    STTS   S T TT        TS TESS  S  T    S
   289   71 H R  E     -C  296   0A  71  234   70  AVVR  VVA        RRK A VV K    RVVK   R V AA        KM VIRK  R  P    R
   290   72 H D  E >>> -C  295   0A  55  234   18  DDDD  DDD        DDD D DD D    DDDD   D D DD        DD ESDE  D  S    D
   291   73 H T  T 345S+     0   0   78  233   60  KKKT  KKK        NNT K KK T    DKT.   T K KK        TT KKNN  D  T    N
   292   74 H S  T 345S+     0   0  105  233   44  SSSN  PSS        SNS S SS S    SSS.   A S SS        SS SDSA  S  S    P
   293   75 H L  T <45S-     0   0  103  234   70  SSSK  SSS        RRK T SS K    KSSS   R S SS        KV SSNK  S  G    N
   294   76 H N  T  <5 +     0   0   29  234   47  STSG  SSS        KAN N TS N    SNSG   N S NT        NS SGSN  S  S    N
   295   77 H K  E   < -BC 239 290A  51  234   64  TTTE  TIT        QQM T TT M    GTSA   E T TT        MT TALT  K  T    L
   296   78 H F  E     -BC 238 289A   1  234   61  AAAV  VAA        VLV A AA L    VAAV   A A AV        VG AVVL  L  A    L
   297   79 H F  E     -BC 237 288A  50  234   27  YYYY  YYY        YNY Y YY Y    YFYY   Y F YY        YF YFNY  Y  Q    H
   298   80 H I  E     -BC 236 287A   4  234    5  MMML  MMM        LLL M MM L    LMML   L M MM        LL MLLL  L  L    L
   299   81 H Q  E     -BC 235 286A  73  234   36  QEQK  HQF        QQE E QE E    QYLQ   E Q HD        EQ EQQQ  Q  R    Q
   300   82 H L  E     -BC 234 285A   3  234   23  LLLL  LLL        MMI L LL V    MLLL   F L LL        II LVMM  M  I    L
   301   82AH I        +     0   0   70  234   62  SRST  RNS        NNK T TA K    NNST   R S SS        KN RTND  N  S    T
   302   82BH S  S    S-     0   0   59  234   35  SSSG  SNS        SSS S SR S    NNSS   G S SR        SG SSSS  S  K    G
   303   82CH V        -     0   0    0  234   13  LLPM  LLL        LLL L LL L    LLLL   M L LL        LL LLLL  L  L    L
   304   83 H T    >   -     0   0   65  234   62  ATTK  TTT        RKK R TT K    RTTR   T T TT        KK TRKR  K  S    K
   305   84 H N  G >  S+     0   0  120  234   65  SSSP  SSS        ATA A SS S    PSSV   A P SS        AS SVTA  T  S    P
   306   85 H E  G 3  S+     0   0  160  234   25  EDEV  EDE        EEE E EE E    EEED   E E EE        EE DDEE  E  S    E
   307   86 H D  G <  S+     0   0    0  234    1  DDDE  DDD        DDD D DD D    DDDD   D D ND        DD DDDD  D  D    D
   308   87 H T    <   +     0   0   30  234   32  SSST  SSS        SST T SS T    MSST   T T SS        TT STTT  T  T    T
   309   88 H A  E    S- H   0 333C   3  234    4  AAAA  AAA        AAA A AA A    GAAA   A A AA        AG AAAA  A  A    A
   310   89 H M  E     -EH 257 332C  43  234   58  VVVV  VVV        VVV I VI V    IFVI   M V VV        VV VILV  V  T    R
   311   90 H Y  E     -EH 256 331C   2  234    0  YYYY  YYY        YYY Y YY Y    YYYY   Y Y YY        YY YYYY  Y  Y    Y
   312   91 H Y  E     -E  255   0C   1  234    3  YYYY  YYF        YYY Y HY Y    YYFY   Y Y FF        YF YYYY  Y  Y    Y
   313   92 H c  E     +E  254   0C   0  234    1  CCCC  CCC        CCW C CC C    CCCC   C C CC        CC CCCC  C  C    C
   314   93 H S  E     -EI 253 327C   0  234   30  AAAA  TAT        AAT A SA A    TAAA   A A AA        AA AAAA  A  T    A
   315   94 H R  E     -EI 252 326C  20  233   44  RRRT  RRR        RRS S IR R    VRRR   K N RR        KR RRRK  R  R    R
   316   95 H E  E     -EI 251 324C   0  233   77  TGWD  RGG        DCH D RG T    EEGP   D N SH        TD TPDD  H  G    H
   317   96 H N  E  >> -E  250   0C   6  233   90  FDRG  GPG        LFC P GE A    GWPQ   T Y KE        DI EPTT  N  Y    T
   318   97 H H  T  45S+     0   0    0  233   93  YLDG  LVG        STD V NA Y    MYRY   V S LD        YG TYYQ  T  G    Q
   319   98 H M  T  45S+     0   0   73  234   93  FRYG  FYW        RGY R WY Y    DGDM   H S GR        YA YVYQ  L  G    Y
   320   99 H Y  T  45S+     0   0  159  234   92  DTNG  YYA        SVY T EG F    YASD   C Y GG        FL YASG  C  G    G
   321  100 H E  T  <5 -     0   0   54  234   90  SGnL  ssF        dkF v GG D    WWSV   D W Fn        Dy sgyL  Y  D    C
   322  100AH T      < +     0   0    0  139   91  ..w.  yd.        wf. f .. .    ....   . . .a        .l gphS  .  .    .
   323  100BH Y  S    S-     0   0   10  161   90  .LYY  SR.        AK. Y .. .    ...E   Y . .W        .L GRFT  C  .    .
   324  100CH F  E     +I  316   0C   0  185   48  .FFF  MG.        FF. L FF .    .FGL   F F .F        .F FLQL  F  F    .
   325  101 H D  E     +     0   0C  42  205   40  .DDD  DDD        DDD D GS .    .AYA   D A AV        .E AADP  G  D    .
   326  102 H V  E     -I  315   0C  35  212   66  .YVY  YYY        YVY H YY Y    .FYY   Y Y YY        YY YYQF  G  Y    .
   327  103 H W  E     -I  314   0C  28  221    8  WWWW  WWW        WWW W WW W    .WWW   W W WW        WW WWWW  S  W    W
   328  104 H G        -     0   0    3  229    7  GGGG  GGG        GGG G GG G    GGGG   G G GG        GG GGpG  G  G    G
   329  105 H Q        -     0   0  100  223   52  QQAQ  QQQ        KNK Q QQ K    RQQS   P Q QQ        KQ RSpQ  S  Q    Q
   330  106 H G        -     0   0    3  228    7  GGGG  GGG        GGG G GG G    GGGG   G G GG        GG GGAG  L  G    G
   331  107 H T  E     -H  311   0C  27  233   39  TTTT  TTT        TTT T TT T    ITTT   T T TT        TT TTTA  L  T    P
   332  108 H T  E     -H  310   0C  48  234   79  TTTM  SLT        TKK L LL K    SLTF   M L LL        KL LFYL  L  M    L
   333  109 H V  E     -H  309   0C   0  234   19  LLVV  VVL        VVV V VV V    VVLL   V V VV        VV VLAV  L  V    P
   334  110 H T  E     -d  227   0B  16  234   41  TTTT  TTT        TTT T TT T    TTTE   T T TT        TT TELT  L  T    S
   335  111 H V  E     +d  228   0B   2  234    9  VVVV  VVV        VVV V VV V    VVVV   V V VV        VV VVKV  A  V    A
   336  112 H S        -     0   0   18  234   31  SSST  SSS        SSS S SS S    SSST   T S SS        SS STIS  A  T    A
   337  113 H S  S    S+     0   0   99  234   19  SSSS  SAS        SSS S AA S    SASS   S S AA        SS ASGS  G  S    A
   338  114 H A  S    S-     0   0   31  234   51  EEEA  EEE        dGa V EE a    EEED   A E EE        aV EVgg  S  A    g
   339  115 H K        -     0   0  143  234   66  PPPT  PPP        pSp D PP p    SSPV   V S SP        pD SArp  S  T    p
   340  116 H T        -     0   0   44  234   72  AAAS  AAA        TTS P AA S    AAAQ   T Q AA        SP AQAS  G  S    A
   341  117 H T  B     -J  370   0D  35  234   73  RRRK  RRR        QKA N RR A    RRRV   S S RR        AN RSRV  V  K    A
   342  118 H P        -     0   0   60  234   66  EEES  EEE        ASP S EE P    NNEK   P S NE        PS NAAS  Q  S    G
   343  119 H P        -     0   0   13  234   17  PPPP  PPP        PPQ L PP Q    PPPP   P P PP        QL PPES  C  P    G
   344  120 H S  E     -K  367   0E  51  234   57  TTTS  TTT        NTS R TT S    TTTS   S T TT        SR TSIP  E  S    K
   345  121 H V  E     -K  366   0E   6  234   25  IIIL  III        VLV S II V    IIIV   L V II        VS IVTN  Q  L    V
   346  122 H Y  E     -K  365   0E  27  234   14  YYYF  YYY        FFF F YY F    YYYY   F F YY        FF YYLA  L  F    Q
   347  123 H P  E     -K  364   0E  15  234   27  PPPP  PPP        PPG P PP G    PPPV   P P PP        GP PITP  T  P    L
   348  124 H L  E     +K  363   0E   4  234   22  LLLL  LLL        LLL L LL L    LLLS   L L LL        LL LSQL  Q  L    V
   349  125 H A        -     0   0   10  234   68  TTTI  TTT        MVS S TT S    TTTS   I V TT        SS TNKD  P  I    E
   350  126 H P        -     0   0   24  234   77  FFFS  FFF        PQQ L FF Q    LLFT   S S LF        QL LPPT  A  S    S
   351  127 H G  S    S-     0   0   16  234   65  PPPC  PPP        CCC Q PP C    PPPS   C C PP        CQ PSTN  Y  C    G
   352  128 H S  S    S+     0   0   99  234   67  QQQG  QQQ        GNS S QQ S    PPQC   G E PQ        SS RCEE  V  G    G
   353  129 H A        +     0   0   52  234   79  AAAE  AAA        PPS T AA S    AAAd   E s AA        ST AdIV  T  E    d
   354  130 H A        +     0   0   70  145   76  ....  ...        .D. . .. .    ...s   . l ..        .. .nI.  K  .    k
   355  133 H Q        +     0   0  178  219   82  LLL.  LLL        QRG D LL G    LLLS   . S LL        GD LSK.  Q  .    K
   356  134 H T    >   -     0   0   64  231   47  SSSS  SSS        SSS S SS S    SSSN   S D SS        SS SNP.  P  S    P
   357  135 H N  T 3  S-     0   0  146  232   60  SSSM  SSS        RAD D SS D    SSSQ   M E SS        DD SQG.  G  M    G
   358  136 H S  T 3  S+     0   0   63  232   58  DDDD  DDD        DSG G DD G    DDDD   D N DD        GG DDA.  Q  D    D
   359  137 H M  E <   - L   0 408E  83  232   79  PPPP  PPP        TQS H PP S    PPPE   P L PP        SH PES.  R  P    S
   360  138 H V  E     - L   0 407E  15  233   38  VVVV  VVV        VII V VV I    VVVI   V V VV        IV VIV.  L  V    L
   361  139 H T  E     + L   0 406E  15  234   68  IIIT  III        TAT V II T    IIIS   T A II        TV ISVA  S  T    R
   362  140 H L  E     + L   0 405E   0  234   26  IIII  III        LVL I II L    IIIL   L M II        LI ILLV  I  I    L
   363  141 H G  E     -KL 348 404E   0  234   28  GGGG  GGG        GGG G GG G    GGGL   G G GG        GG GVEV  T  G    S
   364  142 H e  E     -KL 347 403E   1  234    1  CCCC  CCC        CCC C CC C    CCCC   C C CC        CC CCCC  C  C    C
   365  143 H L  E     -KL 346 402E   2  234   12  LLLL  LLL        LLL M LL L    LLLL   L L LL        LM LLTL  Q  L    K
   366  144 H V  E     -KL 345 401E   1  234   46  IIIA  III        AAA V II A    IIIV   A A II        AV IVVA  V  A    A
   367  145 H K  E     -KL 344 400E  38  231   68  HHHK  HHH        VLK Q HH K    HHHK   K R HH        KQ HKSQ  .  K    S
   368  146 H G  E    S+     0   0E  19  234   40  DDDD  DDD        DDG D DD G    DDDD   G D DD        GD DDGD  S  D    G
   369  147 H Y  E     - L   0 399E   0  234    5  YYYF  YYY        FFF F YY F    YYYF   F F YY        FF YFYF  Y  F    F
   370  148 H F  B     +J  341   0D   3  234   40  FFFL  FFF        TFS F FF S    FFFQ   L L FF        SF FHNL  S  L    T
   371  149 H P  S    S-     0   0    0  234   15  pppP  ppp        PPp p pp p    pppP   P P pp        pp lPIP  V  P    F
   372  150 H E  S    S+     0   0   53  231   47  gggE  ggg        SEd e gg d    gggR   D S gg        de gRND  G  E    S
   373  151 H P        +     0   0   59  232   52  TTTT  TTT        SSS S TT S    TTTN   S S TT        SS TSDS  S  T    S
   374  152 H V        -     0   0   20  233   39  MMMI  MMM        LLL V MM L    MMMI   I I MM        LV MIHI  Y  I    N
   375  153 H T  E     +N  422   0F  83  234   67  NNNS  NNN        TTN N NN N    NNNQ   S S NN        NN NRHT  F  S    W
   376  154 H V  E     +N  421   0F  23  234   44  VVVF  VVV        FYF V VV F    VVVQ   F F VV        FV VQLF  T  F    M
   377  156 H T  E     -N  420   0F  48  234   51  TTTT  TTT        SQK T TT K    TTTT   S S TT        KT TTSS  A  T    S
   378  157 H W  E > >S-NO 419 383F   2  234    0  WWWW  WWW        WWW W WW W    WWWW   W W WW        WW WWWW  W  W    W
   379  162 H N  G > 5S-     0   0   38  234   61  GGGg  GGG        TSk D GG k    GGGF   e n GG        kd GSIk  I  g    V
   380  163 H S  G 3 5S-     0   0   91  234   63  KKKk  KKK        QNp H KK p    KKKS   k q KK        pk KSRk  K  k    R
   381  164 H G  G < 5S+     0   0   39  234   50  SSSN  SSS        GQA K SS A    SSSD   S N SS        AG SEQN  Q  N    Q
   382  165 H S  T < 5 +     0   0   93  234   53  GGGn  GGG        sGg G GG g    GGGn   n n GG        gK GsAn  P  n    A
   383  166 H L  B   < +O  378   0F  43  228   74  KKKy  KKK        l.l K KK d    KKKi   i v KK        l. KiPi  A  y    P
   384  167 H S        +     0   0   88  231   64  DDDS  DDD        E.S G DD L    DDDT   S M DD        SG DTGS  G  S    G
   385  168 H S  S    S+     0   0  101  231   73  IIIT  III        NSD T II S    IIIT   N Q II        DT ITNK  K  T    K
   386  169 H G  S    S+     0   0   32  226   40  TTTG  TTT        .Q. S TT D    TTTG   G G TT        .S TGGG  G  G    G
   387  171 H V        +     0   0   48  232   57  TTTL  TTT        ISF V TT F    TTTF   V V TT        FV TILV  L  L    L
   388  172 H H  E     -M  404   0E  17  233   79  VVVK  VVV        TEV M VV V    VVVN   K R VV        VM VSVW  E  K    E
   389  173 H T  E     -M  403   0E  69  233   67  NNNS  NNN        QQQ N NN Q    NNNR   S T NN        QN NKWG  W  S    W
   390  174 H F  E     -M  402   0E   1  233   11  FFFY  FFF        YYY F FF Y    FFFY   Y F FF        YF FYIF  I  Y    I
   391  175 H P  E     -     0   0E  65  232   17  PPPK  PPP        PPP P PP P    PPPP   R P PP        PP PPVP  G  K    G
   392  176 H A  E     -     0   0E  19  233   53  PPPP  PPP        SVA P PP A    PPPA   P T PP        AP PAAS  S  P    E
   393  177 H V  E     -M  400   0E  42  233   54  AAAV  AAA        IIF V AA F    AAAI   V L AA        FV AVFV  K  V    I
   394  178 H L  E     -M  399   0E  77  233   51  LLLM  LLL        LAG H LL G    LLLL   M R LL        GH LQRL  Y  M    H
   395  179 H Q  S    S-     0   0   83  233   65  AAAQ  AAA        KKK V AA K    AAAG   Q T AA        KV AGSR  T  Q    P
   396  180 H S  S    S-     0   0  116  233   55  ssss  sss        NDE a ss E    sssq   a G ss        Ea snGG  g  s    S
   397  183 H D  S    S+     0   0   90  226   21  gggg  ggg        DGG g gg G    gggm   g D gg        Gg gk.G  s  g    .
   398  184 H L        -     0   0   53  224   74  RRRT  RRR        KSD L RR D    RRRT   T K RR        DL GK.K  Y  T    .
   399  185 H Y  E     -LM 369 394E  36  230    2  YYYY  YYY        YFY Y YY Y    YYYY   Y Y YY        YY YYYY  Y  Y    .
   400  186 H T  E     +LM 367 393E   5  228   48  TTTS  TTT        LST T TT T    TTTT   S T TT        TT TTTA     S    .
   401  187 H L  E     -L  366   0E  11  225   53  MMMA  MMM        GRK M MM K    MMMM   A A MM        KM MM A     A    .
   402  188 H S  E     -LM 365 390E   5  225   25  SSSS  SSS        IVI S SS I    SSSS   S T SS        IS SS T     S    S
   403  189 H S  E     -LM 364 389E   2  225    1  SSSS  SSS        SSS S SS S    SSSS   S S SS        SS SS S     S    S
   404  190 H S  E     -LM 363 388E   0  225   78  QQQQ  QQQ        QLH Q QQ H    QQQV   Q Q QQ        HQ QV Q     Q    S
   405  191 H V  E     -L  362   0E   0  225   27  LLLV  LLL        VII L LL I    LLLL   I V LL        IL LL V     V    I
   406  192 H T  E     +L  361   0E  48  225   41  TTTN  TTT        ERR T TT R    TTTS   N L TT        RT TK L     N    N
   407  193 H V  E     -L  360   0E  14  224   29  LLLV  LLL        FVV L LL V    LLLV   I L LL        VL LV L     V     
   408  194 H P  E  >  -L  359   0E  56  223   43  PPPA  PPP        YSK P PP R    PPPS   T S PP        KP PS A     A     
   409  195 H S  T  4 S+     0   0   49  222   51  AAAS  AAA        SKK A AA K    AAAA   L A AA        KA AA S     S     
   410  196 H S  T  4 S+     0   0   66  222   64  VVVA  VVV        KTS D VV S    VVVS   E K VV        SD VA K     A     
   411  198 H P  T  > S+     0   0   31  222   70  EEEV  EEE        dDD Q EE D    EEED   Q n EE        DQ ED d     V     
   412  199 H R  T  < S+     0   0   16  222   99  CCCW  CCC        kWW C CC W    CCCW   W e CC        WC CW q     W     
   413  200 H P  T  4 S+     0   0   80  223   71  PPPD  PPP        KDI P PP D    PPPN   E G PP        IP PK G     D     
   414  202 H S  T  4 S+     0   0  111  221   68  EEEN  EEE        VAD A EE A    EEEA   S S EE        DA ET T     N     
   415  203 H E  S  < S-     0   0  128  221   75  GGGI  GGG        KGT K GG K    GGGN   T D GG        TK GN D     I     
   416  204 H T        -     0   0   83  221   71  eeee  eee        kkk g ee k    eeek   t e ee        kg er e     e     
   417  205 H V        +     0   0    4  217   60  vvvf  vvv        ryy q vv y    vvvy   l l vv        yq vy v     f     
   418  206 H T  E     - P   0 433F  23  217   76  KKKY  KKK        INT K KK T    KKKH   S V KK        TK KQ V     Y     
   419  208 H e  E     -NP 378 432F   0  220    1  CCCC  CCC        CCC C CC C    CCCC   C C CC        CC CC C     C     
   420  209 H N  E     -NP 377 431F   4  220   59  SSSN  SSS        ESE H SS E    SSSK   V K SS        EH SQ K     N     
   421  210 H V  E     -NP 376 430F   1  220   24  VVVA  VVV        VVA V VV A    VVVA   A I VV        AV VA V     A     
   422  211 H A  E     -NP 375 429F  14  220   74  QQQK  QQQ        QSS Q QQ S    QQQG   T H QQ        SQ QG Q     K     
   423  212 H H  E > > - P   0 428F   1  220   17  HHHH  HHH        GHN H HH N    HHHY   K H HH        NH HY H     H     
   424  213 H P  G > 5S+     0   0   77  209   81  DDDL  DDD        PKS N DD S    DDDK   Y G DD        SN DN P     L     
   425  214 H A  G 3 5S+     0   0   40  203   65  SSSD  SSS        GGV S SS V    SSSA   C N SS        VS S  N     D     
   426  215 H S  G < 5S-     0   0   32  202   63  NNNT  NNN         QG S NN G    NNNN   T K NN        GS N  G     T     
   427  216 H S  T < 5 +     0   0  111  199   72  PPPI  PPP         SA P PP A    PPPE   S N PP        AP A  N     I     
   428  217 H T  E   < +P  423   0F  35  196   63  VVVK  VVV         KP S VV P    VVV    T K VV        PS V  K     K     
   429  218 H K  E     +P  422   0F 135  196   50  QQQS  QQQ         HK Q QQ K    QQQ    D D QQ        KQ Q  E     S     
   430  219 H V  E     -P  421   0F  38  140   32     V              VT      T           T L           T     Q     V     
   431  220 H D  E     -P  420   0F  97  140   36     E              TA      A           E H           A     N     E     
   432  221 H K  E     -P  419   0F  51  127   45     L              L                   K V                 V     L     
   433  222 H K  E     -P  418   0F 121  127   48     K              K                   T P                 P     K     
   434  223 H I        -     0   0    4  123   30     K                                  I I                 L     K     
   435  224 H V        -     0   0   79  112   59     D                                    P                       D     
   436  225 H P              0   0   73  103   61     P                                    A                       P     
   437  226 H R              0   0  167   89   21                                                                        
## ALIGNMENTS  421 -  465
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1    1 L D              0   0  100   77   31    D                                          
     2    2 L I        -     0   0    0   88   32    V       III                 IIII   I       
     3    3 L V        -     0   0   88   98   48    V     V VVV  V    V         VVVV  VV  V VVV
     4    4 L M  E     -Q   25   0G  12  101   21    M     LMLLL  LM   V         LLLL  LL  L VVV
     5    5 L T  E     -Q   24   0G  80  101   14    T     NLTTT  TL   T         TTTT  TT  T TTT
     6    6 L Q  E     -Q   23   0G  19  101    5    Q     QDQQQ  QN   Q         QQQQ  QQ  Q QQQ
     7    7 L S  E    S+Q   22   0G  57  101   57    T     TQTTT  KQ   K         TTTT  KT  K KKK
     8    8 L P        -     0   0   47  148    6    P     PPPPPP PP   P         PPPP  PP  P PPP
     9    9 L A  S    S-     0   0   79  156   68    P     IPAAAV PP   P         AAAA  PA  P PPP
    10   10 L S  E     -t  107   0H  78  168   57    S     SSVVVS GF   V         VVVV  VV  V VVV
    11   11 L L  E     -t  108   0H  34  204   48    LVV   DVHHHQ LV   V         HHHH  LH  L VVV
    12   12 L V  E     +t  109   0H  86  214   38  T PSS   PSSPSS SS   T         SSSS  SI  T TTT
    13   13 L V  E     -t  110   0H  17  216   57  VVIVV   VSVVVV VS   L         VVVV  VV  V LLL
    14   14 L S  E >   -t  111   0H  46  224   63  SSILL   SPPPPN RP   R         PPPP  SS  R RRR
    15   15 L L  T 3  S+     0   0   79  225   67  PPPPP   ALTTTL KL   K         TTTT  KP  K KKK
    16   16 L G  T 3  S+     0   0   39  233    6  GGGGG   GGGGGG GG   G         GGGG  GG  G GGG
    17   17 L Q    <   -     0   0   97  233   51  GGEGG   ETQQQE ET   E         QQQQ  DQ  E EEE
    18   18 L R        -     0   0  152  233   63  TTTSS   TTEEET TT   T         EEEE  TE  T TTT
    19   19 L A  E     - R   0  79G   2  233   43  VVVVV   SVVVVV AI   A         VVVV  AV  A AAA
    20   20 L T  E     - R   0  78G  66  233   58  TTSGG   ERVVVK TR   T         VVVV  TV  T TTT
    21   21 L I  E     - R   0  77G   0  233   23  LLILL   LLLLLI ML   M         LLLL  ML  M MMM
    22   22 L S  E     -QR   7  76G  36  233   53  TTSSS   KANNNS DA   D         NNNN  DN  D DDD
    23   23 L a  E     -QR   6  75G   0  233    0  CCCCC   CCCCCC CC   C         CCYC  CC  C CCC
    24   24 L R  E     -QR   5  74G 153  233   76  GGKSS   ATNNNK NT   N         NNNN  NN  N NNN
    25   25 L A  E     -Q    4   0G   6  233   70  HHSWL   MLIIIL LL   L         IIII  LI  L LLL
    26   26 L S  S    S+     0   0   63  233   52  NNSTT   QSQQQS GS   G         QQQQ  GE  G GGG
    27   27 L E  S    S-     0   0  105  233   74  TTQGG   NRRRRG TR   T         RRRR  TR  T TTT
    28   27AL S        -     0   0   29  233   75  GGsGG   GDYDYF VD   V         YYYY  VY  V GVV
    29   27BL V        +     0   0    0   70   75  AAlSS   KH.... TY   T         ....  ..  V TTT
    30   27CL D  E     +Z   35   0I  45   97   81  ..H..   MdDDd. .d   G         DdDD  ND  N NNd
    31   27DL S  E >  S+Z   34   0I  15  133   82  VVSVV   .i..sS .i   .         .s..  ..  . PSr
    32   28 L Y  T 3  S-     0   0  173  140   87  TTNTT   .Y..VI .Y   S         .V..  I.  T AAA
    33   29 L G  T 3  S+     0   0   81  224   59  SSGGG   GSGGSS GN   G         GSG.  SG  V VAA
    34   30 L K  E <  S-Z   31   0I 112  182   77  EDNGD   S....D ..   .         ...S  ..  . ...
    35   31 L S  E     -Z   30   0I   7  205   76  HHTNN   Y.NH.R S.   .         N.NN  .N  . ...
    36   32 L F        +     0   0    5  218   67  YYYYY   Y.YY.T Y.   .         S.YY  NY  . ...
    37   33 L M  E     -U   94   0H   0  225   52  PPLPP   MIVV.V CI   V         V.VV  AV  . ...
    38   34 L H  E     -U   93   0H   0  229   82  SSHAN   SYHS.Y RY   R         S.SS  RS  Y .R.
    39   35 L W  E     -UV  92  52H   0  233    0  WWWWW   WWWWWW WW   W         WWWW  WW  W WWW
    40   36 L Y  E     -UV  91  50H   0  233   14  FFLVI   YYYYYL YY   Y         YYYY  YY  Y YYY
    41   37 L Q  E     -UV  90  49H   4  233   29  QQQYH   RQKKKQ KQ   K         KKKK  KK  K KKK
    42   38 L Q  E     -U   89   0H  16  233   12  QQQQQ   QQQQQQ QQ   Q         QQQQ  QQ  Q QQQ
    43   39 L K    >   -     0   0   47  233   62  KKKTT   RRVVVK IR   I         VVVV  IV  I III
    44   40 L P  T 3  S+     0   0   81  233   36  SSPTT   PPPPPA PP   P         PPPP  PP  P PPP
    45   41 L G  T 3  S+     0   0   58  232   13  GGGGG   GGGGGG GG   G         GGGG  GG  G GGG
    46   42 L Q  S <  S-     0   0  103  233   69  RRQSS   EHEEEN GH   G         EEEE  GT  G GGG
    47   43 L P        -     0   0   34  233   59  AAGII   APAAAP VP   V         AAAA  SV  V VVV
    48   44 L P        -     0   0    5  233   10  PPPPP   PPPPPP PP   P         PPPP  PP  P PPP
    49   45 L K  E     -V   41   0H  96  233   63  TTQKk   VRqqqr qR   q         qqqq  qq  q qqq
    50   46 L V  E     +V   40   0H  10  233   45  TTGLv   WFvvvl vF   v         vvvv  vv  v vvv
    51   47 L L  E     +     0   0H   2  233   23  LLLVV   VLLLLL LL   L         LLLL  LL  L LLL
    52   48 L I  E     -VW  39  58H   0  233   35  IIIig   llsrrN yl   Y         RgSr  rR  y rrr
    53   49 L Y  E  >  + W   0  57H  54  232   23  YYYsw   hydyhY yy   F         FhFh  yF  y yyy
    54   50 L I  T >4 S-     0   0   10  233   88  DDDsg   sfhhhy hf   i         lhdh  hh  h hhh
    55   51 L A  T 34 S+     0   0    2  233   75  IIVnq   ssasas sd   s         nina  ss  s tss
    56   52 L S  T 34 S+     0   0   73  233   63  DDSQN   IDPpLK PH   s         aLaL  Ps  P sPP
    57   53 L N  E <<  -W   53   0H  77  233   74  KKNNY   YKVsVN TS   n         eDdE  Ts  S sTK
    58   54 L L  E     -W   52   0H  63  233   66  KKRYR   RRFRFQ YQ   Y         FFFF  YF  Y YYY
    59   55 L E    >   -     0   0   49  233   81  SSDRP   GQGGGG GG   G         GGGG  GG  G GGG
    60   56 L S  T 3  S+     0   0  107  233   40  GGSPS   TGSSSV SF   S         SSSS  ST  S SSS
    61   57 L G  T 3  S+     0   0   67  233   21  WWGsW   GpgggG gK   g         gggg  gg  g ggg
    62   58 L V    <   -     0   0   17  233   47  TTVtT   FvsssV sI   s         ssss  ss  s sss
    63   59 L P    >   -     0   0   62  233   27  PPPSP   TPSSSP SP   S         SSSS  AS  S SSS
    64   60 L A  T 3  S+     0   0   99  233   58  AADEE   DPDDDD PP   P         DDDD  PD  P SPP
    65   61 L R  T 3  S+     0   0   30  233    8  RRRRR   RRRRRR KR   K         RRRR  KR  K KKK
    66   62 L F  E <   -S   79   0G   7  233    1  FFFFF   FFFFFF FF   F         FFFF  FF  F FFF
    67   63 L S  E     -S   78   0G  59  233   24  SSSTT   KSNNNS TS   T         NNNN  TN  T TTT
    68   64 L G  E     +S   77   0G  17  233   11  GGGGG   pgsssg sg   s         ssss  ss  s sss
    69   65 L S  E     +S   76   0G  48  233   40  SSSAA   ddsssk hd   h         ssss  hs  h hhh
    70   66 L G  E     -S   75   0G  35  233   77  IIGII   TVSSSD QV   Q         SSSS  QS  Q QQQ
    71   67 L S  E >   +S   74   0G  68  232   24  VVSTT   SASSSI SA   S         SSSS  SS  S SSS
    72   68 L R  T 3  S-     0   0  163  232   35  GGGGG   SEDDSP TK   T         SDSS  TN  T TTT
    73   69 L T  T 3  S+     0   0   51  232   58  GGTGG   NNTTTN TN   S         TTTT  TI  T TSS
    74   70 L D  E <   +RS  24  71G  77  232   64  KKDKK   STEEEN DT   D         EEEE  DD  D DDD
    75   71 L F  E     -RS  23  70G   0  232   81  GGFAA   HGYYYV YG   Y         YYYY  YY  Y YYY
    76   72 L T  E     -RS  22  69G  33  232   61  AATVV   IYQQQG RY   R         QQQQ  RQ  R RRR
    77   73 L L  E     -RS  21  68G   0  232    4  LLLLL   LLFFFY LL   L         FFFF  LF  L LLL
    78   74 L T  E     -RS  20  67G  28  232   48  TTKSS   TSIIIL IS   I         IIMI  II  I III
    79   75 L I  E     -RS  19  66G   0  232    4  LLIII   IIIIIT II   I         IIII  II  I III
    80   76 L D  S    S+     0   0   68  232   42  SSSSS   GSKKKI SS   N         KKKK  KK  N NNN
    81   77 L P  S    S-     0   0   51  232   61  GGRRR   SGRRRK NG   N         RRRR  NR  N NNN
    82   78 L V        +     0   0    0  232   50  AAVAA   LLLSSV VL   V         SSSS  VA  V VVV
    83   79 L E    >   -     0   0   93  232   36  QQEQQ   EQEEEL EQ   E         EEEE  EE  E EEE
    84   80 L A  G >  S+     0   0   22  232   55  PPPAA   PPTTTL EP   E         TTTT  ET  E EEE
    85   81 L D  G 3  S+     0   0   58  232   28  EEEEE   GEGGGE GE   G         GAGG  GG  Q EGG
    86   82 L D  G <   +     0   0    1  232    0  DDDDD   DDDDDD DD   D         DDDD  DD  D DDD
    87   83 L A    <   +     0   0   12  232   78  EEVDD   SEYSSD SE   S         SSSS  SS  S SSS
    88   84 L A  E    S- X   0 108H   8  232   20  AAGGG   AAAAAA AA   A         AAAA  AT  A AAA
    89   85 L T  E     -UX  42 107H  35  233   69  DEITV   VMQQQD VM   V         QQQQ  VV  V VVV
    90   86 L Y  E     -UX  41 106H   0  233    4  YYYYY   YYYYYY YY   Y         YYYY  YY  Y YYY
    91   87 L Y  E     -U   40   0H   9  233    6  YYFYY   YYYYYY YY   Y         YYYY  YY  Y YYY
    92   88 L a  E     -U   39   0H   0  233    4  CCCCC   CCCCCC CC   C         CCCC  CC  C CCC
    93   89 L Q  E     -UY  38 102H   1  233   79  WWVAV   AAQQQV KS   N         QQQQ  KQ  K KQE
    94   90 L Q  E     +UY  37 101H   0  233   84  lvqLL   AvTTTI Tl   T         TTTT  TT  t TTT
    95   91 L N        +     0   0    0  206   57  yylWW   W.WWW. Wf   W         WWWW  HW  . WW.
    96   92 L N  S    S+     0   0    1  213   78  ssptt   d.ddd. dq   d         dddd  dd  . dde
    97   93 L E  S    S-     0   0   48  212   78  ..aaa   tsaee. ss   e         esee  ea  a sns
    98   94 L D  S    S+     0   0   42  216   73  ..iFL   FlLVI. VL   Y         VVVV  YV  V vVv
    99   95 L P  S    S-     0   0   26  119   74  aag..   .g..T. A.   .         .T..  ..  . k.e
   100   96 L P        -     0   0    4  155   90  RRP..   .TW.V. VH   .         .V..  .S  . Y.H
   101   97 L T  E     -Y   94   0H  26  200   64  VVVII   TAVVV. VT   V         VV..  VH  . V.V
   102   98 L F  E     -Y   93   0H  26  231   16  FFSFF   FLFFFF FY   F         FFFF  ST  F FFF
   103   99 L G        -     0   0    3  233   17  GGCGG   GGGGGG GT   G         GGGG  QS  G GGG
   104  100 L A        -     0   0   81  233   63  GGSGG   PGQQQG QE   Q         QQQQ  QA  P QQQ
   105  101 L G        -     0   0   12  233   14  GGSGG   GGGGGG GG   G         GGGG  GF  G GGG
   106  102 L T  E     - X   0  90H   0  233   14  TTITT   TPTTTT TT   T         TTTT  TL  T TTT
   107  103 L K  E     -tX  10  89H  74  233   53  QQSQQ   AAKKKQ KQ   K         KKKK  KT  K KKK
   108  104 L L  E     +tX  11  88H   2  232   22  LLLLL   LLLLLL LL   L         LLLL  LL  L LLL
   109  105 L E  E     -t   12   0H  14  233   69  TTETT   SNITIT IT   I         IIII  IV  F III
   110  106 L M  E     -t   13   0H   0  233   29  VVSVV   LVVVVV VV   V         VVVV  VF  V VVV
   111  107 L R  E     +t   14   0H 126  233   86  LLKLI   RLTTTR TL   T         TTTT  TS  T TTT
   112  108 L R        -     0   0   64  233   79  SGAtt   sGSSSt GG   S         SSSS  SG  G SSS
   113  109 L A        -     0   0   71  221   67  QQEdd   eQSSSd SQ   S         SSSS  SS  S SSS
   114  110 L D        -     0   0   58  226   72  ppGVV   DpsssS sp   s         ssss  ss  s sss
   115  111 L A  B     -A  144   0J  19  225   58  ss.KK   RsrrrK ps   p         rrrr  pp  p ppp
   116  112 L A        -     0   0   40  229   62  AA.AA   KAPPPE PA   S         PPPP  PP  P PPP
   117  113 L P        -     0   0    9  229    4  PP.PP   PPPPPP PP   P         PPPP  PP  P PPP
   118  114 L T  E     -B  141   0K  85  232   60  TTQSS   SSVVVL VL   V         VVVV  VV  V VVV
   119  115 L V  E     -B  140   0K   8  233   26  VVSVV   VVLLLV LV   L         LLLL  LL  L LLL
   120  116 L S  E     -B  139   0K  17  233   67  TTGSS   LTTTTS TM   T         TTTT  TT  T TTT
   121  117 L I  E     -B  138   0K  22  233   31  LLLII   LLVVVI VL   V         VVVV  VV  V VVV
   122  118 L F  E     -B  137   0K   4  233    7  FFIFF   LFFFFF FF   F         FFFF  FF  F FFF
   123  119 L P        -     0   0    5  233   25  PPRAA   PPPPPP PL   P         PPPP  PP  P PPP
   124  120 L P        -     0   0    1  233    9  PPRPP   PPPPPP PP   P         PPPP  PP  P PPP
   125  121 L S    >>  -     0   0    8  233   10  SSDSS   SSSSSS SF   S         SSSS  SS  S SSS
   126  122 L S  H 3> S+     0   0   78  233   64  TTREE   SASSSQ SS   S         SSSS  SS  K SSS
   127  123 L E  H 3> S+     0   0   76  233   30  EELEE   EEAAAE AE   A         AAAA  AA  A AAA
   128  124 L Q  H <4>S+     0   0    8  233   30  EECEE   EEEEEE EE   Q         EEEE  EE  E EEE
   129  125 L L  H ><5S+     0   0   29  233   22  LLLII   ILLLLI LL   L         LLLL  LL  L LLL
   130  126 L T  H 3<5S+     0   0  111  233   69  SSTAA   DHQQQT QR   Q         QQQQ  QQ  Q QQQ
   131  127 L S  T 3<5S-     0   0   83  233   68  NNITT   STSSSS SA   S         SSSS  AS  S SSS
   132  128 L G  T < 5S+     0   0   34  233   54  NNSKK   GNNNNK NN   N         NNNN  NN  N NNN
   133  129 L G  E   < - C   0 186K  21  216   60  KK.KK   WK.... TK   K         ....  .T  K KKK
   134  130 L A  E     - C   0 185K   0  225   19  AA.AA   AAKKK. AA   A         KKKK  TA  A AAA
   135  131 L S  E     - C   0 184K   2  226   39  TTSTT   TTAAA. SI   S         AAAA  AS  T SSS
   136  132 L V  E     - C   0 183K   0  226   35  LLLVV   LLSSS. LL   L         SSSS  SL  L LLL
   137  133 L V  E     -BC 122 182K   0  226   15  VVLVV   SVLLL. VV   I         LLLL  LV  L VVV
   138  134 L b  E     -BC 121 181K   0  227    9  CCVCC   CCVVV. CC   C         VVVV  VC  C CCC
   139  135 L F  E     -BC 120 180K   0  228   40  LLLSS   LLCCC. LL   I         CCCC  CL  L LLL
   140  136 L L  E     -BC 119 179K   0  228   49  MMVLL   VILLL. SI   s         LLLL  LS  S sSS
   141  137 L N  E     -B  118   0K   2  221   47  SS.SS   SSSSS. SS   p         SSSS  S.  . p..
   142  138 L N  E    S+     0   0K  49  225   49  DD.DD   RDSSS. QD   S         SSSS  SS  T SSS
   143  139 L F  E     - C   0 177K   0  226   41  FF.FF   FFQQQ. SF   E         QQQQ  QQ  Q EQQ
   144  140 L Y  B    S+A  115   0J   9  226   46  YY.TT   KYSSS. VY   S         SSSS  SS  S SSS
   145  141 L P  S    S-     0   0   18  226   16  PP.PP   PPGGG. PP   K         GGGG  VV  G KVV
   146  142 L K  S    S+     0   0   83  227   74  GG.RR   GGPPP. FG   G         PPPP  SK  P GPP
   147  143 L D        +     0   0  116  228   78  AA.GG   FSFFF. AN   F         FFFF  FF  F FFF
   148  144 L I        -     0   0   19  228   60  VV.AA   VVAAA. DL   A         AAAA  AV  A AAA
   149  145 L N  E     -E  201   0L  82  228   67  TT.TT   RTDDD. VT   D         DDDD  DD  D DDD
   150  146 L V  E     -E  200   0L  27  228   12  VV.VV   VVVVV. SV   V         VVVV  VV  V VVV
   151  147 L K  E     -E  199   0L  53  228   76  AA.KK   LATTT. WT   S         TTTT  SS  N SSS
   152  148 L W  E     +E  198   0L   3  228    3  WW.WW   WWWWW. LW   W         WWWW  WL  W WWW
   153  149 L K  E     +EF 197 158L  76  229   45  KKMLL   RKMMM. AK   L         MMMM  LL  L LLL
   154  150 L I  E    S-E  196   0L   0  229   68  EELVV   VASSS. GA   L         SSSS  AA  V LLL
   155  151 L D  S    S-     0   0   71  229   24  NNLDD   DNGGG. GD   G         GGGG  GG  D GGG
   156  152 L G  S    S+     0   0   63  230   38  GGIGG   DGGGG. SG   G         GGGG  GG  G GGG
   157  153 L S  S    S-     0   0   33  229   65  SSMKK   KNSSS. PT   S         SSSS  SS  S SSS
   158  154 L E  B     -F  153   0L  85  229   76  PPTEE   EPPPP. VP   P         PPPP  PP  P PPP
   159  155 L R        -     0   0   69  231   75  VVKKQ   TVVVV. SV   V         VVVV  VV  V VVV
   160  156 L Q        +     0   0  133  232   75  SSTTT   DSVVVK ST   S         VVVV  SS  S SSS
   161  157 L N  S    S+     0   0  117  233   70  QQRDD   SQTTTS TQ   S         TTTT  SS  S SSS
   162  158 L G  S    S+     0   0   29  233   33  GGASS   GGGGGG AG   G         GGGG  GG  G GGG
   163  159 L V  E     -D  183   0K  46   68   75  ..A..   ...... ..   .         ....  ..  . ...
   164  160 L L  E     -D  182   0K  16  212   47  VVLVV   VVIII. .V   I         IIII  II  I III
   165  161 L N  E     +D  181   0K  52  216   55  EEQQQ   TESSS. .E   S         SSSS  SS  S SSS
   166  162 L S  E     -D  180   0K  12  224   49  TTGSS   TTTTT. .T   T         TTTT  TT  T TTT
   167  163 L W  E     -D  179   0K  99  224   71  TTSSS   GTSSS. .T   S         SSSS  SS  S SSS
   168  164 L T        -     0   0   24  225   66  KKSGG   TKTTT. .K   T         TTTT  TT  T TTT
   169  165 L D        -     0   0   99  226   74  PPGLL   VPAAAV .P   A         AAAA  AA  A AAA
   170  166 L Q        -     0   0   18  229   76  SSDSS   SWVVVS VF   V         VVVV  VV  V VVV
   171  167 L D     >  -     0   0   48  229   61  KKIKK   TRKKKK QK   Q         KKKK  QR  Q QQQ
   172  168 L S  T  4 S+     0   0   54  232   60  QQVQQ   DQQQQQ RQ   Q         QQQQ  RR  K QQQ
   173  169 L K  T  4 S+     0   0  180  232   58  SSMSS   SSPPPS PS   A         PPPP  PP  P AAA
   174  170 L D  T  4 S-     0   0   57  232   39  NNTDD   DNDDDD DN   D         DDDD  DD  D DDD
   175  171 L S     <  +     0   0    4  232   57  NNQNN   QNQQQN QN   Q         QQQQ  QQ  Q QQQ
   176  172 L T        -     0   0    5  232   72  KKTLL   SKTTTL TK   T         TTTT  TT  T TTT
   177  173 L Y  E     -C  143   0K   7  226    4  YY.YY   YYFFFY YY   F         FFFF  YY  F FFF
   178  174 L S  E     -     0   0K   1  226   72  VV.MM   SAHHHM QV   Q         HHHH  QQ  H QQQ
   179  175 L M  E     -CD 140 167K   0  227   79  AA.EE   LAIIIE IA   I         IIII  II  I III
   180  176 L S  E     -CD 139 166K   3  229    6  SS.SS   SSSSSS SS   S         SSSS  SS  S SSS
   181  177 L S  E     -CD 138 165K   0  229    4  SS.SS   SSSSSN SS   S         SSSS  SS  S SSS
   182  178 L T  E     -CD 137 164K   2  230   72  YYPYY   YYYYYY SY   Y         YYYY  SS  S YYY
   183  179 L L  E     -CD 136 163K   0  231    1  LLLLL   LLLLLL LL   L         LLLL  LL  L LLL
   184  180 L T  E     +C  135   0K  36  231   54  SSSSS   RSAAAS TS   A         AAAA  TT  S AAA
   185  181 L L  E     -C  134   0K  16  231   14  MMLLL   VLIIIM IL   V         IIII  II  I VVV
   186  182 L T  E  >  -C  133   0K  81  230   58  SSPTT   PTQQQS QS   Q         QQQQ  QQ  Q QQQ
   187  183 L K  H >> S+     0   0   66  227   67  AA AA   APAAAA TP   T         AAAA  TP  T TTT
   188  184 L D  H 3> S+     0   0  109  228   63  SS DD   TDSSSD SD   S         SSSS  SS  S SSS
   189  185 L E  H >4 S+     0   0   53  228   49  KK QQ   AKDDDD DK   D         DDDD  DD  D DDD
   190  186 L Y  H X< S+     0   0    6  226   12  WW WW   WWWWWW WW   W         WWWW  WW  W WWW
   191  187 L E  H 3< S+     0   0   90  226   71  KK LL   NKNNNL NK   N         NNNN  NN  N NNN
   192  188 L R  T << S+     0   0  160  226   61  SS RR   KSMMMK MS   M         MMMM  MM  M MMM
   193  189 L H    <   -     0   0   24  224   55  AA HH   GGDDDH DH   D         DDDD  DD  N DDD
   194  190 L N  S    S+     0   0   97  224   71  SS EE   SGKKKD KS   K         KKKK  KK  K KKN
   195  191 L S  E     + G   0 214L  37  224   71  QQ TT   SSVVVS VN   V         VVVV  VV  V VVV
   196  192 L Y  E     +EG 154 213L   0  224   14  YY YY   YYYYYY YF   Y         YYYY  YY  Y YYY
   197  193 L T  E     -EG 153 212L   3  223   48  SS SS   TSTTTS TT   T         TTTT  TT  A TTT
   198  194 L b  E     -EG 152 211L   1  223    0  CC CC   CCCCCC CC   C         CCCC  CC  C CCC
   199  195 L E  E     -EG 151 210L  34  212   62  HH KK   SQKKKK KQ   K         KKKK  KK  K KKK
   200  196 L A  E     -EG 150 209L   1  212   22  VV VV   VVVVVV VV   V         VVVV  VV  V VVV
   201  197 L T  E     +E  149   0L  36  212   35  TT SS   DTSSST ST   S         SSSS  SS  S SSS
   202  198 L H  E >   - G   0 205L  18  212   27  HH HH   HHLLLH LH   L         LLLL  LL  L LLL
   203  199 L K  T 3  S+     0   0  145  211   56  DD QQ   GEGGGE GE   G         GGGG  GA  G GGG
   204  200 L T  T 3  S+     0   0   55  211   41  GG GG   SGSSSG SG   S         SSSS  SS  S SSS
   205  201 L S  E <   -G  202   0L  45  187   83  NN      LGQQQ  QS   Q         QQQQ  QE  Q QQQ
   206  202 L T  E    S+     0   0L 140  187   30  TT      STTTT  TT   T         TTTT  TT  T TTT
   207  203 L S  E    S-     0   0L  82   90   51          S AAA  S    A         AAAA  S   A AAA
   208  204 L P  E     -     0   0L  43   67   33          P                                    
   209  205 L I  E     -G  200   0L  46   67   29          L                                    
   210  206 L V  E     +G  199   0L  70   63   53          L                                    
   211  207 L K  E     +G  198   0L  85   63   26          K                                    
   212  208 L S  E     -G  197   0L  67   63   28          T                                    
   213  209 L F  E     -G  196   0L  30   63   18          I                                    
   214  210 L N  E      G  195   0L  99   63   62          S                                    
   215  211 L R              0   0   82   54   19                                               
   216      ! !              0   0    0   0     0  
   217    1 H Q              0   0  199  213   30       EEE          EQ EDEEEEEEE    D    D E   
   218    2 H V        +     0   0   30  215   38       III          IV IIIIIIIVE    V   VV I   
   219    3 H K  E     -A  241   0A 143  215   52       TTT          RK TVTTTTVQQ    Q   QQ L   
   220    4 H L  E     -A  240   0A  11  231    3       LLL      L   LL LLLLLLLLL    LL  LL L   
   221    5 H Q  E     -A  239   0A 120  231   74       TTT      T   SQ TSTTTTNVV    VT  VV S   
   222    6 H E  E     -A  238   0A   2  232   34       QQQ      E   QQ QQQQQQQEE    EQ  EE Q   
   223    7 H S  E     +A  237   0A  48  232   22       PPP      S   KS PPPPPPTSS    SS  SS K   
   224    8 H G        -     0   0   35  232   24       EKK      E   AG EKEEKEEGG    GE  GG A   
   225    9 H P        -     0   0   50  232   51       SSS      S   SP SSSSSSSGG    GP  GG S   
   226   10 H A  S    S+     0   0   30  232   54       VVV      V   EE VVVVVVVGG    GV  DG E   
   227   11 H V  E     -d  334   0B  33  233   26       VVV      V   IL VEVVVVVLL    LV  VL I   
   228   12 H I  E     -d  335   0B   9  233   54       KKK      K   AK KKKKKKKVV    VK  RV A   
   229   13 H K        -     0   0  104  233   49       KKK      R   NK KKKKKKKQQ    QR  KQ N   
   230   14 H P  S    S+     0   0   56  233   12       PLL      P   VP PPPPLPLPP    PP  PT V   
   231   15 H S  S    S+     0   0   90  233   20       GGG      G   GG GGGGGGGGG    GG  GG G   
   232   16 H Q  S    S-     0   0   76  233   60       EEE      E   AE EAEEEEEGG    GE  DG T   
   233   17 H S        -     0   0   51  232   21       SSS      S   ST SSSSSSSSS    SS  SS S   
   234   18 H L  E     - B   0 300A   1  232   46       HYY      H   IV HHHHYHHLL    LH  LL I   
   235   19 H S  E     - B   0 299A  64  233   50       RRR      R   LK RRRRRRKRR    RT  RR L   
   236   20 H L  E     - B   0 298A   1  233   15       LLL      L   LI LLLLLLLLL    LL  LL L   
   237   21 H T  E     -AB 223 297A  29  233   34       TTT      T   ES TATTTTTSS    ST  SS E   
   238   22 H c  E     -AB 222 296A   0  234    0       CCC      C  CCC CCCCCCCCC    CC  CC C   
   239   23 H I  E     -AB 221 295A  54  233   74       TAA      S  SEK TTTTATTAA    AS  KA E   
   240   24 H V  E     -A  220   0A   4  233   54       VVV      A  VVA VVVVVVVAA    AA  AA V   
   241   25 H S  E     +A  219   0A  60  234    9       SSS      S  NSS SSSSSSSSS    SS  SS S   
   242   26 H G  S    S+     0   0   54  228    4       GGG      G  GGG GGGGGGEGG    GG  GG G   
   243   27 H F  S    S-     0   0   37  199   30       ...      F  ..Y .......FF    FF  FF .   
   244   28 H S    >   -     0   0   44  201   49       ...      T  ..T .......TT    TT  TT .   
   245   29 H I  T 3  S+     0   0    2  232   27       FFF      F  FYF FFFFFFFFF    FF  FF Y   
   246   30 H T  T 3   +     0   0   59  232   53       SSS      S  DNT SSSSSSGDS    SS  SN N   
   247   31 H R  S X  S-     0   0  145  234   77       LLL      S  KID LLLLLLLDS    SS  SS I   
   248   32 H T  T 3  S+     0   0   72   68   71       SDD      .  AN. SSSSDSS..    ..  .. N   
   249   33 H N  T 3  S+     0   0   16   73   70       SDD      .  ND. SSSSDTG..    ..  .. D   
   250   34 H Y  E <   -E  317   0C  23  234   47       YYY      Y  EHY NYYNYYYYY    YY  HY H   
   251   35 H d  E     -EF 316 270C   0  224   90       GWW      G  FHG STGSWGSYW    GG  WW H   
   252   35AH W  E     -EF 315 269C   1  222   46       MMM      M  VMM MMMMMMMMM    MM  MM M   
   253   35BH H  E     -EF 314 268C   0  231   72       HHH      N  HYN HCHHHHHHH    SA  GN N   
   254   36 H W  E     +EF 313 267C   1  233    1       WWW      W  WWW WWWWWWWWW    WW  WW W   
   255   37 H I  E     -EF 312 265C   0  233   13       VVV      V  TVV VVVVVVVVV    VV  VV V   
   256   38 H R  E     -EF 311 264C  10  234   15       RRR      R  RRK RRRRRRRRR    RR  RR R   
   257   39 H Q  E     -EF 310 263C  22  233    3       QQQ      Q  QQQ QQQQQQQQQ    QQ  QQ Q   
   258   40 H A    >   -     0   0   14  233   59       AAA      A  KAA AVAAAAAAA    AA  AA A   
   259   41 H P  T 3  S+     0   0   99  234   20       PPP      P  TPP PPPPPPTPP    PP  PP P   
   260   42 H G  T 3  S+     0   0   94  234   11       GGG      G  GGG GGGGGGGGG    GG  GG G   
   261   43 H K  S <  S-     0   0  140  234   34       KKK      K  KAK KKKKKKKKK    KK  KK A   
   262   44 H G        -     0   0   20  234   23       GGG      G  TgG GGGGGGGGG    GG  GG g   
   263   45 H L  E     -F  257   0C  10  234    6       LLL      L  LlL LLLLLLLLL    LL  LL i   
   264   46 H E  E     -F  256   0C  79  234   10       EEE      E  EEK EEEEEEEEE    EE  EE E   
   265   47 H W  E     +F  255   0C  13  234    9       WWW      W  WWW WWWWWWWWW    WW  WW W   
   266   48 H M  E     -     0   0C   3  234   31       LLL      I  ILM LLLLLLLVV    VI  VV L   
   267   49 H G  E     -FG 254 277C   0  234   42       AAA      A  GAG ALAAAATLA    SS  AS A   
   268   50 H R  E     -FG 253 276C  10  234   92       AAA      Y  RAW ASAAGAAAY    YA  YT A   
   269   51 H I  E     -FG 252 275C   3  234   20       III      I  QFI IYIIQIIDI    II  II F   
   270   52 H d  E >   -F  251   0C   0  234   84       AAA      C  SRN AYNAAAVSS    SS  RT R   
   271   53 H Y  T 3  S+     0   0   47  234   85       GGG      T  ltt SSNSGASGS    ss  Yh t   
   272   54 H E  T 3  S-     0   0   63  232   61       SSS      s  qtt SESSSSS.d    ik  dd t   
   273   55 H G  S <  S+     0   0   25  185   36       GGG      s  ..G GSGGGGGGs    ..  g. .   
   274   56 H S        -     0   0   42  200   70       RSS      P  ..E SNRSNGSSS    ..  SS .   
   275   57 H I  E     -G  269   0C  71  215   54       KKK      I  .TP KKKKKKKTT    ..  TT T   
   276   58 H Y  E     -G  268   0C  70  222   77       YYY      Y  EYT YNYYVSYYY    YY  YY H   
   277   59 H Y  E     -G  267   0C  41  227   14       YYY      Y  YIY YYYYHYYYY    YY  YY I   
   278   60 H S    >>  -     0   0   11  231   57       AAA      S  SAA AAVAAAAVA    AS  LP S   
   279   61 H P  T 34 S+     0   0   76  234   56       PPP      Q  SED PPSPPPPNN    DE  DD E   
   280   62 H S  T 34 S+     0   0   79  234   55       AAA      S  SGD AGAAATASS    SS  AS S   
   281   63 H I  T X4 S+     0   0    4  234   43       VVV      V  FFF VVVVVVVVV    VV  VV F   
   282   64 H K  G >< S+     0   0  133  234   33       RRR      Q  QKK RQRRRRQKK    KK  KK K   
   283   65 H S  G 3  S+     0   0  116  234   31       DGG      G  SDG DDDDGDDGG    GG  GG D   
   284   66 H R  G <  S+     0   0   51  234   16       RRR      R  RRR RRRRRRRRR    RR  RR R   
   285   67 H S  E <   -C  300   0A  11  234   54       FFF      F  FVF FFFFFFFFF    FF  FF V   
   286   68 H T  E     -C  299   0A  67  220   24       ...      S  T.A .......TT    TI  TT .   
   287   69 H I  E     +C  298   0A   3  220   25       ...      I  L.F .......II    II  II .   
   288   70 H S  E     -C  297   0A  56  234   45       EEE      S  STS ETEEEEESS    SS  SS T   
   289   71 H R  E     -C  296   0A  71  234   70       III      R  YPL IAIIIIIRR    RR  RR P   
   290   72 H D  E >>> -C  295   0A  55  234   18       SSS      D  DSE SSSSSSSDD    DD  DD S   
   291   73 H T  T 345S+     0   0   78  233   60       KKK      D  VTT KKKKKKKNN    NN  NN T   
   292   74 H S  T 345S+     0   0  105  233   44       DDD      S  SSS DGDDADDAA    AN  PA S   
   293   75 H L  T <45S-     0   0  103  234   70       SSS      S  SGA SSSSGSNKK    KK  NK G   
   294   76 H N  T  <5 +     0   0   29  234   47       GNN      S  SSS DDGDNGDNN    NA  NN S   
   295   77 H K  E   < -BC 239 290A  51  234   64       ATT      K  STT TAATTATST    SQ  LM T   
   296   78 H F  E     -BC 238 289A   1  234   61       VVV      L  AAA VFVVVVVLL    LL  LL A   
   297   79 H F  E     -BC 237 288A  50  234   27       YYY      Y  DQY YYYYYYYYY    YN  HY Q   
   298   80 H I  E     -BC 236 287A   4  234    5       LLL      L  LLL LLLLLLLLL    LL  LL L   
   299   81 H Q  E     -BC 235 286A  73  234   36       QQQ      Q  SRQ QQQQQQKQQ    QQ  QQ R   
   300   82 H L  E     -BC 234 285A   3  234   23       VVV      M  III VMVVVVVMM    MM  MM I   
   301   82AH I        +     0   0   70  234   62       TTT      N  RNN TTTTTTTNS    NN  TN N   
   302   82BH S  S    S-     0   0   59  234   35       SNN      S  KRN SDSSNSNSS    SS  GS K   
   303   82CH V        -     0   0    0  234   13       LLL      L  RLL LLLLLLLLL    LL  LL L   
   304   83 H T    >   -     0   0   65  234   62       RRR      R  SSK RRRRRRTKR    RK  KR S   
   305   84 H N  G >  S+     0   0  120  234   65       VVT      M  VSN VVVVVVVAA    AT  PA S   
   306   85 H E  G 3  S+     0   0  160  234   25       DDD      E  ASE DDDDDDDEE    EE  EE S   
   307   86 H D  G <  S+     0   0    0  234    1       DDD      D  DDD DDDDDDDDD    DD  DD D   
   308   87 H T    <   +     0   0   30  234   32       TTT      T  MTT TTTTTTTTT    TS  TT I   
   309   88 H A  E    S- H   0 333C   3  234    4       AAA      A  AAA AAAAAAAAA    AA  AA A   
   310   89 H M  E     -EH 257 332C  43  234   58       III      V  VTT IMIIIIIVV    VV  RV T   
   311   90 H Y  E     -EH 256 331C   2  234    0       YYY      Y  YYY YYYYYYYYY    YY  YY Y   
   312   91 H Y  E     -E  255   0C   1  234    3       YYY      Y  HYF YYYYYYYYY    YY  YY Y   
   313   92 H c  E     +E  254   0C   0  234    1       CCC      C  CCC CCCCCCCCC    CC  CC C   
   314   93 H S  E     -EI 253 327C   0  234   30       AAA      A  GAA AAAAAAAAA    AA  AV A   
   315   94 H R  E     -EI 252 326C  20  233   44       RRR      R  GRR IRSSRRRRR    RR  RL R   
   316   95 H E  E     -EI 251 324C   0  233   77       DDD      R  QSK WYRGDGGDD    DE  HS G   
   317   96 H N  E  >> -E  250   0C   6  233   90       LWW      D  ERD YNARGYYTT    TS  TQ Y   
   318   97 H H  T  45S+     0   0    0  233   93       GVM      T  AGL WWMSGANGR    VQ  AV F   
   319   98 H M  T  45S+     0   0   73  234   93       SCV      V  MSL GVHHGTDFP    SL  TQ D   
   320   99 H Y  T  45S+     0   0  159  234   92       VVW      R  PYR SAEWSGGPV    FL  RL Y   
   321  100 H E  T  <5 -     0   0   54  234   90       aWG      d  hFY GGGGPaYlM    FD  NQ W   
   322  100AH T      < +     0   0    0  139   91       g..      q  d.. .....p.q.    ..  .. .   
   323  100BH Y  S    S-     0   0   10  161   90       V..      M  A.. .Y...Q.Y.    ..  .. .   
   324  100CH F  E     +I  316   0C   0  185   48       L..      S  L.F .GI..LGT.    .F  .. .   
   325  101 H D  E     +     0   0C  42  205   40       T..      C  DDD .RA..SGDE    .F  .. .   
   326  102 H V  E     -I  315   0C  35  212   66       Y..      C  YYY .YY..YYTG    VL  .E .   
   327  103 H W  E     -I  314   0C  28  221    8       W..      Q  WWW .WW.WWWTL    FP  .S .   
   328  104 H G        -     0   0    3  229    7       GGS      p  GGG .GGSGAGPg    vs  .G G   
   329  105 H Q        -     0   0  100  223   52       SS.      r  EPQ .SS.SSN.g    rr  .. Q   
   330  106 H G        -     0   0    3  228    7       GGG      S  GGG .GGGGGGSH    GV  .P G   
   331  107 H T  E     -H  311   0C  27  233   39       TTT      S  TTT TTTTTTTSL    NI  .G T   
   332  108 H T  E     -H  310   0C  48  234   79       FFF      N  RMT FFFFFFFPC    IT  LL M   
   333  109 H V  E     -H  309   0C   0  234   19       LLL      Q  VVV LLLLLLLTF    LL  LV V   
   334  110 H T  E     -d  227   0B  16  234   41       EEE      S  TTT EEAEEEEVC    TT  TK T   
   335  111 H V  E     +d  228   0B   2  234    9       VVV      S  VVV VVVVVVVLI    SV  LP V   
   336  112 H S        -     0   0   18  234   31       TTT      S  TTS TTTTTSTCH    TP  LS T   
   337  113 H S  S    S+     0   0   99  234   19       SSS      S  SSS SSSSSSSRP    ES  QQ S   
   338  114 H A  S    S-     0   0   31  234   51       VDD      s  vAg VDVVDLDpa    at  kt A   
   339  115 H K        -     0   0  143  234   66       AII      q  pVg AVAAIAVgs    at  pg T   
   340  116 H T        -     0   0   44  234   72       QQQ      L  STG QQQQQQQPI    GG  GY S   
   341  117 H T  B     -J  370   0D  35  234   73       SII      T  VSG SISSISVAL    VV  AS K   
   342  118 H P        -     0   0   60  234   66       AKK      Q  PPS AKAAKAKHE    QK  RI S   
   343  119 H P        -     0   0   13  234   17       PPP      P  PPD PPPPPPPDV    CS  ST P   
   344  120 H S  E     -K  367   0E  51  234   57       SSS      D  VSI SSSSSSSVQ    EE  QS S   
   345  121 H V  E     -K  366   0E   6  234   25       VVV      S  LLE VVVVVVVTV    VQ  VG L   
   346  122 H Y  E     -K  365   0E  27  234   14       YYY      V  VFL YYYYYYYVQ    QL  QY F   
   347  123 H P  E     -K  364   0E  15  234   27       ILL      S  PPT ILIILIVGL    LT  LC P   
   348  124 H L  E     +K  363   0E   4  234   22       SSS      L  MLQ SSSSSSSVQ    VQ  VW L   
   349  125 H A        -     0   0   10  234   68       NSS      Q  VIS NSNNSNSPE    EP  ET I   
   350  126 H P        -     0   0   24  234   77       PTT      P  WSP PTPPTPTPS    SA  SW S   
   351  127 H G  S    S-     0   0   16  234   65       SYY      G  FCS SSSSYSSGG    GS  GI C   
   352  128 H S  S    S+     0   0   99  234   67       CGG      Q  SGS CCCCGCCSP    GV  GR G   
   353  129 H A        +     0   0   52  234   79       ddd      R  PEl dddddddGg    gT  dQ E   
   354  130 H A        +     0   0   70  145   76       nss      .  ..a nsnnsns.v    vV  kP .   
   355  133 H Q        +     0   0  178  219   82       SSS      .  A.S SSSSSSS.K    KQ  KQ .   
   356  134 H T    >   -     0   0   64  231   47       NNN      .  SSL NNNNNNN.P    PP  PG S   
   357  135 H N  T 3  S-     0   0  146  232   60       QQQ      .  GMG QQQQQQQGS    GG  GK M   
   358  136 H S  T 3  S+     0   0   63  232   58       DAA      .  DDG DDDDADDDQ    GQ  DG D   
   359  137 H M  E <   - L   0 408E  83  232   79       EEE      .  KPK EEEEEEEST    SC  SL P   
   360  138 H V  E     - L   0 407E  15  233   38       III      L  VVV IIIIIIIGL    LL  LE V   
   361  139 H T  E     + L   0 406E  15  234   68       SSS      T  TTT SSSSSSSVS    RT  RW T   
   362  140 H L  E     + L   0 405E   0  234   26       LLL      I  LLI LLLLLLLLL    LV  LM I   
   363  141 H G  E     -KL 348 404E   0  234   28       VLL      T  SGT VLVVLVLST    ST  SG G   
   364  142 H e  E     -KL 347 403E   1  234    1       CCC      C  CCC CCCCCCCQC    CC  CC C   
   365  143 H L  E     -KL 346 402E   2  234   12       LLL      Q  LLK LLLLLLLVS    AQ  KI L   
   366  144 H V  E     -KL 345 401E   1  234   46       VVV      V  AAA VVVVVVVqV    AV  Tg A   
   367  145 H K  E     -KL 344 400E  38  231   68       KKK      .  LKS KKKKKKKqS    S.  Sn K   
   368  146 H G  E    S+     0   0E  19  234   40       DDD      S  DGQ DDDDDDDEG    GS  GT D   
   369  147 H Y  E     - L   0 399E   0  234    5       FFF      Y  FFD FFFFFFFSF    FY  FY F   
   370  148 H F  B     +J  341   0D   3  234   40       HQQ      S  YLI HQHHQHQGS    TS  TY L   
   371  149 H P  S    S-     0   0    0  234   15       PPP      V  PPN PPPPPPPPi    FV  FS P   
   372  150 H E  S    S+     0   0   53  231   47       RRR      S  QD. RRRRRRR.t    SS  S. E   
   373  151 H P        +     0   0   59  232   52       SNN      S  SS. SNSSNSN.S    SS  SP T   
   374  152 H V        -     0   0   20  233   39       III      Y  LIK IIIIIII.G    YH  YS I   
   375  153 H T  E     +N  422   0F  83  234   67       RQQ      W  SSY RQRRQRQGY    WH  RL S   
   376  154 H V  E     +N  421   0F  23  234   44       QQQ      T  FFI QQQQQQQLW    MT  MK F   
   377  156 H T  E     -N  420   0F  48  234   51       TTT      G  ESA TTATTTTVS    SH  NS T   
   378  157 H W  E > >S-NO 419 383F   2  234    0       WWW      W  WWW WWWWWWWKW    WW  WR W   
   379  162 H N  G > 5S-     0   0   38  234   61       sFF      I  seY sSssFsFPI    VI  VT g   
   380  163 H S  G 3 5S-     0   0   91  234   63       eSS      R  akQ eTeeSeSAR    RR  RS k   
   381  164 H G  G < 5S+     0   0   39  234   50       SDD      Q  SSH SGSSDSDQQ    QQ  QI N   
   382  165 H S  T < 5 +     0   0   93  234   53       gnn      P  gnK gnggngntP    AP  AS n   
   383  166 H L  B   < +O  378   0F  43  228   74       iii      A  liP iiiiiiilP    PA  PR y   
   384  167 H S        +     0   0   88  231   64       TTT      G  DSG TTTTTTTTG    GG  GD S   
   385  168 H S  S    S+     0   0  101  231   73       TTT      K  SNK TTTTTTTCK    KK  KT T   
   386  169 H G  S    S+     0   0   32  226   40       GGG      G  .GG GGGGGGGTG    GG  GS G   
   387  171 H V        +     0   0   48  232   57       IFF      L  .VP IFIIFIFVL    LL  LK L   
   388  172 H H  E     -M  404   0E  17  233   79       SNN      E  LKR SNSSNSNSE    EE  EN K   
   389  173 H T  E     -M  403   0E  69  233   67       KKK      W  RSS KKKKKKRGW    WW  WQ S   
   390  174 H F  E     -M  402   0E   1  233   11       YYY      I  YYA YYYYYYYFM    VI  VF Y   
   391  175 H P  E     -     0   0E  65  232   17       PPP      G  PR. PPPPPPPSG    SG  AS K   
   392  176 H A  E     -     0   0E  19  233   53       AAA      S  APH AAAAAAAIH    VA  YL P   
   393  177 H V  E     -M  400   0E  42  233   54       VVV      E  VVT VIVVVVITI    IH  IQ V   
   394  178 H L  E     -M  399   0E  77  233   51       QLL      R  EML QLQQLQLTW    SR  SL M   
   395  179 H Q  S    S-     0   0   83  233   65       GGG      V  TQH GGGGGGGSY    SV  NS Q   
   396  180 H S  S    S-     0   0  116  233   55       NQQ      G  NaI NQNNQNQGd    SG  GS s   
   397  183 H D  S    S+     0   0   90  226   21       ddd      .  Ng. ddddddn.s    G.  G. g   
   398  184 H L        -     0   0   53  224   74       kkk      .  RT. kkkkkkt.T     .  I. T   
   399  185 H Y  E     -LM 369 394E  36  230    2       YYY      Y  FYY YYYYYYYYY     Y  T. Y   
   400  186 H T  E     +LM 367 393E   5  228   48       TSS      A  TSI TTTTTTTA         IV S   
   401  187 H L  E     -L  366   0E  11  225   53       MMM         EAQ MMMMMMM          LT A   
   402  188 H S  E     -LM 365 390E   5  225   25       SCC         VSP SSSSCSS           T S   
   403  189 H S  E     -LM 364 389E   2  225    1       SSS         SSG SSSSSSS           E S   
   404  190 H S  E     -LM 363 388E   0  225   78       VVV         LQI VVVVVVV           D Q   
   405  191 H V  E     -L  362   0E   0  225   27       LLL         VIP LLLLLLL           M V   
   406  192 H T  E     +L  361   0E  48  225   41       KSS         QNS KSKKSKS           A N   
   407  193 H V  E     -L  360   0E  14  224   29       VVV         MVR VVVVVVV           V V   
   408  194 H P  E  >  -L  359   0E  56  223   43       SSS         SDF SSSSSSS             A   
   409  195 H S  T  4 S+     0   0   49  222   51       AAA         RSS AAAAAAA             S   
   410  196 H S  T  4 S+     0   0   66  222   64       ASS         SAG ASAASAS             A   
   411  198 H P  T  > S+     0   0   31  222   70       DDD         ETS DDDDDDD             V   
   412  199 H R  T  < S+     0   0   16  222   99       WWW         .WG WWWWWWW             W   
   413  200 H P  T  4 S+     0   0   80  223   71       KNN         ADS KNKKNKN             D   
   414  202 H S  T  4 S+     0   0  111  221   68       TAA         NKG TATTATA             N   
   415  203 H E  S  < S-     0   0  128  221   75       NNN         LSR NNNNNNN             I   
   416  204 H T        -     0   0   83  221   71       rkk         kkD rkrrkrk             e   
   417  205 H V        +     0   0    4  217   60       yyy         yfY yyyyyyy             f   
   418  206 H T  E     - P   0 433F  23  217   76       QQQ         RYS QHQQQQH             Y   
   419  208 H e  E     -NP 378 432F   0  220    1       CCC         CCF CCCCCCC             C   
   420  209 H N  E     -NP 377 431F   4  220   59       QKK         SNS QEQQKQK             N   
   421  210 H V  E     -NP 376 430F   1  220   24       AAA         VAI AAAAAAA             A   
   422  211 H A  E     -NP 375 429F  14  220   74       GGG         TKS GGGGGGG             K   
   423  212 H H  E > > - P   0 428F   1  220   17       YDD         HHN YYYYDYY             H   
   424  213 H P  G > 5S+     0   0   77  209   81       NKK         PL  NKNNKNK             L   
   425  214 H A  G 3 5S+     0   0   40  203   65        AA         GE   A  A A             D   
   426  215 H S  G < 5S-     0   0   32  202   63        AA         GV   N  A N             T   
   427  216 H S  T < 5 +     0   0  111  199   72                   TT   E    E             I   
   428  217 H T  E   < +P  423   0F  35  196   63                   KK                      K   
   429  218 H K  E     +P  422   0F 135  196   50                   TR                      S   
   430  219 H V  E     -P  421   0F  38  140   32                   VV                      V   
   431  220 H D  E     -P  420   0F  97  140   36                   DE                      E   
   432  221 H K  E     -P  419   0F  51  127   45                   A                       L   
   433  222 H K  E     -P  418   0F 121  127   48                   K                       K   
   434  223 H I        -     0   0    4  123   30                                           K   
   435  224 H V        -     0   0   79  112   59                                           D   
   436  225 H P              0   0   73  103   61                                           P   
   437  226 H R              0   0  167   89   21                                               
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1    1 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  29  26   0  45    77    0    0   1.066     35  0.68
    2    2 L  16  11  65   0   0   0   0   0   0   0   3   2   0   0   0   0   0   0   2   0    88    0    0   1.108     36  0.68
    3    3 L  68   2   3   0   0   0   0   0   0   0   0   5   0   0   2   3  14   2   0   0    98    0    0   1.142     38  0.51
    4    4 L  15  34   1  50   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   101    0    0   1.040     34  0.79
    5    5 L   0   3   2   0   0   0   0   0   0   0   2  92   0   0   0   0   0   0   1   0   101    0    0   0.381     12  0.85
    6    6 L   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0  97   0   1   1   101    0    0   0.166      5  0.95
    7    7 L   0   0   0   0   0   0   0   0   0   1  48  39   0   1   1   8   3   0   0   0   101    1    0   1.163     38  0.43
    8    8 L   0   1   0   0   0   0   0   0   0  97   0   1   0   0   0   0   1   0   0   0   148    0    0   0.183      6  0.94
    9    9 L   2  10   1   0   0   0   1   4  26  28  24   0   0   0   0   0   0   2   0   2   156    0    0   1.704     56  0.32
   10   10 L  13   1   2   4   1   0   2   1   3   1  66   6   0   0   0   0   0   0   0   0   168    0    0   1.272     42  0.42
   11   11 L  44  39   1   3   0   0   0   0   2   0   0   0   0   4   0   2   1   1   0   0   204    0    0   1.384     46  0.52
   12   12 L   0   1   0   0   1   0   1   0   3   8  75   8   0   0   0   0   0   0   0   0   214    0    0   0.978     32  0.62
   13   13 L  50   6   2   0   0   0   0  19  15   0   5   2   0   0   0   0   0   0   0   0   216    0    0   1.462     48  0.42
   14   14 L   1   2   2   0   1   0   0   0  11   5  50  16   0   0   3   2   1   0   4   0   224    1    0   1.680     56  0.37
   15   15 L  15  20   0   0   0   0   0   0   2  53   0   4   0   0   0   4   2   0   0   0   225    0    0   1.406     46  0.33
   16   16 L   0   0   0   0   0   0   0  97   0   0   0   0   0   0   1   2   0   0   0   0   233    0    0   0.164      5  0.94
   17   17 L   0   0   0   0   0   0   0  13   3   0   4   2   0   0   0   1  42  25   0   9   233    0    0   1.587     52  0.49
   18   18 L   0   0   0   0   0   0   0   0   1   5  14  50   0   0  19   3   2   3   1   0   233    0    0   1.539     51  0.36
   19   19 L  60   2   4   0   0   0   0   0  33   0   0   0   0   0   0   0   0   0   0   0   233    0    0   0.926     30  0.56
   20   20 L   3   0   1   0   0   0   0   1   1   0  18  56   0   0  12   6   1   0   0   0   233    0    0   1.408     46  0.42
   21   21 L   1  27  67   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   233    0    0   0.823     27  0.76
   22   22 L   0   0   0   0   0   0   0   0   1   1  40  46   0   0   0   0   0   0   6   4   233    0    0   1.216     40  0.47
   23   23 L   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   233    0    0   0.028      0  1.00
   24   24 L   0   0   0   0   0   0   0   6   4   0  20  19   0   0  19  18   4   3   7   0   233    0    0   1.999     66  0.24
   25   25 L   0  11   4   0   0   1   0  39  25   0  11   6   0   1   1   0   0   0   0   0   233    0    0   1.684     56  0.30
   26   26 L   0   0   0   0   0   0   0   4   0   0  57  12   0   0   2   0   3   0   8  13   233    0    0   1.387     46  0.47
   27   27 L   0   1   0   0   0   0   0   4   2   1  36   9   0   0   7   3  25   2   8   3   233    0    0   1.892     63  0.26
   28   27 L   4   5  10   0   2   0   5  12   3   1  42   2   0   0   1   0   0   0   5   8   233  163   34   2.005     66  0.24
   29   27 L  30  13  14   0   0   0   3   1  10   1   6  10   0   6   0   6   0   0   0   0    70   10    3   2.077     69  0.24
   30   27 L   6   0   0   1   1   0  11   4   3   0  11   0   0  18   3   0   0   2   7  32    97   15    8   2.046     68  0.19
   31   27 L  17   0  13   0   0   1   2   2   1   2  22  10   0   0   2   0   1   1  18  11   133    0    0   2.094     69  0.18
   32   28 L   9   3  24   0   1   1  11  11   2   0   7   8   0   1   0   0   1   1   9  11   140    0    0   2.301     76  0.12
   33   29 L   7   1  11   0   0   0   0  58   2   2  12   2   1   0   0   1   0   0   1   1   224   44   33   1.555     51  0.41
   34   30 L   1   1   1   0   1   0  12   7   2   0  33   4   1   1   3   9   1   1  18   8   182    0    0   2.096     69  0.23
   35   31 L   0   0   0   1   0   0  12   2   2   0  12  10   0   6   1  13   0   2  34   4   205    0    0   2.041     68  0.24
   36   32 L   0   3   0   0   3   3  54   2   6   0   6   2   4   4   4   0   0   0   4   4   218    0    0   1.817     60  0.33
   37   33 L  38  30   8   7   0   0   3   0   8   5   0   1   0   0   0   0   0   0   0   0   225    0    0   1.664     55  0.48
   38   34 L   0   0   0   0   3   0  12   5  14   0  28   0   1  16   3   0   3   1  12   1   229    0    0   2.096     69  0.18
   39   35 L   0   0   0   0   1  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   233    0    0   0.077      2  0.99
   40   36 L   1   3   1   0  10   0  82   0   0   0   0   0   0   1   0   0   0   0   0   0   233    0    0   0.690     23  0.86
   41   37 L   0   6   0   0   0   0   0   0   0   0   0   0   0   1   3   7  83   0   0   0   233    0    0   0.671     22  0.71
   42   38 L   0   2   0   0   0   0   0   0   0   0   0   0   0   3   0   2  92   1   0   0   233    0    0   0.411     13  0.88
   43   39 L   5   5   8   3   2   0   0   0   0   1   0   3   0   9   7  57   0   0   0   0   233    0    0   1.591     53  0.37
   44   40 L   1   4   0   0   0   0   0   0   6  76   9   2   0   0   0   0   1   0   0   1   233    1    8   0.963     32  0.64
   45   41 L   0   0   0   0   0   0   0  91   0   4   1   0   0   0   0   0   0   0   0   2   232    0    0   0.453     15  0.87
   46   42 L   0   1   0   0   0   0   0   5   2   0  17   7   0   3   2  17  35  10   2   0   233    0    0   1.911     63  0.31
   47   43 L   9   1   1   0   0   0   0   2  54   8  15   3   0   0   5   1   0   0   0   0   233    0    0   1.537     51  0.41
   48   44 L   1   2   0   0   1   0   0   0   0  95   0   0   0   0   1   0   0   0   0   0   233    0    0   0.251      8  0.90
   49   45 L  15   1   0   1   0   0   1   0   0   0   0   2   0   0  23  41  13   2   0   0   233    0   28   1.571     52  0.36
   50   46 L   8  69   0   1   2   0   0   3   2   1   1   9   0   0   2   0   0   0   0   0   233    0    0   1.220     40  0.54
   51   47 L  14  67  10   6   0   1   0   0   1   0   0   0   0   0   0   0   0   0   0   0   233    0    0   1.063     35  0.77
   52   48 L   3   2  81   1   0   1   3   1   0   0   1   0   0   0   6   0   0   0   0   0   233    1   18   0.859     28  0.65
   53   49 L   0   0   0   0   5   2  83   1   0   0   1   0   1   3   1   2   0   0   0   0   232    0    0   0.812     27  0.76
   54   50 L   1   3   2   0   3   2   8  13   5   0   9   1   0   7   6   7   4   9   5  14   233    0   35   2.615     87  0.12
   55   51 L  18   0   4   0   0   0   0   1  22   0  10  10   0   0   0   0   1   1  14  19   233    0    0   1.987     66  0.24
   56   52 L   0   1   0   0   0   0   1   0   1   4  48  13   0   1   2   6   0   0  14   6   233    0    6   1.721     57  0.36
   57   53 L   1   0   1   0   0   0   2   0   1   0  18  15   0   3   3  18   4   4  26   3   233    0    0   2.106     70  0.26
   58   54 L   0  17   0   0   3   0   4   0   0   0   0   0   0   0  64   4   6   0   1   0   233    0    0   1.221     40  0.34
   59   55 L   2   0   0   0   5   0   6  14   9  42   1   0   0   6   0   0   7   4   1   2   233    0    0   1.962     65  0.19
   60   56 L   0   0   0   0   0   0   1   1   0   2  73  15   0   0   0   0   0   0   0   6   233    0    0   0.997     33  0.59
   61   57 L   0   0   0   0   0   4   0  90   0   0   0   0   0   0   0   2   0   0   3   0   233    0   18   0.492     16  0.78
   62   58 L  49   0  28   0   1   0   0   0   0   0   7  15   0   0   0   0   0   0   0   0   233    0    0   1.219     40  0.53
   63   59 L   0   0   0   0   0   0   0   0   2  79  17   0   0   1   0   0   0   0   0   0   233    0    0   0.679     22  0.72
   64   60 L   1   0   0   0   0   0   0   0  15   5  18   0   0   0   0   0   0  19   4  36   233    0    0   1.670     55  0.41
   65   61 L   0   0   0   0   0   0   0   0   0   0   0   0   0   1  93   4   2   0   0   0   233    0    0   0.329     10  0.91
   66   62 L   0   0   2   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   233    0    0   0.114      3  0.98
   67   63 L   0   0   0   0   0   0   0   0   0   0  86   9   0   0   0   1   0   0   3   0   233    0    0   0.542     18  0.76
   68   64 L   0   0   0   0   0   0   0  92   0   0   7   0   0   0   0   0   0   0   0   0   233    0   36   0.316     10  0.89
   69   65 L   0   0   0   0   0   0   0   0   3   0  76   6   0   7   0   1   0   0   0   6   233    0    0   0.938     31  0.59
   70   66 L   1   4   3   0   0   0   0  33   1   0  10   1   0   0   2  21   7   0  14   1   233    1    0   1.952     65  0.23
   71   67 L   1   3   2   0   1   0   1   0   2   2  88   1   0   0   0   0   0   0   0   0   232    0    0   0.635     21  0.76
   72   68 L   0   0   0   0   0   0   0  74   1   0   9   3   0   0   1   2   0   3   3   2   232    0    0   1.085     36  0.65
   73   69 L   0   0   0   0   0   0   0   4   2   0   8  44   0   0   0   2   1   0  35   2   232    0    0   1.425     47  0.41
   74   70 L   2   0   1   1   0   0   0   1   2   0   9  38   0   0   0   6   2   3   0  34   232    0    0   1.628     54  0.35
   75   71 L   1   0   0   0  33   0  12   8  44   0   0   0   0   1   0   0   0   0   1   0   232    0    0   1.358     45  0.18
   76   72 L   2   1   1   0   0   0   4   0   5   0  26  53   0   0   3   0   3   0   0   0   232    0    0   1.463     48  0.38
   77   73 L   0  90   0   4   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   232    0    0   0.417     13  0.95
   78   74 L   0   1   7   0   0   0   0   0   6   0   6  68   0   0   1   6   0   2   1   0   232    0    0   1.279     42  0.51
   79   75 L   1   4  94   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   232    0    0   0.268      8  0.95
   80   76 L   0   0   1   0   0   0   0   1   2   0  70  13   0   0   1   5   0   0   5   0   232    0    0   1.099     36  0.58
   81   77 L   0   0   0   0   0   0   0  52   1   1  19   0   0   0  18   1   0   2   7   0   232    0    0   1.376     45  0.39
   82   78 L  39  37   2   2   0   0   0   0  16   0   3   2   0   0   0   0   0   0   0   0   232    0    0   1.345     44  0.49
   83   79 L   0   3   0   0   0   0   0   0   0   0   0   0   0   0   4   1  59  32   0   0   232    0    0   0.983     32  0.63
   84   80 L   2   2   0   0   0   0   0   1  50  22   6  11   1   0   0   0   0   4   0   0   232    0    0   1.516     50  0.45
   85   81 L   0   0   0   1   0   0   0  14   0   0   0   0   0   0   0   0   2  74   1   6   232    0    0   0.930     31  0.72
   86   82 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   232    0    0   0.028      0  1.00
   87   83 L   3   3   2   1  12   0   0   0  14   0   7   1   0   0   0   0   0  51   0   5   232    0    0   1.635     54  0.21
   88   84 L   1   0   0   0   0   0   0  18  80   0   0   0   0   0   0   0   0   0   0   0   232    0    0   0.593     19  0.80
   89   85 L  24   1   3   1   0   0   0   1   0   0   1   8   0   1   0   0   3   3   1  52   233    0    0   1.541     51  0.30
   90   86 L   0   0   0   0   0   0  97   0   0   0   0   0   1   0   0   0   0   0   0   0   233    0    0   0.160      5  0.95
   91   87 L   0   0   0   0  11   0  86   0   0   0   0   0   0   1   0   0   0   0   0   0   233    0    0   0.517     17  0.94
   92   88 L   0   0   0   0   0   0   0   0   0   0   1   0  97   0   0   0   0   0   0   0   233    0    0   0.152      5  0.96
   93   89 L   2   7   0   6   1   1   3   6  13   0  10   0   4   0   1   2  41   1   2   0   233    0    0   2.075     69  0.21
   94   90 L  10   8   3   0   0   0   0   5   7   0  25  12   0   1   1   0  25   1   1   0   233   27   28   2.071     69  0.15
   95   91 L   1   1   0   0   2  30  46   5   1   0   3   1   0   2   1   1   0   2   1   1   206    0    0   1.673     55  0.43
   96   92 L   2   1   1   0   0   2   3   4   8   2  15   7   0   7   3   3   4   3   5  31   213   16  150   2.397     80  0.22
   97   93 L   3   3   0   0   1   0   1  11  11   2  23   8   4   9   1   1   4   7   8   2   212    0    0   2.475     82  0.21
   98   94 L  22  20   8   1  11  11   9   0   1   1   9   2   2   1   1   0   0   0   1   0   216  109   48   2.225     74  0.27
   99   95 L   8   1   1   0   0   3   0   5   6  45   4   7  10   3   3   1   1   1   2   0   119    0    0   1.999     66  0.25
  100   96 L  11   4   1   0   8  14  17   4   3  12   4   7   1   6   5   0   1   0   2   0   155    0    0   2.470     82  0.10
  101   97 L  40   1   9   1   1   0   1   1   2   0   3  35   0   2   0   0   0   0   1   0   200    0    0   1.646     54  0.35
  102   98 L   0   1   1   0  89   3   1   0   0   0   2   0   0   1   0   0   0   0   0   0   231    0    0   0.580     19  0.84
  103   99 L   0   0   0   0   0   1   0  89   1   0   4   1   0   0   0   0   1   0   1   0   233    0    0   0.555     18  0.82
  104  100 L   1   0   1   0   0   0   0  45   6   2  13   7   0   0   0   6  16   2   0   0   233    0    0   1.736     57  0.37
  105  101 L   0   0   0   0   0   0   0  91   0   1   3   0   0   0   1   0   0   2   0   0   233    0    0   0.485     16  0.85
  106  102 L   0   1   1   0   0   0   0   0   0   1   2  92   0   0   0   0   0   1   0   1   233    0    0   0.453     15  0.85
  107  103 L   0   0   0   1   0   0   0   0   1   0   3   8   0   1  12  51  16   4   2   0   233    0    0   1.577     52  0.46
  108  104 L  19  75   1   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   232    0    0   0.790     26  0.77
  109  105 L   5   3   6   0   1   0   0   0   2   1   3  50   0   0   0   0   0  24   1   3   233    0    0   1.643     54  0.31
  110  106 L  61  10  23   0   1   0   0   0   0   0   1   0   1   0   0   0   0   0   0   0   233    0    0   1.196     39  0.70
  111  107 L   0  46   1   0   1   0   0   3   0   2   2   8   1   0   2  24   1   0   3   2   233    0    0   1.763     58  0.13
  112  108 L   1   3   0   0   0   0   0  38   1   0  13   9   0   0  29   1   2   0   0   1   233   12   25   1.647     54  0.20
  113  109 L   0   0   0   0   0   0   0   5  15   0  13   5   0   2   0   0  46   1   2  11   221    0    0   1.675     55  0.32
  114  110 L  23   1   0   0   0   0   0   1   0  47   8   0   0   1   0   0   1   0   0  16   226    3  129   1.431     47  0.28
  115  111 L   9   0   0   0   0   0   0   0  59   4  16   1   0   0   4   7   0   0   0   0   225    0    0   1.332     44  0.42
  116  112 L   1   0   1   0   0   0   0   0  50  13  10   3   0   0   3   8   2   3   6   0   229    0    0   1.760     58  0.38
  117  113 L   0   0   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   229    0    0   0.140      4  0.96
  118  114 L  11   3   0   0   0   0   0   0   3   0  54  26   0   0   0   0   1   0   0   0   232    0    0   1.268     42  0.40
  119  115 L  77  15   3   1   0   0   0   0   1   0   0   1   0   0   0   1   0   0   0   0   233    0    0   0.861     28  0.74
  120  116 L   0   0   1   0  15   0   0   1   0   0  23  55   1   1   0   1   0   0   0   0   233    0    0   1.319     44  0.32
  121  117 L  14  55  28   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   233    0    0   1.112     37  0.68
  122  118 L   0  12   1   0  86   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   233    0    0   0.470     15  0.93
  123  119 L   0   1   0   0   0   0   0   1   4  85   0   0   0   0   0   3   2   0   0   0   233    0    0   0.697     23  0.75
  124  120 L   0   0   0   0   0   0   0   0   0  95   2   0   0   0   0   0   0   0   0   0   233    0    0   0.280      9  0.90
  125  121 L   0   0   0   0   1   0   0   0   0   0  95   0   0   0   0   0   0   1   0   0   233    0    0   0.292      9  0.89
  126  122 L   3   1   0   1   0   0   0   0   4   3  51  12   0   0   2   4   2  10   0   6   233    0    0   1.742     58  0.35
  127  123 L   0   2   1   0   0   0   0   0   9   0   0   0   0   0   0   0   1  77   0   9   233    0    0   0.872     29  0.69
  128  124 L   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0  27  70   0   0   233    0    0   0.788     26  0.70
  129  125 L   8  76  13   1   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   233    0    0   0.811     27  0.77
  130  126 L   0   0   0   0   0   0   0   2   8   0  10   9   0   2   1  16  40   2   6   2   233    0    0   1.880     62  0.30
  131  127 L   0   1   0   0   0   0   0   6  30   0  27  17   0   0   0   3   6   2   5   2   233    0    0   1.860     62  0.32
  132  128 L   0   0   0   0   0   0   0  33   0   0   1   0   0   0   0   9   0   0  52   2   233   17    8   1.233     41  0.46
  133  129 L   0   0   0   0   0   0   0  10   1   0   6  18   0   0   1  61   0   1   1   0   216    0    0   1.256     41  0.40
  134  130 L   4   0   0   0   0   0   0   0  90   1   0   1   0   0   0   3   0   0   0   0   225    0    0   0.481     16  0.80
  135  131 L   0   0   0   0   0   0   0   0   5   0  23  71   0   0   0   0   0   0   0   0   226    0    0   0.781     26  0.60
  136  132 L  27  66   0   0   0   0   0   0   1   0   4   0   0   0   0   0   0   0   0   0   226    0    0   0.887     29  0.65
  137  133 L  86  10   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   226    0    0   0.527     17  0.85
  138  134 L   4   0   0   0   0   0   0   0   0   0   0   0  96   0   0   0   0   0   0   0   227    0    0   0.181      6  0.91
  139  135 L   3  75   1   1   8   0   0   0   0   0   7   1   4   0   0   0   0   0   0   0   228    0    0   1.004     33  0.60
  140  136 L   6  32  43   7   0   0   0   0   8   0   4   0   0   0   0   0   0   0   0   0   228    7    2   1.426     47  0.51
  141  137 L   0   0   0   0   0   0   0   0   0   1  58   2   0   0   0   0   0   1  37   0   221    0    0   0.913     30  0.52
  142  138 L   0   0   0   0   0   0   0  10   0   0   9   0   0   4   0   3   0   0  18  56   225    0    0   1.370     45  0.50
  143  139 L   0   0   0   0  86   0   1   5   0   0   1   0   0   0   0   0   6   1   0   0   226    0    0   0.592     19  0.58
  144  140 L   0   0   0   0   8   0  73   0   0   0  10   7   0   0   0   0   0   0   0   0   226    0    0   0.920     30  0.54
  145  141 L   2   0   0   0   0   0   0   4   0  92   0   0   0   0   0   1   0   0   0   0   226    0    0   0.393     13  0.83
  146  142 L   0   0   0   0   0   0   0  45   0   7   9   0   0   0  21  12   0   0   4   0   227    0    0   1.595     53  0.25
  147  143 L   4   0   0   0   7   0   0   9  30   2  10   7   0   0   0   0   1   7   1  21   228    0    0   2.066     68  0.21
  148  144 L  50   7  14   0   0   5   0   0  24   0   0   0   0   0   0   0   0   0   0   0   228    0    0   1.339     44  0.40
  149  145 L   2   0   0   0   0   0   0   0   0   0   4  47   0   0   3  15   4   4  14   7   228    0    0   1.689     56  0.32
  150  146 L  89   8   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.447     14  0.87
  151  147 L   9   0   0   0   0   0   0   1  38   0   7   6   0   0   0  26   4   5   1   2   228    0    0   1.821     60  0.24
  152  148 L   0   1   0   0   0  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   228    0    0   0.098      3  0.96
  153  149 L   1   9   0   3   0   0   0   0   0   0   0   2   0   0   2  75   7   0   0   0   229    0    0   0.998     33  0.55
  154  150 L  31   2  10   0   0   0   0   0  42   0   3   0   0   0   1   4   0   4   0   0   229    0    0   1.581     52  0.32
  155  151 L   0   1   0   0   0   0   0   9   1   0   1   0   0   0   0   0   0   1   7  80   229    0    0   0.772     25  0.76
  156  152 L   0   0   0   3   0   0   0  69   0   0  14   1   0   0   0   1   0   0   5   5   230    1    0   1.104     36  0.62
  157  153 L  14   0   0   0   0   0   0   2   4   1  53   7   0   0   0  10   1   1   5   0   229    0    0   1.592     53  0.34
  158  154 L   7   6   1   0   0   0   0   0   7  34   8  17   0   0   1   0   1  15   0   4   229    0    0   1.961     65  0.24
  159  155 L  48   1  10   0   0   0   0   1   1   0   3   1   1   0  11   6  16   0   0   0   231    0    0   1.667     55  0.25
  160  156 L   3   1   1   0   0   0   0   0   0   1  25  26   0   0   6  20   8   0   7   1   232    0    0   1.895     63  0.25
  161  157 L   0   0   0   0   0   0   0   8  25   1  12   7   0   0   5   1  12   2   8  19   233    0    0   2.089     69  0.29
  162  158 L   1   0   0   0   0   0   0  72   1   0   9   1   0   0   0   0   0   2  13   1   233  165   19   0.976     32  0.66
  163  159 L  31   0  24   0  12   1   0   1   6   0  21   0   0   0   0   0   0   0   0   4    68    7    2   1.709     57  0.24
  164  160 L  62  11  10   1   0   0   0   0   0   0   0   0   0   0   0   0  14   1   0   0   212    0    0   1.161     38  0.52
  165  161 L   3   0   0   0   0   0   0   0   0   0   9   1   0   0   0   6   8  54  11   6   216    0    0   1.537     51  0.45
  166  162 L   0   1   0   0   0   0   0   1   0   0  32  62   0   2   0   0   0   0   1   0   224    0    0   0.915     30  0.51
  167  163 L   8   0   5   0   2   8   0   1   0   0  26  49   0   0   1   0   0   0   0   0   224    0    0   1.439     48  0.28
  168  164 L   0   3   0   0   0   0   0  10   1   1   4  48   0   0   4  22   4   0   0   1   225    0    0   1.643     54  0.34
  169  165 L   1   7   0   0   0   0   1   1  16  42   4   0   0   0   0   0   0  14   0  11   226    0    0   1.777     59  0.25
  170  166 L  14   1   0   1   0   0   0   2   2   0  51   0   0   0   0   0  26   2   0   0   229    0    0   1.381     46  0.23
  171  167 L   1   4   0   0   0   0   0   0   0   0   2   4   0   0   4  55   7   0   1  22   229    0    0   1.420     47  0.38
  172  168 L   0   1   0   0   0   0   0   6   0   1  23   0   0   0   2   0  62   3   0   1   232    0    0   1.189     39  0.40
  173  169 L   0   0   0   0   0   0   0   1   3   5  59   1   0   0   1  24   3   1   1   0   232    0    0   1.298     43  0.42
  174  170 L   0   0   0   0   0   0   0   0   0   1   1   0   0   0   0   3   0   2  45  46   232    0    0   1.094     36  0.60
  175  171 L   0   0   0   0   0   0   0   6   0   0  27   0   0   4   0   1   8   0  51   2   232    0    0   1.376     45  0.43
  176  172 L   1   9   0   0   0   0   0   1   0   0   5  33   0   1   3  44   2   0   0   0   232    6    5   1.460     48  0.28
  177  173 L   0   0   0   0   7   0  92   0   0   0   0   0   0   0   0   0   0   0   0   0   226    0    0   0.328     10  0.95
  178  174 L   5   0   0  12   0   0   0   0  38   0  36   1   0   4   0   0   4   0   0   0   226    0    0   1.492     49  0.27
  179  175 L   5  15   7   9   0   5   0   0  48   0   0   1   1   0   0   0   1   7   0   0   227    0    0   1.677     55  0.20
  180  176 L   0   0   0   0   0   0   0   0   0   0  97   1   0   0   0   0   0   0   0   0   229    0    0   0.182      6  0.94
  181  177 L   0   0   0   0   0   0   0   0   0   0  98   0   0   0   0   0   0   0   1   0   229    0    0   0.134      4  0.96
  182  178 L   1   0   3   1   1   0  60   0   0   1   3  28   0   0   0   0   0   0   0   0   230    0    0   1.147     38  0.28
  183  179 L   0  99   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   231    0    0   0.078      2  0.98
  184  180 L   0   0   0   0   0   0   0   0   6   0  55  33   0   0   2   1   0   0   2   0   231    0    0   1.123     37  0.46
  185  181 L   5  83   5   5   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   231    0    0   0.706     23  0.85
  186  182 L   0   0   0   0   0   0   0   0   0  13  21  56   0   0   0   1   7   0   0   1   230    1    0   1.245     41  0.41
  187  183 L   1   0   0   0   0   0   0   0  23  29  24   4   0   0   2  15   0   1   0   0   227    0    0   1.702     56  0.33
  188  184 L   0   1   0   0   0   0   0   1   7   0  21   7   0   0   1   0  11  20   1  29   228    0    0   1.865     62  0.36
  189  185 L   4   0   0   0   0   0   0   0   2   0   0   0   0   0   0   8  39  25   0  22   228    0    0   1.483     49  0.50
  190  186 L   0   0   0   0   0  76  24   0   0   0   0   0   0   0   0   0   0   0   0   0   226    0    0   0.577     19  0.87
  191  187 L   0   8   0   1   0   0   0   0   4   0   2   1   0   0   3  43  10  18   9   2   226    0    0   1.790     59  0.29
  192  188 L   0   0   0   7   0   0   0   0   0   0  59   0   0   0  16  15   0   1   0   0   226    0    0   1.238     41  0.38
  193  189 L   2   0   0   0   0   0   2   1   7   0   2   0   0  63   5   6   0   0   1  10   224    0    0   1.362     45  0.45
  194  190 L   0   0   0   0   0   0   0   7   4   0  15   0   0   0  15  21   1  10  19   8   224    0    0   2.040     68  0.29
  195  191 L  16   4   1   0   0   0   0   0   5   0  53   8   0   0   5   2   3   0   1   0   224    0    0   1.610     53  0.28
  196  192 L   5   0   0   0   8   0  86   0   0   0   0   0   0   0   0   0   0   0   0   0   224    0    0   0.512     17  0.86
  197  193 L   0   0   0   0   0   0   0   0  12   0  61  24   0   0   0   0   0   1   0   0   223    0    0   1.005     33  0.51
  198  194 L   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   223    0    0   0.000      0  1.00
  199  195 L   4   3   0   0   0   0   0   0   0   0   0   0   0   8   3  17  29  36   0   0   212    0    0   1.618     54  0.38
  200  196 L  86   0   1   0   0   0   0   0  13   0   0   0   0   0   0   0   0   0   0   0   212    0    0   0.454     15  0.78
  201  197 L   1   0   0   0   0   0   0   0   0   0  17  77   0   0   1   2   1   0   0   0   212    0    0   0.779     25  0.64
  202  198 L   0  10   0   0   0   0   0   0   0   0   0   0   0  88   1   0   1   0   0   0   212    0    0   0.428     14  0.72
  203  199 L   0   0   0   0   0   0   0   9   2   0   2   0   0   0   0  17  19  43   1   7   211    0    0   1.598     53  0.43
  204  200 L   1   0   0   0   0   0   0  62   0   0  23  12   0   0   0   0   0   0   1   0   211    0    0   1.025     34  0.58
  205  201 L   0  22   0   0   0   0   0   2   0   0  47   2   0   3   0   9  12   1   3   0   187    0    0   1.546     51  0.17
  206  202 L   0   0   0   1   0   0   0   0   3   3  11  80   0   0   0   0   1   0   1   2   187    0    0   0.766     25  0.69
  207  203 L   0   0   0   0   0   0   0   9  16   6  60   6   0   0   0   1   3   0   0   0    90    0    0   1.296     43  0.48
  208  204 L   0   1   0   0   0   0   0   0   3  81   0  10   0   0   0   0   0   4   0   0    67    0    0   0.717     23  0.67
  209  205 L  21  46  31   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    67    0    0   1.110     37  0.70
  210  206 L  49   2   3   0   0   0   0   0   0   0   2  44   0   0   0   0   0   0   0   0    63    0    0   0.950     31  0.46
  211  207 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  86  13   0   0   2    63    0    0   0.460     15  0.74
  212  208 L   0   0   0   0   0   0   0   0   0   0  86  14   0   0   0   0   0   0   0   0    63    0    0   0.410     13  0.72
  213  209 L   0   0  14   0  86   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    63    0    0   0.410     13  0.81
  214  210 L   0   0   0   0   0   0   0   0   0   0  11   0   0   0  29   0   6   2  52   0    63    0    0   1.182     39  0.37
  215  211 L   0   0   0   0   0   0   0   0   0   0   0   0   0   0  74  26   0   0   0   0    54    0    0   0.572     19  0.80
  216          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  217    1 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  38  53   0   8   213    0    0   0.938     31  0.70
  218    2 H  69   1  12   0   0   0   0   0   1   0   0   0   0   0   0   0   0  15   0   0   215    0    0   0.962     32  0.62
  219    3 H   1   1   0   0   0   0   0   0   0   0   0  10   0   5   1  19  61   0   1   0   215    0    0   1.257     41  0.48
  220    4 H   3  96   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   231    0    0   0.206      6  0.96
  221    5 H  48   6   0   1   0   0   0   0   2   0   3  11   0   1   0   4  18   2   0   3   231    0    0   1.703     56  0.25
  222    6 H   0   1   0   0   0   0   0   0   0   0   2   0   0   0   0   0  40  56   0   0   232    0    0   0.853     28  0.65
  223    7 H   0   0   0   0   0   0   0   0   1  10  85   3   0   0   0   1   0   0   0   0   232    0    0   0.556     18  0.78
  224    8 H   1   0   0   0   0   0   0  83   2   0   0   0   0   0   0   2   0  11   0   1   232    0    0   0.673     22  0.75
  225    9 H   0   0   0   0   0   0   0  45  18  21  14   1   0   0   0   0   0   0   0   0   232    0    0   1.372     45  0.49
  226   10 H  14   0   0   0   0   0   0  50   2   0   1   0   0   0   0   0   0  28   0   4   232    0    0   1.293     43  0.45
  227   11 H  27  66   5   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   233    0    0   0.894     29  0.73
  228   12 H  66   3   3   0   0   0   0   0   4   0   0   0   0   0   2  21   0   0   0   0   233    0    0   1.091     36  0.45
  229   13 H   0   1   0   0   0   0   0   0   1   0   0   0   0   0  12  42  39   1   2   0   233    0    0   1.279     42  0.51
  230   14 H   1   2   0   0   0   0   0   0   0  94   1   1   0   0   0   0   0   0   0   0   233    0    0   0.317     10  0.88
  231   15 H   0   0   0   0   0   0   0  83   1   0  13   0   0   0   1   0   0   1   0   0   233    0    0   0.601     20  0.79
  232   16 H   1   0   0   0   0   0   0  40  18   0   4   3   0   0   5   1   6  19   0   2   233    1    0   1.769     59  0.40
  233   17 H   0   0   0   0   0   0   0   0   0   0  86  12   0   0   0   0   0   0   0   0   232    0    0   0.496     16  0.78
  234   18 H  27  57   1   2   0   0   1   0   0   0   0   0   0  10   1   0   0   0   0   0   232    0    0   1.146     38  0.54
  235   19 H   0   1   0   0   0   0   0   0   0   0  12   5   0   0  45  35   0   0   0   0   233    0    0   1.275     42  0.50
  236   20 H   9  80   8   3   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   233    0    0   0.718     23  0.85
  237   21 H   0   0   0   0   0   0   0   0   2   0  77  18   0   0   0   0   0   1   0   0   233    0    0   0.731     24  0.66
  238   22 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   234    1    0   0.028      0  0.99
  239   23 H  18   0   1   0   0   0   0   0  23   0   6  22   0   0   2  25   1   2   0   0   233    0    0   1.762     58  0.25
  240   24 H  19   0   1   0   2   0   0  19  52   1   0   5   1   0   0   0   0   0   0   0   233    0    0   1.352     45  0.46
  241   25 H   0   0   0   0   0   0   0   0   0   1  95   2   0   0   0   0   0   0   0   0   234    6    0   0.289      9  0.91
  242   26 H   0   0   0   0   0   0   0  96   1   0   0   0   0   0   0   0   0   0   0   1   228   29    4   0.204      6  0.96
  243   27 H   1   3   3   0  61   0  25   5   0   0   1   0   0   1   0   0   0   0   1   2   199    0    0   1.179     39  0.70
  244   28 H   0   0   2   1   0   0   0   2   2   2  18  62   0   0   1   1   0   0   1   5   201    0    0   1.352     45  0.51
  245   29 H   4   7   6   0  76   0   3   2   0   0   0   0   0   0   0   0   0   0   0   2   232    0    0   0.967     32  0.73
  246   30 H   0   0   1   0   0   0   0   5   0   0  55  24   0   0   4   2   0   1   6   2   232    0    0   1.387     46  0.46
  247   31 H   2   6   2   1   4   0   0   3   0   0  37   7   0   0   4   3   0   1  11  18   234  166    0   2.048     68  0.22
  248   32 H   0   0   1   0   3   0   4   3   3   0  44  10   0   1   1   6   3   0  13   6    68    0    0   1.935     64  0.29
  249   33 H   0   4   7   0   0   1   0  16  11   0  33   3   0   0   1   0   0   1   7  15    73    0    0   1.963     65  0.29
  250   34 H   1   2   2   4   4   0  70   0   3   0   3   3   0   6   0   0   0   0   3   0   234   10    0   1.320     44  0.53
  251   35 H   1   0   1   0   3  18  21  12  18   2   6   3   1   4   0   0   0   3   3   4   224    3    0   2.306     76  0.10
  252   35 H   9   2  20  56   3   9   0   0   0   0   0   0   0   0   0   0   0   0   0   0   222    0    0   1.288     42  0.54
  253   35 H   1   0   1   0   0   0   6   6   2   0  21   4   0  29   0   0   0   1  23   5   231    1    0   1.956     65  0.27
  254   36 H   0   0   0   0   1  97   0   0   0   0   0   0   0   0   1   0   0   0   0   0   233    0    0   0.154      5  0.99
  255   37 H  77   1  19   1   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   233    0    0   0.705     23  0.86
  256   38 H   0   0   0   0   0   1   0   0   0   0   0   0   0   0  84  14   0   0   0   0   234    1    0   0.535     17  0.85
  257   39 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0  98   0   0   0   233    0    0   0.124      4  0.97
  258   40 H   2   0   0   0   3   0   0   0  61   7   9   3   0   0   9   3   1   0   0   0   233    0    0   1.459     48  0.41
  259   41 H   0   0   0   0   0   0   0   0   1  87   5   2   0   4   0   0   1   0   0   0   234    0    0   0.561     18  0.80
  260   42 H   0   0   0   0   0   0   0  91   1   0   1   0   0   0   0   1   0   6   0   0   234    0    0   0.415     13  0.89
  261   43 H   0   0   0   0   0   0   0   0   1   0   1   0   0   1   6  72  16   0   2   0   234    0    0   0.983     32  0.65
  262   44 H   0   0   0   0   0   0   0  85   3   0   5   1   0   0   5   1   0   0   0   0   234    0    3   0.635     21  0.76
  263   45 H   0  96   1   0   1   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   234    0    0   0.221      7  0.93
  264   46 H   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   5  92   0   1   234    0    0   0.382     12  0.89
  265   47 H   0   0   0   0   1  93   2   0   0   0   1   0   1   0   0   0   0   0   0   0   234    0    0   0.371     12  0.90
  266   48 H  29  29  27  14   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   234    0    0   1.369     45  0.68
  267   49 H   1   1   0   0   0   0   0  40  39   0  18   1   0   0   0   0   0   0   0   0   234    0    0   1.211     40  0.57
  268   50 H   5   2   1   2   4   8  16   9  18   0   5   7   1   3   9   1   3   3   3   1   234    0    0   2.593     86  0.07
  269   51 H   5   2  82   3   4   0   1   0   0   0   0   2   0   0   0   0   1   0   0   0   234    0    0   0.828     27  0.80
  270   52 H   0   0   4   0   1   6  12   5   5   0  25   3   1   3   6   0   0   0  18  10   234    0    0   2.291     76  0.16
  271   53 H   1   2   0   0   2   3  11   6   2  21  20  17   0   2   2   1   0   0   6   4   234    2   78   2.285     76  0.15
  272   54 H   0   0   1   0   0   0   0  22   2   1  23   4   0   0   1   2   3   4  15  21   232   49  111   1.972     65  0.39
  273   55 H   1   0   1   0   0   0   1  68   1   0  16   4   0   1   1   0   0   1   2   4   185    0    0   1.171     39  0.63
  274   56 H   1   0   0   1   0   0   2  10   1   2  34   9   0   1   5   2   1   6  13   9   200    0    0   2.190     73  0.29
  275   57 H   1   0   8   0   0   0   0   0   4   4   5  62   0   0   0  10   2   1   2   0   215    0    0   1.457     48  0.46
  276   58 H   2   0   3   0   2   4  50   1   1   0   5   5   0   5   2   6   0   4   6   4   222    0    0   1.957     65  0.23
  277   59 H   0   1   2   0   3   0  90   0   0   0   0   0   0   1   0   0   0   0   0   0   227    0    0   0.541     18  0.85
  278   60 H   3   0   0   0   0   0   0   1  52   3  13   6   0   0   1   0   0   0  19   1   231    0    0   1.485     49  0.43
  279   61 H   0   0   0   0   0   0   0   1   2  17   3   0   0   0   1   0  18  15   2  40   234    0    0   1.700     56  0.44
  280   62 H   0   0   0   0   1   0   0   1  10   1  59   3   0   0   2  17   0   0   3   1   234    0    0   1.404     46  0.45
  281   63 H  52  16   0   1  28   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   234    0    0   1.158     38  0.57
  282   64 H   0   0   0   0   0   0   0   0   0   0   0   3   0   0   8  71  15   2   0   0   234    0    0   0.959     32  0.66
  283   65 H   0   0   0   0   0   0   0  73   0   0  11   1   0   0   0   0   0   1   4   9   234    0    0   0.975     32  0.68
  284   66 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0  82  15   3   0   0   0   234    0    0   0.556     18  0.83
  285   67 H   9  10   4   0  59   0   0   0  15   0   1   0   0   0   0   0   0   0   0   0   234   14    1   1.312     43  0.45
  286   68 H   2   0   2   0   0   0   0   0   3   0   6  85   0   0   0   0   0   1   1   0   220    0    0   0.689     23  0.75
  287   69 H   5  17  68   4   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   220    0    0   1.040     34  0.75
  288   70 H   0   0   1   0   0   0   0   0   0   0  65  28   0   0   0   0   0   4   1   0   234    0    0   0.900     30  0.55
  289   71 H  10   3   5   0   0   0   0   1  10   2   3   2   0   0  52  12   0   0   0   0   234    0    0   1.659     55  0.29
  290   72 H   0   0   0   0   0   0   0   0   0   0   6   0   0   0   0   0   0   5   1  86   234    1    0   0.582     19  0.81
  291   73 H   1   0   0   0   0   0   0   0   2   0   0  24   0   0   0  17   0   2  42  10   233    0    0   1.513     50  0.39
  292   74 H   0   0   0   0   0   1   0   1  21   3  63   2   0   0   0   0   0   0   5   4   233    0    0   1.202     40  0.55
  293   75 H   2   2   1   0   0   0   0   2   1   0  22   6   0   0   4  36  15   1   7   0   234    0    0   1.881     62  0.29
  294   76 H   0   0   0   0   0   0   0   3   1   0  28   3   0   0   0   3   0   0  59   3   234    0    0   1.171     39  0.52
  295   77 H   0   2   3   5   0   0   0   0   3   0  10  56   0   0   0   5  11   3   1   0   234    0    0   1.603     53  0.36
  296   78 H  20  35   3   0   6   0   0   0  35   0   0   0   0   0   0   0   0   0   0   0   234    0    0   1.390     46  0.39
  297   79 H   0   1   0   0  12   0  76   0   0   0   5   0   0   2   0   0   1   0   2   0   234    0    0   0.928     30  0.72
  298   80 H   0  79   0  21   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   234    0    0   0.561     18  0.95
  299   81 H   0   0   0   0   0   0   0   0   0   0   1   0   0   3   3   6  69  13   1   2   234    0    0   1.180     39  0.63
  300   82 H   6  31   9  52   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   234    0    0   1.181     39  0.77
  301   82 H   0   0   0   0   0   0   0   0   1   0  21  16   0   1   7   3   0   0  44   6   234    0    0   1.599     53  0.37
  302   82 H   0   0   0   0   0   0   0   6   1   0  74   1   0   0   3   2   0   0  12   0   234    0    0   0.966     32  0.65
  303   82 H   9  85   0   4   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   234    0    0   0.580     19  0.87
  304   83 H   0   0   0   0   0   0   0   0   0   0   3  25   0   0  47  16   4   0   0   2   234    0    0   1.420     47  0.38
  305   84 H   8   0   0   0   1   0   0   0  26   6  29  26   0   0   0   0   0   0   1   1   234    0    0   1.671     55  0.34
  306   85 H   0   0   0   0   0   0   0   1   7   0   2   0   0   0   0   0   0  75   1  12   234    0    0   0.891     29  0.74
  307   86 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   1  98   234    0    0   0.118      3  0.98
  308   87 H   0   0   0   2   0   0   0   0   1   0  21  76   0   0   0   0   0   0   0   0   234    0    0   0.663     22  0.67
  309   88 H   0   0   0   0   0   0   0   4  96   0   0   0   0   0   0   0   0   0   0   0   234    0    0   0.190      6  0.95
  310   89 H  51   2  11   7   2   0   0   0   0   0   0  12   0   1  13   0   1   0   0   0   234    0    0   1.541     51  0.42
  311   90 H   0   0   0   0   1   0  98   0   0   0   0   0   1   0   0   0   0   0   0   0   234    0    0   0.098      3  0.99
  312   91 H   0   0   0   0  13   1  85   0   0   0   0   0   0   1   0   0   0   0   0   0   234    0    0   0.487     16  0.96
  313   92 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   234    0    0   0.028      0  0.98
  314   93 H   6   0   0   0   0   0   0   3  76   0   2  13   0   0   0   0   0   0   0   0   234    1    0   0.850     28  0.70
  315   94 H   0   0   2   0   0   0   0   3   0   0   6   6   0   0  69  10   0   0   1   0   233    0    0   1.227     40  0.55
  316   95 H   2   3   1   1   0   2   3  24   3   3   5   4   2   6   3   1   1   7   3  25   233    0    0   2.422     80  0.23
  317   96 H   3   6   2   2   3   1   9  16   4   6   8  14   1   1   8   1   3   3   4   5   233    0    0   2.701     90  0.09
  318   97 H   7   5   3   2   3   5  13  16   6   3   6   5   1   3   3   1   6   3   3   7   233    0    0   2.768     92  0.07
  319   98 H   7   6   2   2   3   3  16  11   5   3  11   3   3   3   9   0   2   0   3   7   234    0    0   2.686     89  0.06
  320   99 H   5   6   3   0   5   4  17  16   6   3  10   4   2   1   4   0   0   2   3   7   234    0    0   2.630     87  0.08
  321  100 H   3   4   1   1   8   5  14  18  10   3  10   3   3   2   1   0   1   1   3   9   234   95  118   2.589     86  0.09
  322  100 H   0   1   1   0   4   8  25   9   3   6   6   6   1   4   0   1   3   3   9  10   139    0    0   2.476     82  0.09
  323  100 H   2   3   1   1   3   7  23  12  19   6   6   2   1   2   3   1   1   2   3   2   161    0    0   2.450     81  0.09
  324  100 H   2  11   4  18  53   0   1   2   0   0   1   2   0   2   1   1   1   2   0   0   185    1    0   1.603     53  0.52
  325  101 H   0   0   0   0   0   0   1   3   7   2   5   1   0   1   0   1   1   2   3  69   205    0    0   1.347     44  0.59
  326  102 H  10  16   3   0   7   0  47   2   1   3   2   1   1   2   0   0   1   0   3   0   212    0    0   1.878     62  0.33
  327  103 H   0   1   0   0   0  95   0   0   0   0   1   0   0   0   1   0   0   0   0   0   221    0    0   0.290      9  0.92
  328  104 H   1   0   0   0   0   0   0  95   0   1   2   0   0   0   0   0   0   0   0   0   229    9    7   0.280      9  0.92
  329  105 H   0   0   0   0   0   0   0   0   4  20   4   0   0   0   5   4  59   0   1   0   223    0    0   1.327     44  0.48
  330  106 H   0   0   0   0   0   0   0  96   0   0   1   0   0   0   0   0   0   0   0   0   228    0    0   0.247      8  0.93
  331  107 H  16   2   3   0   0   0   0   0   4   1   1  72   0   0   0   0   1   0   0   0   233    0    0   1.006     33  0.61
  332  108 H   2  29   0  14   5   0   0   0   1   3   6  17   0   0   1   4   2  12   1   1   234    0    0   2.150     71  0.21
  333  109 H  80  11   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   234    0    0   0.764     25  0.80
  334  110 H  12   1   3   0   0   0   0   0   2   0   3  72   1   0   0   0   0   5   0   0   234    0    0   1.080     36  0.59
  335  111 H  93   2   2   0   0   0   0   0   1   0   1   0   0   0   0   0   0   0   0   0   234    0    0   0.372     12  0.90
  336  112 H   0   0   0   0   0   0   0   0   3   0  79  15   0   0   0   0   0   0   0   0   234    0    0   0.743     24  0.68
  337  113 H   0   1   0   0   0   0   0   1   7   1  87   0   0   0   0   0   1   0   0   0   234    0    0   0.589     19  0.80
  338  114 H   6   1   0   0   0   0   0   3  62   0   1   1   0   0   0   0   0  21   0   3   234    0   24   1.249     41  0.48
  339  115 H   2   0   1   0   0   0   2   1   4  29  39   8   0   0   0   8   1   3   0   2   234    0    0   1.786     59  0.34
  340  116 H   0   2   0   0   0   0   0   2  19  12   7  36   0   0   0  12   8   0   2   0   234    0    0   1.864     62  0.27
  341  117 H   3   0   2   0   0   0   0   0   5   0   9  34   0   2  17  26   0   0   2   0   234    0    0   1.777     59  0.26
  342  118 H   0   0   0   0   0   0   0  21  30   8  15   0   0   0   1   4   1  13   6   0   234    0    0   1.913     63  0.34
  343  119 H   0   2   0   0   0   0   0   0   0  91   1   0   1   0   0   0   3   0   0   1   234    0    0   0.480     16  0.82
  344  120 H   1   3   1   0   0   0   0   0   0   0  59  21   0   0   2   7   2   1   1   2   234    0    0   1.354     45  0.42
  345  121 H  71   7  17   0   0   0   0   0   0   0   2   1   0   0   0   0   1   0   0   0   234    0    0   0.956     31  0.74
  346  122 H   1   2   0   0  49   0  46   0   0   0   0   0   0   0   0   0   2   0   0   0   234    0    0   0.925     30  0.85
  347  123 H   1   3   3   0   0   0   0   3   0  88   0   2   0   0   0   0   0   0   0   0   234    0    0   0.587     19  0.73
  348  124 H   2  90   0   1   0   0   0   0   0   0   5   0   0   0   0   0   2   0   0   0   234    0    0   0.465     15  0.77
  349  125 H   4   0   6   1   0   0   0   0  45   1  16  18   0   0   3   1   0   2   3   0   234    0    0   1.710     57  0.31
  350  126 H   0  14   0   0  12   1   0   0   1  57   7   3   0   0   0   0   4   0   0   0   234    0    0   1.397     46  0.23
  351  127 H   4   0   0   0   0   0   2   9   0  16  23   0  39   0   0   0   2   0   0   3   234    0    0   1.704     56  0.34
  352  128 H   1   0   0   0   0   0   0  19   0   3  39   3  15   0   2   0  13   3   1   0   234    0    0   1.728     57  0.33
  353  129 H   0   0   0   0   0   0   0  11  21   2   6  12   0   0  21  13   0   5   1   7   234   89   33   2.140     71  0.20
  354  130 H   5  10   1   0   0   0   0   1   4   2  40   0   0   0   0   2   0   0   4  31   145    0    0   1.619     54  0.24
  355  133 H   2  18   0   0   0   0   0   5   0   4  10  41   0   0   1   5   9   0   0   4   219    0    0   1.862     62  0.18
  356  134 H   0   0   0   0   2   0   0   0   0   9  68   9   0   0   0   0   3   0   5   3   231    0    0   1.189     39  0.52
  357  135 H   0   0   0   3   0   0   0  39   2   0  17   0   0   0   0   0   5   9   7  16   232    0    0   1.777     59  0.40
  358  136 H   0   0   0   0   0   0   0  29   2  13  21   2   0   1   0   0   1   0   3  28   232    0    0   1.691     56  0.41
  359  137 H   0   3   0   5   0   0   0   0   0  20  12  25   0   4   0   1   2   6  22   0   232    0    0   1.978     66  0.20
  360  138 H  65   3   9   0   0   0   0   0  21   0   0   2   0   0   0   0   0   0   0   0   233    0    0   1.045     34  0.61
  361  139 H  11   0  16   0   0   0   0   0  40   0   6  25   0   0   1   0   0   0   0   0   234    0    0   1.501     50  0.32
  362  140 H   8  60  28   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   234    0    0   1.002     33  0.73
  363  141 H   3   3   0   0   0   0   0  81   9   0   2   2   0   0   0   0   0   0   0   0   234    0    0   0.766     25  0.72
  364  142 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   234    0    0   0.028      0  0.99
  365  143 H   0  92   1   2   1   0   0   0   0   0   0   0   0   0   0   1   1   0   0   0   234    0    0   0.430     14  0.88
  366  144 H  56   0  16   0   0   0   0   0  25   0   2   0   0   0   0   0   0   0   0   0   234    3    2   1.120     37  0.54
  367  145 H   0   1   0   0   0   0   0   0   0   0  19   3   0  16   3  45  11   0   0   0   231    0    0   1.546     51  0.31
  368  146 H   0   0   0   0   0   0   0  30   0   0  16   0   0   0   0   0   0   0   0  53   234    0    0   1.084     36  0.59
  369  147 H   0   0   0   0  32   0  67   0   0   0   0   0   0   0   0   0   0   0   0   0   234    0    0   0.679     22  0.94
  370  148 H   0   9   0   2  75   0   1   0   0   0   5   2   0   3   0   0   3   0   0   0   234    0    0   1.030     34  0.60
  371  149 H   1   1   1   0   1   0   0   0   2  93   0   0   0   0   0   0   0   0   0   0   234    3   69   0.375     12  0.85
  372  150 H   0   0   0   0   0   0   0  17   3   0   5   0   0   0   5   0   1  62   0   6   231    0    0   1.261     42  0.53
  373  151 H   0   0   0   0   0   0   0   0   0  59  18  19   0   0   0   0   0   0   3   0   232    0    0   1.083     36  0.48
  374  152 H  52  16  12  16   0   0   2   0   0   0   0   0   0   1   0   0   0   0   0   0   233    0    0   1.382     46  0.60
  375  153 H   0   0   0   0   0   1   1   0   0   0  14  51   0   1   3   0   3   0  21   3   234    0    0   1.504     50  0.33
  376  154 H  69   5   3   4  11   0   1   0   0   0   0   1   0   0   0   0   5   0   0   0   234    0    0   1.180     39  0.55
  377  156 H   0   0   0   0   0   0   0   0   2   0  29  58   0   0   0   5   3   0   0   0   234    0    0   1.141     38  0.49
  378  157 H   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   234    0    0   0.055      1  0.99
  379  162 H   1   0   2   0   2   0   0  19   0   0  12   1   0   0   0   4   0   1  54   2   234    0   32   1.472     49  0.39
  380  163 H   1   0   0   0   0   0   0   0   1   3  53   0   0   1   3  21   4   9   1   2   234    0    0   1.507     50  0.36
  381  164 H   0   0   0   0   0   0   0  53   3   0  27   0   0   0   0   1   5   0   7   2   234    0    0   1.330     44  0.50
  382  165 H   0   0   0   0   0   0   0  32  37   2  17   1   0   0   0   1   1   0   9   0   234    6   40   1.484     49  0.47
  383  166 H   2  51  12   0   0   0   3   0   2   3   0   0   0   0   0  18   6   0   0   1   228    0    0   1.586     52  0.25
  384  167 H   0   2   0   2   0   0   0   9   0   0  22  43   0   0   0   0   0   0   4  17   231    1    0   1.556     51  0.35
  385  168 H   8   0  16   0   0   0   0   0   0   0  49  13   0   0   2   4   2   0   3   2   231    6    1   1.592     53  0.27
  386  169 H   2   0   0   0   0   0   0  66   0   0   4  25   0   0   0   0   0   0   0   2   226    0    0   0.940     31  0.60
  387  171 H  54   7   7   0   6   0   0   0   7   0   1  17   0   0   0   0   0   0   0   0   232    0    0   1.466     48  0.42
  388  172 H  19   0   1   2   0   1   0   0   0   0   3   1   0  47  10   8   0   4   3   0   233    0    0   1.714     57  0.20
  389  173 H   0   0   0   0   0   3   0   1   0   0   4  51   0   1   1   5   5   0  28   0   233    0    0   1.399     46  0.33
  390  174 H   1   0   2   2  80   0  15   0   0   0   0   0   0   0   0   0   0   0   0   0   233    1    0   0.690     23  0.89
  391  175 H   0   0   0   0   0   0   0   3   0  90   2   0   0   0   2   3   0   0   0   0   232    0    0   0.483     16  0.82
  392  176 H   2   0   0   0   0   0   0   0  45  32  17   2   0   1   0   0   0   0   0   0   233    0    0   1.313     43  0.46
  393  177 H  62   4   4   0   3   0   0   0  16   0   8   1   0   0   0   0   0   0   0   0   233    0    0   1.307     43  0.45
  394  178 H   0  73   0   3   0   0   0   3   1   0   1   0   0   2   4   0  11   0   0   0   233    0    0   1.096     36  0.49
  395  179 H   3   0   0   0   0   0   0   5  17   0   3   3   0   0   3   4  52   0   1   7   233    0    0   1.699     56  0.35
  396  180 H   0   0   0   0   0   0   0   6  11  13  55   0   0   0   0   0   5   3   4   3   233    7  169   1.517     50  0.44
  397  183 H   0   0   0   0   0   0   0  81   0   0   1   0   0   0   0   1   0   0   1  15   226    1   33   0.617     20  0.79
  398  184 H   0  63   0   0   1   0   1   1   0   0   2   5   0   0  16   8   0   0   0   3   224    0    0   1.307     43  0.25
  399  185 H   0   0   0   0   4   0  95   0   0   0   0   0   0   0   0   0   0   0   0   0   230    0    0   0.221      7  0.98
  400  186 H   1   0   1   0   0   0   0   0   4   0  43  51   0   0   0   0   0   0   0   0   228    0    0   0.951     31  0.51
  401  187 H   0  50   0  26   0   0   0   2   7   0   3   8   0   0   1   3   0   0   0   0   225    0    0   1.443     48  0.47
  402  188 H   3   0   3   0   0   0   0   0   0   0  85   7   2   0   0   0   0   0   0   0   225    0    0   0.616     20  0.74
  403  189 H   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   225    0    0   0.057      1  0.98
  404  190 H  27   2   0  16   0   0   0   0   0   0  12   0   0   3   0   0  39   0   1   0   225    0    0   1.542     51  0.22
  405  191 H  56  38   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   225    0    0   0.907     30  0.72
  406  192 H   0   3   3   0   0   0   0   0   0   0   4  78   0   0   4   3   0   0   4   0   225    0    0   0.979     32  0.58
  407  193 H  61  30   5   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   224    0    0   0.964     32  0.71
  408  194 H   0   2   0   0   0   0   0   0   5  71  12   6   0   0   1   2   0   0   0   0   223    1    0   1.085     36  0.57
  409  195 H   0   3   0   0   0   0   0   0  50   0  41   0   0   0   1   4   0   0   0   0   222    0    0   1.046     34  0.49
  410  196 H  17   0   0   0   0   0   0   0   9   0  56   9   0   0   1   3   1   0   1   2   222    0    0   1.434     47  0.35
  411  198 H   3   0   0   0   0   0   0   2   0   0  35  11   0   0   1   0  10  20   3  14   222    1   12   1.807     60  0.30
  412  199 H   0  34   0   0   1  30   0   0   0   0   3   0  27   0   0   0   1   3   0   0   222    0    0   1.460     48  0.01
  413  200 H   0   3   2   0   0   0   0  25   2  34  17   0   0   0   0   7   2   0   4   5   223    0    0   1.829     61  0.29
  414  202 H   0   0   0   0   0   0   0   1  10   0  27  28   0   0   1   2   0  17   5   7   221    0    0   1.814     60  0.31
  415  203 H   0   2   2   0   0   0   2  24   0   0   2   4   0   0   1  20  30   3   5   5   221    0    0   1.927     64  0.24
  416  204 H   0   0   0   0   0   0   0   2   3   0  19  32   1   0   4  16   0  23   0   0   221    4  101   1.716     57  0.29
  417  205 H  35   2   6   0   8   0  47   0   0   0   0   0   0   0   0   0   2   0   0   0   217    0    0   1.274     42  0.40
  418  206 H   7   0  14   0   0   0   3   0   0   0   1  41   0   1   2  22   5   2   1   0   217    0    0   1.735     57  0.23
  419  208 H   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   220    0    0   0.029      0  0.99
  420  209 H   0   0   0   0   0   0   0   0   1   0  22   0   0   9   0   7   3   4  53   0   220    0    0   1.416     47  0.41
  421  210 H  85   0   2   0   0   0   0   0  13   0   0   0   0   0   0   0   0   0   0   0   220    0    0   0.487     16  0.75
  422  211 H   4   0   0   0   0   0   2   5  12   0   4   3   0   2   0  12  21   2  30   3   220    0    0   2.036     67  0.26
  423  212 H   0   0   0   0   0   0   5   0   0   0   0   0   0  90   0   0   0   0   3   1   220    0    0   0.453     15  0.82
  424  213 H   0   4   0   0   0   0   4   2   2  30   3   2   0   0   0  27   0   0   8  18   209    0    0   1.845     61  0.18
  425  214 H   3   0   0   0   0   0   1   2  33  27  22   4   0   0   0   0   0   0   3   3   203    0    0   1.719     57  0.34
  426  215 H   0   0   0   0   0   0   0   6   1   0  38  26   0   0   0   2   1   0  24   0   202    0    0   1.463     48  0.36
  427  216 H   0   0   3   0   0   0   0   2   5  24  19  14   0   0   0   1   0   2  31   1   199    0    0   1.763     58  0.27
  428  217 H  20   0   0   0   2   0   0   0   1   3   7  58   0   0   0   9   0   0   0   0   196    0    0   1.252     41  0.37
  429  218 H   0   0   0   0   0   0   0   0   1   1   4   2   0   1   1  61  25   2   0   3   196    0    0   1.177     39  0.50
  430  219 H  84   3   0   0   0   0   0   0   0   1   0   5   0   0   0   3   4   0   0   0   140    0    0   0.667     22  0.68
  431  220 H   1   0   0   0   0   0   0   0   4   0   0   6   0   3   0   0   0   9   4  74   140    0    0   0.986     32  0.64
  432  221 H   9   6   0   0   0   0   0   0   1   0   1   1   0   0   0  81   2   0   0   0   127    0    0   0.736     24  0.55
  433  222 H   0   0   0   0   0   0   0   0   0   9   3   3   1   0  43  39   0   1   0   0   127    0    0   1.246     41  0.51
  434  223 H  61   8  27   0   0   0   0   0   0   0   0   0   0   0   0   4   0   0   0   0   123    0    0   0.989     33  0.70
  435  224 H  12   0   0   0   0   0   0  21   1   8   0   1   0   0   0   0   0  49   0   8   112    0    0   1.419     47  0.41
  436  225 H   4   2  10   0   0   0   0   0   4  54   1  19   0   0   3   1   1   1   0   0   103    0    0   1.488     49  0.39
  437  226 H   0   0   0   0   0   0   0   0   0   0   0   0   0   0  27  73   0   0   0   0    89    0    0   0.583     19  0.78
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     2    29    49     1 sLl
     2    34    55     1 nQk
     3    29    29     1 sIv
     4    29    29     1 sIv
     5    29    29     1 sLv
     6    29    29     1 sLv
     9    29    49     1 sLl
    18   271    55     1 gGg
    19   270    73     1 sGg
    20   270    73     1 pNn
    21   270    73     5 nKANGYt
    21   318   126     4 yYYSGt
    23   271    74     1 gSg
    24   271    74     1 dGg
    24   320   124     2 gYNy
    26   270    73     3 nKNYn
    26   320   126     1 gYn
    27   271    74     1 gSg
    28   271    74     1 dGg
    29   271    74     1 dGs
    30   270    73     5 sKSNNYa
    31   271    74     1 gSt
    32   271    74     1 eDg
    33   392   195     1 sSg
    34   270    54     2 nKGn
    34   271    57     1 nGy
    36   272    75     1 tGg
    36   321   125     1 hSd
    36   396   201     1 sSg
    37   271    74     1 gNg
    38   271    74     1 gNg
    39   271    74     1 eDg
    39   320   124     1 gRd
    40   159   179     1 nSi
    41    93   115     1 nSa
    43   271    74     1 nNg
    43   320   124     3 ySYDh
    44   271    74     1 gDg
    45    29    49     1 sLv
    46   271    74     1 gSg
    47   271    74     1 sGs
    47   394   198     1 sSg
    48    94   116     1 sAs
    48   158   181     1 nSi
    49    93   113     1 nSa
    50   159   181     1 nSi
    51   159   181     1 nSi
    52   159   183     1 nSi
    53    29    49     1 sLl
    54    29    49     1 sLi
    54    99   120     1 aPp
    55    29    29     1 sLv
    56   271    74     1 nNg
    56   320   124     3 ySYDq
    57    92   113     2 yNSp
    58   271    74     1 gTg
    59   270    73     5 lRSDNYa
    60   270    73     1 pYn
    62   322   125     5 sDEAMAg
    62   397   205     1 sSg
    63    95   115     1 wPp
    63   159   180     1 nSi
    64    30    50     1 vSs
    64    93   114     1 vKr
    64    95   117     2 nHCv
    64   159   183     1 nSi
    65    29    49     1 sLl
    65    99   120     1 aPr
    66    94   114     1 gTs
    67   320   123     3 gSATy
    67   395   201     1 sSg
    68    29    49     1 sLv
    68    97   118     2 tEDp
    68   161   184     1 sNf
    69   159   179     1 nSi
    70    29    51     1 sLt
    70    34    57     1 lNa
    70    99   123     1 tPl
    70   115   140     1 gPv
    71   322   132     2 fASa
    71   397   209     1 sSg
    72    30    50     1 vFs
    72    95   116     1 sPs
    73   270    73     2 sKTd
    73   271    76     1 dGg
    73   320   126     1 yYy
    73   395   202     1 sSg
    74    29    49     1 sLk
    74   163   184     1 sNf
    75    29    49     1 sLl
    75    97   118     2 nPNp
    76   272    59     5 yRSKWYn
    76   319   111     7 sQWTVSLCd
    76   394   193     1 sSg
    77   271    74     1 nSg
    77   320   124     3 nFYYy
    77   395   202     1 sSg
    78    30    50     1 vSs
    78    93   114     2 gSSq
    79   271    74     1 sGh
    79   392   196     1 sSg
    80   271   110     1 dSs
    80   392   232     1 sSg
    81   388   195     1 sSg
    82    29    49     1 sLk
    82    97   118     2 sDDp
    82   161   184     1 sNf
    83   271    74     1 sGh
    83   392   196     1 sSg
    84   270    73     6 hVGTSTYq
    84   320   129     2 sSAe
    84   395   206     1 sSg
    85    29    49     1 sLk
    85    97   118     2 sSAp
    85   161   184     1 sNf
    86   271    74     1 gGg
    86   392   196     1 sSg
    87   153   175     1 nSi
    88   271    74     1 gGg
    88   320   124     3 eLCYw
    88   395   202     1 sSg
    89    29    49     1 sLl
    89    99   120     1 sHw
    90   271    74     1 sGg
    90   320   124     3 aIAVt
    90   395   202     1 pSg
    91   270    73     5 yDGRNIq
    91   316   124     6 wLQLGLEd
    91   391   205     1 sSg
    92   271    74     1 eGg
    92   320   124     5 sSWHTNy
    92   395   204     1 sSg
    93   270    73     5 sRGGSYe
    93   390   198     1 sSg
    94   271    74     1 gNg
    94   320   124     2 vTTt
    94   395   201     1 sSg
    95   271    74     1 dAs
    95   392   196     1 sSg
    96   271    74     1 sGg
    96   392   196     1 sSg
    97   271    74     1 sGg
    97   320   124     2 gSKg
    97   395   201     1 sSg
    98   271    74     1 gGg
    98   393   197     1 sSg
    99   271    74     1 gGg
    99   320   124     2 lALg
    99   395   201     1 sSg
   100    29    45     1 sVs
   100    97   114     1 kRn
   100    99   117     1 hCv
   101   159   181     1 nSi
   102   271    74     1 gGg
   102   320   124     6 gSSGWILn
   102   395   205     1 sSg
   103   271    74     1 gGg
   103   394   198     1 pSg
   104   270    73     1 fSd
   104   387   191     1 pSg
   105   271    74     1 sGv
   105   395   199     1 pSg
   106    91   120     6 hGLPPTVn
   106    93   128     1 cCv
   106   157   193     1 sNf
   107   271    74     1 eDg
   107   320   124     3 lTGYs
   107   395   202     1 sSg
   108   271    74     1 sGv
   108   320   124     6 yQVSPAYw
   108   395   205     1 sSg
   109   271    74     1 dGn
   109   320   124    13 tTSIFGLIPLYFYYs
   109   395   212     1 sSg
   110   271    74     1 sGd
   110   320   124     4 tTSNTe
   110   395   203     1 sSg
   111   270    73     1 gRd
   111   395   199     1 sSg
   112   270    73     1 aYn
   112   320   124     3 sSDSp
   112   395   202     1 sSg
   113   271    74     1 dGs
   113   320   124     7 sGSGNYYYy
   113   395   206     1 sSg
   114   268    52     1 dGs
   114   317   102    10 tFARILDPPFHk
   114   392   187     1 sSg
   115   271    74     1 gGg
   115   320   124     8 gWTFCHCDYy
   115   395   207     1 sSg
   116   271    74     1 gGg
   116   320   124     4 qPWTPs
   116   395   203     1 sSg
   117   270    73     1 sNg
   117   271    75     1 gGi
   117   320   125     8 sQSSPKLCYw
   117   395   208     1 sSg
   118   270    73     2 dSVt
   118   319   124     7 dGADWIPVy
   118   394   206     1 pSg
   119   270    73     1 aSd
   119   320   124     4 yYWGYg
   119   395   203     1 pSg
   120   271    74     1 sGs
   120   320   124     2 lAAl
   120   395   201     1 pSg
   121   270    73     3 tSEYd
   121   320   126     5 iANLGGd
   121   395   206     1 pSg
   122   270    73     2 sGYg
   122   389   194     1 pSg
   123   271    74     1 sGn
   123   320   124     4 sPWYPs
   123   395   203     1 sSg
   124   271    74     1 rGn
   124   320   124    11 aGPTSTSGPVRHn
   124   395   210     1 sSg
   125   270    73     2 pRSd
   125   319   124     6 aLWFGELd
   125   394   205     1 sSg
   126   271    74     1 dGg
   126   320   124    12 lLDILSGYFRGWKt
   126   395   211     1 sSg
   127   370   172     1 pQe
   127   395   198     1 aSg
   127   396   200     1 gDl
   127   415   220     1 kSv
   128   270    73     2 pFFg
   128   319   124     4 aTGVQy
   128   394   203     1 sSg
   129   270    73     2 pILt
   129   319   124     5 dGSDLTy
   129   394   204     1 sSg
   130   270    73     2 pTLh
   130   319   124     5 dSDASNy
   130   394   204     1 sSg
   131   271    74     1 kTg
   131   320   124     1 aDw
   131   395   200     1 sSg
   132   271    74     1 nTg
   132   320   124     1 aDw
   132   395   200     1 sSg
   133   271    74     1 kTg
   133   320   124     1 aDw
   133   395   200     1 sSg
   134   270    73     3 tSDYd
   134   320   126     3 fAVTp
   134   395   204     1 pSg
   135   270    73     3 rGSYs
   135   320   126    11 ySFGAYCYDQYYy
   135   395   212     1 pSg
   136   271    74     1 sGg
   136   320   124     6 vNIAVTGd
   136   395   205     1 pSg
   137   320   123     8 gQTWYVWTYy
   137   395   206     1 pSg
   138   271    74     1 sGg
   138   320   124     6 aTVWSNRy
   138   395   205     1 pSg
   139   271    74     1 dGg
   139   388   192     1 pSg
   140   270    73     3 sGSYs
   140   320   126     5 sGFLPTt
   140   395   206     1 pSg
   141   271    74     3 tAGRd
   141   319   125     1 aDc
   141   394   201     1 pSg
   142   270    73     5 yTGVITd
   142   316   124     1 dLy
   142   391   200     1 pSg
   143   371   186     1 pQe
   143   396   212     1 aSg
   143   397   214     1 gDl
   143   416   234     1 kSv
   144   270    73     2 pLYk
   144   319   124     4 gSEGAg
   144   394   203     1 sSg
   145    93   118     2 ySTp
   145   109   136     1 dDa
   146   270    73     3 nTGLg
   146   318   124     1 eAy
   146   393   200     1 pSg
   147   271    74     1 gGg
   147   320   124     5 sGGFLYy
   147   395   204     1 pSg
   148   270    73     3 sSGLs
   148   318   124     5 tGCSVEy
   148   393   204     1 pSg
   149   270    73     3 rGSYs
   149   320   126     7 hYDASCHNn
   149   395   208     1 pSg
   150   271    74     1 gGg
   150   393   197     1 pSg
   151   270    73     3 cGGWs
   151   320   126     6 cWGGWLYh
   151   395   207     1 pSg
   152   320   123     5 cITGYVc
   152   395   203     1 pSg
   153   271    74     1 sGt
   153   320   124     8 wYGDTCYYYf
   153   395   207     1 pSg
   154   271    74     1 sGg
   154   320   124     6 aTVWSNRy
   154   395   205     1 pSg
   155   270    73     3 sVSYs
   155   320   126     5 cYQTYYy
   155   395   206     1 pSg
   156    29    50     1 sVv
   157   270    73     1 pSn
   157   320   124     6 tNSYHKRs
   157   395   205     1 sSg
   158   370   172     1 pSg
   158   395   198     1 sGg
   158   415   219     1 eSv
   159    29    54     1 sVa
   160   270    73     2 pMSr
   160   319   124     8 gGDSDHDENn
   160   394   207     1 sSg
   161    93   118     2 wDPp
   162   270    73     1 gGg
   162   393   197     1 pSg
   163   317   122     1 vAd
   163   349   155     1 gSs
   163   392   199     1 qSg
   163   412   220     1 kSf
   164   270    73     2 tSAd
   164   320   125     3 aMGPf
   164   395   203     1 pSg
   165   320   123     6 cACSSERn
   165   369   178     1 pSa
   165   414   224     1 qSv
   166   270    73     4 sSGNQe
   166   318   125    13 vQLSSSSRSPPRYYe
   166   393   213     1 pSg
   167   367   169     1 pSg
   167   392   195     1 sGg
   167   412   216     1 eSv
   168   271    74     1 nGg
   168   320   124     3 sQCEp
   168   335   142     2 lAAs
   168   391   200     1 sSg
   169   271    74     1 nGg
   169   320   124     2 sVSp
   169   336   142     5 aASLAAs
   169   392   203     1 sSg
   170   321   124     1 sVy
   170   368   172     1 pQe
   170   390   195     1 aPg
   170   391   197     1 gGl
   170   410   217     1 kSv
   171   271    74     1 dGd
   171   320   124     1 aDn
   171   352   157     1 gSs
   171   395   201     1 qSg
   171   415   222     1 kSf
   172   271    74     1 tAg
   172   332   136     7 vTAASLAAs
   172   388   199     1 sSg
   173   271    74     1 nGg
   173   321   125     1 vSp
   173   331   136     6 mRSASTAs
   173   387   198     1 sSg
   174    83   111     5 yGMSSLc
   174    99   132     1 pKa
   175    81   142     4 dSSSKh
   175    98   163     1 pKa
   176    75    95     3 aLTLa
   177   352   152     1 sPl
   177   378   179     1 nYq
   177   381   183     2 nTEv
   177   410   214     2 nVLe
   177   415   221     1 eYl
   178   271    74     1 dGt
   178   320   124     1 gYg
   178   369   174     1 pQe
   178   394   200     1 aSg
   178   395   202     1 gDl
   178   414   222     1 kSv
   179    83   111     4 dRTSLc
   179    99   131     1 pKa
   180    83   114     5 aSRQNSs
   180   101   137     1 pKa
   181   269    77     5 sNRGSYp
   181   345   158     1 gSl
   181   388   202     1 qSg
   182    83   114     3 aSTLs
   182   101   135     1 pKa
   183    83   111     5 dNAQSLc
   183    99   132     1 pKa
   184    83   111     3 ePVSq
   184   100   131     1 pKa
   185    83   114     5 aSSSTFs
   185   101   137     1 pKa
   186    93   114     6 ySYPLTXv
   186   110   137     1 tVt
   186   128   156     1 nKk
   187   322   125     2 gDFh
   187   371   176     1 pSg
   187   396   202     1 sGg
   187   416   223     1 eSv
   188   371   174     1 pSg
   188   396   200     1 sGg
   188   416   221     1 eSv
   189   269    78     5 sDMRSFp
   189   343   157     1 gSl
   189   386   201     1 qSg
   190   271    74     1 dGg
   190   378   182     2 sGSi
   190   392   198     1 qSg
   191   320   123     1 aGy
   191   369   173     1 pSg
   191   394   199     1 sGg
   191   414   220     1 eSv
   192   322   125     1 yGg
   192   371   175     1 pSg
   192   396   201     1 sGg
   192   416   222     1 tTv
   193    25    50     1 gAg
   193    88   114     1 dDs
   193    90   117     1 lTg
   193   106   134     1 pKa
   194    31    50     1 gAg
   194    94   114     4 dSSLSg
   194   110   134     1 pKa
   195   271    74     1 gGg
   195   349   153     1 dNv
   195   392   197     1 dVd
   195   393   199     1 dGl
   196   270    73     2 yTTd
   196   368   173     1 pQe
   196   393   199     1 aSg
   196   394   201     1 gDl
   196   413   221     1 kSv
   197   271    74     1 qNg
   197   320   124     1 sSy
   197   369   174     1 pQe
   197   394   200     1 aSg
   197   395   202     1 gDl
   197   414   222     1 kSv
   198    86   111     3 dSSSd
   198   104   132     1 pKa
   199   368   171     1 pSg
   199   393   197     1 sGg
   199   413   218     1 eSv
   200    25    50     1 gAg
   200    88   114     5 dGSLSGs
   200   103   134     1 pKa
   201    88   114     1 dDs
   201    90   117     1 lSr
   201   106   134     1 pKa
   202    94   113     1 dDs
   202    96   116     1 lSg
   202   112   133     1 pKa
   203    89   114     2 eSGt
   203   107   134     1 pKs
   204    83   114     5 aSTMTCv
   204    98   134     1 pKa
   205    83   114     5 aSTYKCg
   205    98   134     1 pKa
   206    83   114     4 aSKGCv
   206    98   133     1 pKa
   207    82   111     6 dSSTAHTs
   207   100   135     1 pKa
   208    82   111     6 dSSTAHSs
   208   100   135     1 pKa
   209   319   119     5 gSYYYYn
   209   351   156     1 gDp
   209   380   186     1 aAv
   209   394   201     1 sQd
   209   395   203     1 dGt
   210    86   111     4 aSRDDh
   210   103   132     1 pKa
   211    86   111     5 hGSSEVi
   211   102   132     1 pKa
   212    85   114     3 aGSNn
   212   102   134     1 pKa
   213   270    88     1 pRd
   213   320   139     4 gTSASy
   213   369   192     1 pQe
   213   394   218     1 aSg
   213   395   220     1 gDl
   213   414   240     1 kSv
   214    86   111     4 dTGPDh
   214   103   132     1 pKa
   215    86   114     1 sSt
   215    88   117     1 tPp
   215   104   134     1 pKa
   216    88   113     5 dDSLSVh
   216   104   134     1 pKa
   217   270    73     4 sRSDYi
   217   317   124     2 aICy
   217   366   175     1 pQe
   217   391   201     1 aSg
   217   392   203     1 gDl
   217   411   223     1 kSv
   218    24    49     1 iAn
   218    87   113     1 dDs
   218    89   116     1 lSa
   218   105   133     1 pKa
   219    25    50     1 gAg
   219    88   114     4 dGSLSg
   219   104   134     1 pKa
   220    88   113     5 dSSLSAg
   220   103   133     1 pKa
   221    80   111     3 dSSTs
   221    96   130     1 pKa
   222    83   111     5 dPVSLCd
   222    98   131     1 pKs
   223    25    50     1 gVs
   223    88   114     5 kRGDTFh
   223    90   121     1 sGp
   223   106   138     1 pKa
   224    27    57     1 kSn
   224    90   121     3 wFESl
   225    29    52     1 sVy
   225    34    58     1 yKk
   225    95   120     3 sVHWw
   225    97   125     5 nNQDVFf
   225    99   132     2 vSLw
   225   163   198     1 sSw
   225   177   213     1 gLy
   226    88   113     1 dDn
   226    90   116     1 lNs
   226   106   133     1 pKa
   227   271    72     1 gGg
   227   375   177     1 gDk
   227   378   181     2 nASy
   227   392   197     1 sSg
   227   412   218     1 ePf
   228    88   113     6 dDSMSGPg
   228   104   135     1 pKa
   229    88   113     1 dDs
   229    90   116     2 lDGp
   229   106   134     1 pKa
   230    88   113     1 dDs
   230    90   116     1 lTg
   230   106   133     1 pKa
   231   270    73     4 dASKIn
   231   347   154     1 dNv
   231   390   198     1 dVd
   231   391   200     1 dGl
   232    88   113     5 dTSLTAg
   232   103   133     1 pKa
   233   271    98     1 dGs
   233   320   148     3 mSRDd
   233   369   200     1 pQe
   233   394   226     1 aSg
   233   395   228     1 gDl
   233   414   248     1 kSv
   234   346   159     1 gSs
   234   389   203     1 qSg
   235   271    74     1 sSg
   235   320   124     1 yGg
   235   369   174     1 pSg
   235   394   200     1 sGg
   235   414   221     1 eSv
   236    85   114     3 aGSNn
   236   101   133     1 pKa
   237    22    50     1 gSh
   237    85   114     3 vGSGt
   237   101   133     1 pKa
   238    25    50     1 gAg
   238    88   114     2 dSSl
   238   106   134     1 pKa
   239    87   112     6 gDSSSDNa
   239   102   133     1 pKs
   240    22    47     1 nNi
   240    85   111     1 sAd
   240    87   114     2 lSLc
   240   103   132     1 pKs
   241    82   111     2 pESq
   241    99   130     1 pKs
   242    81   109     6 sTDSSGNh
   242    83   117     1 sTc
   242    99   134     1 pKa
   243    82   111     6 dSSSGNSd
   243    84   119     2 vSIt
   243   100   137     1 pKa
   244   270    73     2 nKAn
   244   271    76     1 nGg
   244   320   126     8 aQCEPRHKPp
   244   327   141     1 gHq
   244   369   184     1 pQe
   245    81   109     6 sADSSGNh
   245    97   131     1 pKv
   246   268    61     1 sSs
   246   317   111     6 hSVGWVIt
   246   391   191     1 nKk
   246   410   211     1 rSf
   247    27    56     1 kSn
   247    88   118     2 sFHy
   247    90   122     5 iNSFESl
   248    95   115     1 sSn
   249    93   113     1 qSs
   249    95   116     1 sNp
   250    82   109     3 ySSPv
   250    84   114     6 aPSQWSMc
   250    86   122     1 hCv
   250   102   139     1 pKa
   250   120   158     1 kNk
   251    80   109     4 sTDISg
   251    97   130     1 pKa
   252    14    47     1 lRt
   252    76   110     5 rDSSGSh
   252    92   131     1 pKa
   253   271    74     1 dGs
   253   320   124     4 gIYDDe
   253   369   177     1 pQe
   253   394   203     1 aSg
   253   395   205     1 gDl
   253   414   225     1 kSv
   254    22    50     1 gNy
   254    85   114     3 aGTYt
   254   102   134     1 pKa
   255   271    74     1 dGr
   255   320   124     8 sWSSYYVEGh
   255   369   181     1 pQe
   255   394   207     1 aSg
   255   395   209     1 gDl
   255   414   229     1 kSv
   256    86   111     4 dNSGGq
   256   103   132     1 pKa
   257    82   110     5 sDSSGNh
   257    98   131     1 pKa
   258   270    73     5 nRANGYt
   258   365   173     1 pSg
   258   390   199     1 sGg
   258   410   220     1 eSv
   259   270    72     3 nSGYa
   259   364   169     1 pSg
   259   389   195     1 sGg
   259   409   216     1 eSv
   260   320   123     4 yYYSGs
   260   369   176     1 pSg
   260   394   202     1 sGg
   260   414   223     1 eSv
   261    60    85     2 gSId
   261    88   115     1 sSg
   261   105   133     1 pKt
   262    27    54     1 sSg
   262    88   116     1 sLh
   262    90   119     3 nINSa
   263    84   112     1 lYy
   263    86   115     1 rGg
   263   102   132     1 pKa
   264    22    50     1 gDy
   264    85   114     1 aGs
   264   103   133     1 pKa
   265    86   114     5 aISSVRv
   265   101   134     1 pKa
   266    22    50     1 sTs
   266    85   114     2 lGSg
   266   102   133     1 pKa
   267    22    47     1 tNi
   267    85   111     2 aGDy
   267    88   116     1 vNt
   267   104   133     1 pKs
   268    22    47     1 nNi
   268    85   111     5 sADLSLf
   268   101   132     1 pKs
   269    81   109     6 sTDSSDNa
   269    96   130     1 pKs
   270    88   113     4 dSSSGa
   270   103   132     1 pKs
   271    88   113     5 tSSSTFh
   271    90   120     1 sGp
   271   105   136     1 pKa
   272   320   123     2 sCPd
   272   367   172     1 pQe
   272   389   195     1 aPg
   272   390   197     1 gGl
   272   409   217     1 kSv
   273   268    74     1 sSs
   273   332   139     1 vAa
   273   372   180     1 nKv
   273   375   184     1 gPa
   273   404   214     1 dWe
   273   409   220     1 aTf
   274   268    73     1 sSs
   274   372   178     1 nKv
   274   375   182     1 gPa
   274   404   212     1 dWe
   274   409   218     1 aTf
   275    81   109     4 sGDSSs
   275    83   115     1 sAp
   275    97   130     1 gCh
   275    99   133     1 lKa
   276    82   109     3 sGDSs
   276    84   114     1 sSa
   276   100   131     1 lKa
   277    83   111     4 dGHPRk
   277    98   130     1 aGh
   277   100   133     1 lKa
   278   272    76     5 yRSKWYn
   278   319   128     3 sQCDn
   278   351   163     1 nAp
   278   377   190     1 kFk
   278   380   194     2 nSDi
   278   409   225     2 dVMq
   278   414   232     1 eHv
   279    23    50     1 gYy
   279    84   112     3 gTAAl
   279    86   117     2 hTQs
   279   104   137     1 pKa
   280   333   137     1 aQp
   280   365   170     1 pAd
   280   373   179     1 kDp
   280   376   183     2 gKDl
   280   409   218     1 kNy
   281    93   113     1 qSs
   281    95   116     1 sNp
   282    95   115     1 sSn
   283    93   113     2 qSSs
   284   271    67     1 nGd
   284   320   117     2 nWYq
   284   369   168     1 pPe
   284   394   194     1 aGg
   284   414   215     1 gTq
   285    36    61     1 sGs
   285    46    72     3 rSASe
   285    60    89     2 gSKd
   285    88   119     3 dSTNn
   285   123   157     1 kNr
   286    85   109     2 dGGa
   286   101   127     1 dVk
   287    95   115     2 hSSn
   287   129   151     1 kRa
   288    88   113     4 dSSSSt
   288   103   132     1 pKs
   289   270    73     1 pSd
   289   369   173     1 pSg
   289   394   199     1 sGg
   289   414   220     1 eSv
   290   271    74     1 gRg
   290   369   173     1 pSg
   290   394   199     1 sGg
   290   414   220     1 eSv
   291    86   111     1 sAe
   291    88   114     4 dSSSNa
   291   103   133     1 pKs
   292   271    74     1 gDg
   292   368   172     1 pSg
   292   393   198     1 sGg
   292   413   219     1 eSv
   293   270    73     3 nLAYn
   293   366   172     1 pSg
   293   391   198     1 sGg
   293   411   219     1 eSv
   294   322   125     1 yYw
   294   354   158     1 sPl
   294   380   185     1 nYq
   294   383   189     2 nTEv
   294   412   220     2 nVLe
   294   417   227     1 eYl
   295   271    72     1 dGg
   295   374   176     1 gDk
   295   377   180     2 nASy
   295   391   196     1 sSg
   295   411   217     1 eQf
   296   271    72     1 dGg
   296   320   122     3 gYSWn
   296   376   181     1 gDk
   296   379   185     2 nASy
   296   393   201     1 sSg
   296   413   222     1 eQf
   297   270    90     6 vENGNMMs
   297   361   187     1 pQe
   297   386   213     1 aSg
   297   387   215     1 gDl
   297   406   235     1 kSv
   298   270    91     1 aYs
   298   320   142     3 tIPNd
   298   369   194     1 pQe
   298   394   220     1 aSg
   298   395   222     1 gDl
   298   414   242     1 kSv
   299   271    74     1 nSg
   299   367   171     1 pSg
   299   392   197     1 sGg
   299   412   218     1 eSv
   300   271    74     1 qTg
   300   320   124     5 gRGFGYn
   300   369   178     1 pQe
   300   394   204     1 aSg
   300   395   206     1 gDl
   300   414   226     1 kSv
   301   270    73     2 pNFg
   301   319   124     4 gSGSYy
   301   368   177     1 pQe
   301   393   203     1 aSg
   301   394   205     1 gDl
   301   413   225     1 kSv
   302   271    74     1 gGs
   302   320   124     4 pYGGYs
   302   369   177     1 pSg
   302   394   203     1 sGg
   302   414   224     1 eSv
   303    86   111     3 hVDAh
   303   102   130     1 pKa
   304   243    50     2 gALi
   304   272    81     6 yEAGTALn
   304   342   157     1 dNv
   304   385   201     1 dVd
   304   386   203     1 dGl
   305   243    60     2 gALi
   305   272    91     6 yQQGTALn
   305   348   173     1 gNv
   305   391   217     1 aAd
   305   392   219     1 dGl
   306    84   112     2 sFHy
   306    86   116     4 pHIQAl
   306   101   135     1 tGs
   307    86   114     1 kRg
   307    88   117     2 lSTv
   307   103   134     1 pKa
   308    86   114     3 kRGDt
   308   103   134     1 pKa
   309    23    53     1 gRt
   309    86   117     1 dSt
   309    88   120     1 lGc
   309   104   137     1 pKs
   310    33    45     1 sPg
   310    85    98     5 dSSSTGg
   310   100   118     1 pKv
   311   271    80     1 dGs
   311   350   160     1 nSl
   311   376   187     1 kYe
   311   379   191     2 lSAi
   311   382   196     1 nQd
   311   408   223     2 dIIq
   311   413   230     1 eYi
   312    93   113     1 qSs
   312    95   116     1 sPs
   313    88   113     1 dSs
   313    90   116     1 lSg
   313   106   133     1 pKs
   314    76   109     2 sIVg
   314    78   113     2 lGQc
   314    94   131     1 pTs
   315   354   157     1 sPl
   315   380   184     1 nYq
   315   383   188     2 nTEv
   315   412   219     2 nVLe
   315   417   226     1 eYl
   316   270    72     5 pDSSTIn
   316   358   165     1 pSg
   316   383   191     1 sGg
   316   403   212     1 eSv
   317    84   112     1 lSy
   317   103   132     1 pKa
   318    86   111     2 dSGa
   318   100   127     1 tGd
   319   270    91     1 lYd
   319   365   187     1 pQe
   319   373   196     1 sEs
   319   389   213     1 aSg
   319   390   215     1 gDl
   319   404   230     1 qCl
   320   271    74     1 nGg
   320   320   124     2 wMDw
   320   369   175     1 pQe
   320   377   184     1 sEs
   320   393   201     1 aSg
   320   394   203     1 gDl
   320   408   218     1 qCl
   321   260    74     2 yNAq
   321   323   139     1 aQp
   321   355   172     1 pAd
   321   363   181     1 kDp
   321   366   185     1 gKd
   321   400   220     1 kPy
   322   270    73     5 lRSNNYa
   322   318   126     1 pNw
   322   367   176     1 pSg
   322   392   202     1 sGg
   322   412   223     1 eSv
   323   271    74     1 nGg
   323   364   168     1 pSg
   323   389   194     1 sGg
   323   409   215     1 eSv
   324   271    74     1 eTg
   324   320   124     1 dIy
   324   369   174     1 pSg
   324   394   200     1 sGg
   324   414   221     1 eSv
   325    27    54     1 sHg
   325    90   118     5 hYINSAn
   326    29    56     1 aPg
   326    79   107     3 sADSs
   326    81   112     1 sTa
   326    97   129     1 pKv
   326   115   148     1 aTk
   327    86   114     2 rDGg
   327   102   132     1 pKa
   328    85   111     3 dSDAa
   328    98   127     1 tGd
   329    68   115     2 gGGs
   329    96   145     4 hYINTl
   329   111   164     1 tGs
   330    84   108     4 dTDTGg
   330    99   127     1 tGd
   331    85   117     4 tNSVPq
   331   100   136     1 tGd
   332    86   114     5 aGSSTSt
   333    86   114     3 kRGDa
   333   101   132     1 pKa
   334    84   112     1 lWy
   334    86   115     1 sNh
   334   102   132     1 pKs
   335    83   113     2 fQTc
   335    99   131     1 pKs
   336    81   113     1 iDc
   336    97   130     1 pKs
   337    23    50     1 gRt
   337    86   114     3 aGTSc
   337   102   133     1 pKs
   338    34    46     1 sPg
   338    84    97     5 sRDSSTg
   338    99   117     1 pKv
   339    76   109     6 rADDSGCa
   339    91   130     1 pKa
   340   268    73     1 sGs
   340   410   216     1 kSy
   341    33    66     1 rYl
   341    38    72     3 kHDSe
   341    52    89     2 gSTd
   341    80   119     6 dNSRNAVh
   341    82   127     1 tVv
   341    98   144     1 sSs
   341   116   163     1 kNr
   342    84   111     3 aISHc
   342   101   131     1 pIv
   342   119   150     1 kNk
   343   329   132     1 aQp
   343   361   165     1 pAd
   343   369   174     1 kDp
   343   372   178     2 gKDl
   343   405   213     1 kNy
   344    93   113     5 qSSSNPg
   345    90    90     5 qSSSGSn
   346   271    67     1 gDs
   346   369   166     1 pPe
   346   394   192     1 aGg
   346   414   213     1 gTq
   347    14    65     1 gIg
   347    15    67     1 gDr
   347    19    72     1 gCr
   347    54   108     2 gSGa
   347    80   136     2 sVHw
   347    82   140     1 iSn
   347   117   176     1 kRa
   347   147   207     1 sSg
   347   148   209     1 gGq
   347   161   223     1 gLy
   348   270    73     1 pYn
   348   320   124     2 yGYa
   348   369   175     1 pSg
   348   394   201     1 sGg
   348   414   222     1 eSv
   349   271    74     1 sSg
   349   365   169     1 pSg
   349   390   195     1 sGg
   349   410   216     1 eSv
   350   271    74     1 gRg
   350   367   171     1 pSg
   350   392   197     1 sGg
   350   412   218     1 eSv
   351   271    74     1 gDg
   351   364   168     1 pSg
   351   389   194     1 sGg
   351   409   215     1 eSv
   352   271    74     1 nSg
   352   368   172     1 pSg
   352   393   198     1 sGg
   352   413   219     1 eSv
   353   270    73     1 pSd
   353   320   124     2 nLNw
   353   369   175     1 pSg
   353   394   201     1 sGg
   353   414   222     1 eSv
   354   243    57     2 gASl
   354   377   193     1 gDk
   354   380   197     2 nASy
   354   394   213     1 sSg
   354   414   234     1 eQf
   355    86   111     3 dSDSk
   355   101   129     1 tGd
   356    22    50     1 gNy
   356    85   114     3 vGSGt
   356   101   133     1 pKa
   357   271    74     1 nSg
   357   320   124     4 sDYVDy
   357   369   177     1 pSg
   357   394   203     1 sGg
   357   414   224     1 eSv
   358   270    73     1 pYn
   358   320   124     4 sYFSYd
   358   369   177     1 pSg
   358   394   203     1 sGg
   358   414   224     1 eSv
   359   271    74     1 gDg
   359   366   170     1 pSg
   359   391   196     1 sGg
   359   411   217     1 eSv
   360    29    48     1 kVa
   360    34    54     1 gSq
   360    69    90     2 gSGa
   360    97   120     4 hYINSq
   360   160   187     1 sSs
   360   161   189     1 sWe
   360   174   203     1 gHy
   361    86   111     2 rDGg
   361   102   129     1 pKa
   362    25    25     1 vPg
   362    76    77     5 eDSSSGg
   362    91    97     1 pTv
   363    84   112     1 lWy
   363    86   115     1 sTh
   363   102   132     1 pKs
   364    29    56     1 sPg
   364    81   109     6 dSSTAAHg
   364    96   130     1 pKv
   365    23    50     1 gRt
   365    85   113     6 gQASGSGc
   365   101   135     1 pKs
   366    23    50     1 gRy
   366    86   114     4 rSGSTc
   366   102   134     1 pKs
   367    29    56     1 vPg
   367    81   109     1 dSs
   367    83   112     1 iSr
   367    99   129     1 pQv
   367   160   191     1 tRy
   368   270    82     4 gSSSIs
   368   316   132     6 dVSIHDNw
   368   333   155     1 dTp
   368   376   199     2 sNNl
   368   404   229     2 dQMk
   368   409   236     1 kEr
   369   268    75     1 sGs
   369   317   125     6 kLGWHNVf
   369   410   224     1 kSy
   370   329   132     1 aQp
   370   361   165     1 pAd
   370   369   174     1 kDp
   370   372   178     2 gKDl
   370   405   213     1 kNy
   371    21    21     1 sSg
   371    82    83     3 pLNEf
   372   270    73     6 aNNGKTId
   372   315   124     1 vHf
   372   364   174     1 pPe
   372   389   200     1 aGg
   372   409   221     1 gTq
   373   102   119     1 pWd
   374   271    74     1 sSg
   374   367   171     1 pSg
   374   392   197     1 sGg
   374   412   218     1 eSv
   375   270    73     2 tYYg
   375   366   171     1 pSg
   375   391   197     1 sGg
   375   411   218     1 eSv
   376    32    79     1 gCs
   376    67   115     3 gGGTa
   376    93   144     2 sVHy
   376    95   148     2 iSNs
   376   111   166     1 tGs
   377   330   134     1 aQp
   377   362   167     1 pAd
   377   370   176     1 kDp
   377   373   180     1 gKd
   377   407   215     1 kPy
   378    85   109     2 dGGa
   378    99   125     1 tGd
   379    85   111     5 dNDSDAa
   379    98   129     1 tGd
   380    36    61     1 aGn
   380    46    72     3 ySDSs
   380    60    89     2 gSKd
   380    88   119     2 hASs
   380   102   135     1 tGd
   381    37    66     1 rYl
   381    42    72     3 nSDSs
   381    56    89     2 gSKd
   381    82   117     1 iWy
   381    84   120     1 sSs
   381    99   136     1 tGd
   382   270    73     5 nKPYNYe
   382   361   169     1 pSg
   382   386   195     1 sGg
   382   406   216     1 eSv
   383   270    73     1 pYn
   383   367   171     1 pSg
   383   392   197     1 sGg
   383   412   218     1 eSv
   384   270    73     1 pFd
   384   282    86     1 gTt
   384   365   170     1 pSg
   384   390   196     1 sGg
   384   410   217     1 eSv
   385   349   135     1 dTs
   385   378   165     2 nKEi
   385   392   181     1 qNm
   385   412   202     1 kVy
   386    29    49     1 sLl
   386    31    52     1 sSa
   386    95   117     1 qDy
   386    97   120     4 sAPPTv
   386    99   126     1 lQp
   387    84   112     1 lYy
   387    86   115     1 sGp
   387   104   134     1 pKs
   388    84   112     1 lYy
   388    86   115     4 sGXXXx
   388   101   134     1 pKs
   389   243    60     2 gALi
   389   272    91     6 yAQGTALn
   389   371   196     1 eDk
   389   374   200     2 nTSi
   389   388   216     1 aSg
   389   408   237     1 tEl
   390    91   258     3 kGPPs
   390    93   263     3 eVPAq
   390   108   281     1 vSs
   390   110   284     1 vEa
   391   271    73     1 gSg
   391   350   153     1 sPl
   391   376   180     1 nYq
   391   379   184     2 nTEv
   391   408   215     2 nVLe
   391   413   222     1 eYl
   392    41    56     1 rYl
   392    46    62     3 ySDSn
   392    60    79     2 gSKd
   392    88   109     4 hSPSRs
   392   102   127     1 tGd
   393   271    74     1 gDg
   393   366   170     1 pSg
   393   391   196     1 sGg
   393   411   217     1 eSv
   394   271    74     1 gSg
   394   320   124     5 nYDGSLa
   394   369   178     1 pSg
   394   394   204     1 sGg
   394   414   225     1 eSv
   395    29    49     1 sLv
   395   137   158     1 vLt
   396    42    67     1 rFl
   396    47    73     3 fSPSd
   396    61    90     2 gSKd
   396    87   118     1 vGt
   396    89   121     5 pVMGRRp
   396   106   143     1 pKf
   397    86   114     4 aGSSSt
   397   100   132     1 gLs
   398    39    67     1 rYl
   398    44    73     3 nSDSd
   398    58    90     2 gSKd
   398    86   120     6 dNSLSACt
   398   100   140     1 rAq
   398   102   143     1 pKa
   399    32    66     1 rYl
   399    37    72     3 eSDGs
   399    77   115     1 vDf
   399    79   118     2 tDGc
   399    95   136     1 pAv
   401    34    67     1 rFl
   401    39    73     3 fSYLd
   401    53    90     2 gSKd
   401    81   120     5 gHSQQSp
   401    98   142     1 pKa
   402    22    66     1 aVh
   402    23    68     1 hSr
   402    24    70     3 rCYNg
   402    27    76     1 sTs
   402    47    97     1 rHv
   402    89   140     3 nSDGt
   402   105   159     1 dSg
   403   330   134     1 aQp
   403   362   167     1 pAd
   403   370   176     1 kDp
   403   373   180     2 gKDl
   403   406   215     1 kNy
   404   271    74     1 dTg
   404   320   124     7 yYCDGGSCl
   404   369   180     1 pPe
   404   377   189     1 dHk
   404   393   206     1 aGg
   404   413   227     1 gTq
   405    91   138     3 qRKSy
   405   141   191     1 dSa
   406   270    73     2 pNYd
   406   319   124     2 sYDg
   406   368   175     1 lSg
   406   393   201     1 sGg
   406   413   222     1 eSv
   407   318   105     2 gSAp
   407   350   139     1 dMn
   407   379   169     2 sGAi
   407   393   185     1 nDk
   407   413   206     1 rFy
   408   271    55     1 sGs
   408   320   105     2 yIWh
   408   327   114     1 pQp
   408   337   125    10 gVGVGGRSTGNr
   409   271    74     1 gGg
   409   337   141     9 gESAGPFKWEp
   409   371   184     1 kFk
   409   374   188     2 nSDi
   409   403   219     2 dVMq
   409   408   226     1 eHv
   410    45    70     1 lRy
   410    47    73     3 fSRSd
   410    61    90     2 gSKd
   410    87   118     3 vGAQa
   410   104   138     1 pKs
   411    22    49     1 aVh
   411    23    51     1 hSr
   411    24    53     3 rCYNg
   411    27    59     1 sTs
   411    90   123     3 nSDGt
   412   268    53     1 gSs
   412   390   176     1 gAs
   413    22    49     1 gFv
   413    41    69     1 rFl
   413    46    75     3 kSGSd
   413    60    92     2 gSKd
   413    88   122     4 hGNSNt
   413   104   142     1 pKs
   414    22    49     1 gFv
   414    41    69     1 rFl
   414    46    75     3 kSDSd
   414    60    92     2 gSKd
   414    88   122     5 hGNSNTa
   414   103   142     1 pKs
   415   261    64     1 gTi
   415   371   175     1 gDk
   415   374   179     2 nASy
   415   388   195     1 sSg
   415   408   216     1 eQf
   416    39    67     1 kLa
   416    42    71     1 gSw
   416    44    74     3 gTGNq
   416    86   119     2 tGSa
   416   100   135     1 tGd
   417    85   111     5 dSDSLEg
   417    87   118     1 lQw
   418    91    91     1 qGy
   418    93    94     1 sTp
   419    43    65     1 qYv
   419    55    78     1 gFs
   419    62    86     1 sNh
   419    90   115     2 dSSv
   419   108   135     1 sLp
   420   329   116     8 gNGPGSGEGp
   420   344   139     1 dVk
   421    83   113     1 lVy
   421    85   116     1 sGa
   421   101   133     1 pKs
   422    82   108     1 vVy
   422    84   111     1 sGa
   422   100   128     1 pKs
   423    29    49     1 sLl
   423    95   116     2 qGAl
   423    97   120     5 pTAQAPa
   423    99   127     1 iCg
   424    42    76     1 iGs
   424    44    79     3 sGTGn
   424    51    89     1 sWt
   424    86   125     2 tGSa
   424   100   141     1 tGd
   425    39    76     1 kLv
   425    42    80     1 gSw
   425    44    83     3 gTGNq
   425    86   128     2 tGSa
   425   100   144     1 tGd
   426   318   109     2 aYIg
   426   350   143     1 dMn
   426   376   170     1 sSe
   426   379   174     1 gAi
   426   394   190     1 dKk
   426   413   210     1 rFy
   427   344   147     1 dTs
   427   373   177     2 nKEi
   427   388   194     1 dMk
   427   407   214     1 kVy
   428   343   146     1 dTs
   428   372   176     2 nKEi
   428   387   193     1 dMk
   428   406   213     1 kVy
   429    49    67     1 lAh
   429    51    70     3 sTSGs
   429    65    87     2 pSRd
   429    93   117     4 dSSAAt
   429   107   135     1 sSe
   430    28    49     2 dVNi
   430    47    70     1 lRy
   430    49    73     2 fSHs
   430    56    82     1 pKv
   430    63    90     2 gFKd
   430    89   118     3 vGTQs
   430    91   123     2 lEKg
   430   107   141     1 pAs
   431    45    55     1 qYv
   431    48    59     1 sFd
   431    50    62     3 hGNSa
   431    57    72     1 gFs
   431    64    80     1 sKs
   431    92   109     2 dDSa
   431   109   128     1 sLr
   432    45    63     1 qYv
   432    48    67     1 rFy
   432    50    70     3 hTHSs
   432    52    75     1 pDs
   432    57    81     1 gFs
   432    64    89     1 sKs
   432    92   118     4 dRSADe
   432   108   138     1 sLr
   433    29    47     2 dSNs
   433    43    63     1 qYv
   433    46    67     1 rFh
   433    48    70     3 hGNNa
   433    55    80     1 gFs
   433    62    88     1 sKs
   433    90   117     3 dDSAe
   433   108   138     1 sLr
   434    41    52     1 rYl
   434    46    58     3 ySDSs
   434    60    75     1 gSk
   434    97   113     1 tGd
   435   268    53     1 sSs
   435   317   103    10 dILGTDVQKKDq
   435   324   120     1 pSr
   435   334   131     9 sSSSSCVKCEq
   436    44    66     1 qFv
   436    47    70     1 yFy
   436    49    73     3 hSHSs
   436    56    83     1 gFs
   436    63    91     1 sTh
   436    91   120     1 dGs
   436   109   139     1 sLp
   437    28    49     2 dVRi
   437    47    70     1 lRy
   437    49    73     3 fSHSd
   437    63    90     2 gSKd
   437    89   118     1 lGf
   437    91   121     1 qNs
   437   108   139     1 pKs
   438   249    33     2 lSWq
   438   296    82     1 hCd
   438   313   100     4 vFLTEp
   438   353   144     1 sDa
   438   356   148     2 gAPl
   438   387   181     1 kSy
   439   261    73     1 gTl
   439   270    83     2 tGYt
   439   369   184     1 eDk
   439   372   188     2 nTSi
   439   386   204     1 aSg
   439   406   225     1 kPf
   440   270    54     1 tYt
   440   335   120    10 gGGGSGGGGSGg
   440   350   145     1 lSa
   441    44    63     1 qFv
   441    49    69     3 iHSSs
   441    51    74     1 sPn
   441    56    80     1 gFs
   441    63    88     1 sTh
   441    91   117     4 dNSVNe
   441   107   137     1 sLp
   441   133   164     2 sILp
   442   341   144     1 dMn
   442   367   171     1 sSe
   442   370   175     1 gVi
   442   385   191     1 dKk
   442   404   211     1 rFy
   443   349   152     1 dTs
   443   378   182     2 nKEi
   443   393   199     1 dMk
   443   412   219     1 kVy
   444   348   149     1 dMn
   444   374   176     1 sSe
   444   377   180     1 gAi
   444   392   196     1 dKk
   444   411   216     1 rFy
   445   343   146     1 dMn
   445   369   173     1 sSe
   445   372   177     1 gVi
   445   387   193     1 dKk
   445   406   213     1 rFy
   446   345   148     1 dTs
   446   374   178     2 nKEi
   446   389   195     1 dMk
   446   408   215     1 kVy
   447   318   119     3 aWSEp
   447   350   154     1 dMn
   447   376   181     1 sSe
   447   379   185     1 gAi
   447   394   201     1 dKk
   447   413   221     1 rFy
   448   348   151     1 dTs
   448   377   181     2 nKEi
   448   392   198     1 nMt
   448   411   218     1 kVy
   449   319   104     7 lGFSTGKKq
   449   335   127     5 pHSHPMg
   449   360   157     1 qLq
   449   373   171     2 tLSl
   450   271    55     1 dGs
   450   324   109     1 gPg
   450   334   120    10 aDQNTGTQGGLs
   450   349   145     1 gLv
   450   367   164     1 iTt
   450   392   190     1 dGs
   451    45    65     1 qYv
   451    50    71     3 lHGNn
   451    52    76     1 aLe
   451    57    82     1 gFs
   451    64    90     1 sKs
   451    92   119     4 dDSARe
   451   108   139     1 sLr
   452    29    44     2 dSNs
   452    43    60     1 qYv
   452    46    64     1 gFh
   452    48    67     3 hAANi
   452    55    77     1 gFs
   452    62    85     1 sKs
   452    90   114     1 dDs
   452   108   133     1 sLr
   453    45    60     1 qYv
   453    50    66     3 dHGNn
   453    52    71     1 aLd
   453    57    77     1 gFs
   453    64    85     1 sKs
   453    92   114     4 dDSADe
   453   107   133     1 sLr
   454    45    66     1 qYv
   454    48    70     1 rFh
   454    50    73     3 hGANa
   454    57    83     1 gFs
   454    64    91     1 sKs
   454    92   120     4 dDSARe
   454   107   139     1 sLr
   455   270    54     4 sSSSYi
   455   320   108     1 vTr
   455   330   119     7 aRSKSQGSa
   455   345   141     1 gLv
   456   267    54     4 sGSSYk
   456   319   110     1 sHr
   456   329   121    10 tSTDSIFCSSSt
   457    44    65     1 qFv
   457    47    69     1 rFy
   457    49    72     3 hTWGs
   457    56    82     1 gFs
   457    63    90     1 sTh
   457    91   119     4 dSSVDe
   457   107   139     1 sLp
   458    45    63     1 qYv
   458    50    69     3 hHSDs
   458    52    74     1 sPs
   458    57    80     1 gFs
   458    64    88     1 sKs
   458    92   117     5 dDSARAa
   458   109   139     1 sLp
   459   270    54     1 dGg
   459   326   111     8 kPRLHGSLFp
   459   341   134     1 dVk
   460   270    73     2 hTAd
   460   331   136     8 tLSLICTVSg
   460   359   172     3 gYDGn
   461    43    62     1 qWv
   461    46    66     1 yFy
   461    48    69     3 hSWSs
   461    55    79     1 gFs
   461    62    87     1 sTh
   461    88   114     5 tRENNKa
   461   103   134     1 sLp
   462   261    68     1 gTi
   462   270    78     2 tGYt
   462   366   176     1 gDk
   462   369   180     2 nASy
   462   383   196     1 sSg
   462   403   217     1 eQf
   463    43    62     1 qYv
   463    46    66     1 rFy
   463    48    69     2 hGWt
   463    50    73     1 sVs
   463    55    79     1 gFs
   463    62    87     1 sNh
   463    90   116     1 dGs
   463    92   119     1 vNk
   463   108   136     1 sLp
   463   134   163     2 sILp
   464    44    63     1 qFv
   464    47    67     1 rFy
   464    49    70     3 hSNRs
   464    56    80     1 gFs
   464    63    88     1 sTh
   464    91   117     5 dSSATDn
   464   106   137     1 sLp
   465    29    48     1 dRr
   465    43    63     1 qYv
   465    46    67     1 rFy
   465    48    70     3 hSWSs
   465    55    80     1 gFs
   465    62    88     1 sNh
   465    89   116     2 eDSs
   465    91   120     1 vIe
   465   107   137     1 sLp
//